CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number	Anti-CRISPR protein number
NZ_JH815306	Simonsiella muelleri ATCC 29453 supercont1.7, whole genome shotgun sequence	0 crisprs	DinG	0	0
NZ_JH815305	Simonsiella muelleri ATCC 29453 supercont1.6, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815309	Simonsiella muelleri ATCC 29453 supercont1.10, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815307	Simonsiella muelleri ATCC 29453 supercont1.8, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815303	Simonsiella muelleri ATCC 29453 supercont1.4, whole genome shotgun sequence	0 crisprs	cas2,cas9	0	0
NZ_JH815301	Simonsiella muelleri ATCC 29453 supercont1.2, whole genome shotgun sequence	0 crisprs	NA	2	0
NZ_JH815325	Simonsiella muelleri ATCC 29453 supercont1.26, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815322	Simonsiella muelleri ATCC 29453 supercont1.23, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815319	Simonsiella muelleri ATCC 29453 supercont1.20, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815302	Simonsiella muelleri ATCC 29453 supercont1.3, whole genome shotgun sequence	0 crisprs	DEDDh	0	0
NZ_JH815304	Simonsiella muelleri ATCC 29453 supercont1.5, whole genome shotgun sequence	0 crisprs	DEDDh,c2c9_V-U4	2	2
NZ_JH815315	Simonsiella muelleri ATCC 29453 supercont1.16, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815318	Simonsiella muelleri ATCC 29453 supercont1.19, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815300	Simonsiella muelleri ATCC 29453 supercont1.1, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815320	Simonsiella muelleri ATCC 29453 supercont1.21, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815310	Simonsiella muelleri ATCC 29453 supercont1.11, whole genome shotgun sequence	0 crisprs	csa3	0	0
NZ_JH815327	Simonsiella muelleri ATCC 29453 supercont1.28, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815323	Simonsiella muelleri ATCC 29453 supercont1.24, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815313	Simonsiella muelleri ATCC 29453 supercont1.14, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815326	Simonsiella muelleri ATCC 29453 supercont1.27, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815312	Simonsiella muelleri ATCC 29453 supercont1.13, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815328	Simonsiella muelleri ATCC 29453 supercont1.29, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815321	Simonsiella muelleri ATCC 29453 supercont1.22, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815308	Simonsiella muelleri ATCC 29453 supercont1.9, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815324	Simonsiella muelleri ATCC 29453 supercont1.25, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815317	Simonsiella muelleri ATCC 29453 supercont1.18, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JH815311	Simonsiella muelleri ATCC 29453 supercont1.12, whole genome shotgun sequence	1 crisprs	NA	0	0
NZ_JH815316	Simonsiella muelleri ATCC 29453 supercont1.17, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JH815314	Simonsiella muelleri ATCC 29453 supercont1.15, whole genome shotgun sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

236045 : 311647

uncultured_Caudovirales_phage(15.62%)

head,portal,integrase,transposase,tail,tRNA,terminase,capsid,protease

attL 243935:243959|attR 271424:271448

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002641528.1\|236045_237350_-	DUF1983 domain-containing protein	A0A172Q098	Acinetobacter_phage	1.0e-26	37.0
WP_002641529.1\|237652_239283_-	hypothetical protein	A0A172Q096	Acinetobacter_phage	3.1e-09	34.4
WP_002641530.1\|239383_243420_-	carbohydrate binding domain-containing protein	Q9FZU3	Neisseria_meningitidis_phage	0.0e+00	64.7
WP_002641531.1\|243430_244150_-\|tail	tail assembly protein	Q9FZU4	Neisseria_meningitidis_phage	4.1e-62	54.3
243935:243959	attL	NA	NA	NA	NA
WP_002641532.1\|244270_244534_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002641533.1\|244578_244941_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002641534.1\|244937_245687_-	C40 family peptidase	Q9FZU5	Neisseria_meningitidis_phage	1.3e-58	47.1
WP_002641535.1\|245687_246404_-\|tail	phage minor tail protein L	Q9FZU6	Neisseria_meningitidis_phage	5.9e-69	64.8
WP_002641536.1\|246406_246718_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	8.8e-14	39.0
WP_002641537.1\|246721_250171_-\|tail	lambda family phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	1.2e-02	39.6
WP_040628715.1\|250163_250409_-	DUF1799 domain-containing protein	A0A2D1GP80	Escherichia_phage	1.1e-06	46.6
WP_002641538.1\|250486_250795_-	hypothetical protein	A0A0H5AUF4	Pseudomonas_phage	7.2e-08	35.9
WP_002641539.1\|250810_251452_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	6.0e-41	41.8
WP_002641540.1\|251491_251836_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_002641541.1\|251828_252299_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002641542.1\|252303_252621_-\|head	phage head closure protein	Q3HQT3	Burkholderia_phage	4.5e-05	37.5
WP_104930388.1\|252683_253097_-	hypothetical protein	A0A1B0VMK5	Pseudomonas_phage	2.4e-06	30.9
WP_002641544.1\|253189_253402_-	hypothetical protein	NA	NA	NA	NA
WP_002641545.1\|253456_253765_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002641546.1\|253761_254028_-	hypothetical protein	NA	NA	NA	NA
WP_002641547.1\|254043_255270_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	7.6e-109	52.1
WP_002641548.1\|255273_256107_-\|protease	Clp protease ClpP	Q3HQS9	Burkholderia_phage	9.9e-52	46.9
WP_002641549.1\|256199_257423_-\|portal	phage portal protein	Q3HQS8	Burkholderia_phage	2.3e-97	50.8
WP_002641552.1\|258291_259986_-\|terminase	terminase large subunit	A0A2H4J559	uncultured_Caudovirales_phage	1.4e-185	57.7
WP_002641553.1\|259985_260522_-\|terminase	terminase small subunit	A0A2H4J8R0	uncultured_Caudovirales_phage	3.1e-14	36.1
WP_002641554.1\|260686_260998_-	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	1.8e-22	58.4
WP_002641555.1\|261116_261482_-	sigma-70 region 4 domain-containing protein	NA	NA	NA	NA
WP_002641556.1\|261910_264688_-	hypothetical protein	A0A2H4JF22	uncultured_Caudovirales_phage	9.2e-78	33.0
WP_002641557.1\|264790_265360_-	KilA-N domain-containing protein	Q8SBE6	Shigella_phage	6.2e-21	53.4
WP_002641558.1\|265356_265545_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002641559.1\|265694_266357_+	LexA family transcriptional regulator	K7P850	Enterobacteria_phage	3.0e-19	33.8
WP_002641560.1\|266526_266862_+	hypothetical protein	NA	NA	NA	NA
WP_002641561.1\|266874_267396_-	hypothetical protein	NA	NA	NA	NA
WP_002641562.1\|267549_267693_+	hypothetical protein	NA	NA	NA	NA
WP_002641563.1\|267738_268026_+	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_002641564.1\|268064_269225_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	1.2e-92	47.0
WP_002641565.1\|269339_269804_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_002641567.1\|270572_271256_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_040628719.1\|271493_272501_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	A0A0E3FCK0	Synechococcus_phage	6.9e-07	38.5
271424:271448	attR	NA	NA	NA	NA
WP_155999532.1\|272589_274476_+	O-antigen ligase C-terminal domain-containing protein	NA	NA	NA	NA
WP_002641570.1\|274643_275330_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.7e-29	35.3
WP_169315043.1\|275690_275933_+	Fis family transcriptional regulator	NA	NA	NA	NA
WP_002641572.1\|275978_277943_-	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.3e-46	37.4
WP_002641573.1\|278048_279485_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.2e-27	27.5
WP_002641574.1\|279844_280405_-	FixH family protein	NA	NA	NA	NA
WP_002641575.1\|280479_281910_-	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
WP_002641576.1\|282101_283271_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_040628838.1\|283360_283678_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_002641578.1\|283890_284820_+	branched-chain amino acid transaminase	NA	NA	NA	NA
WP_002641579.1\|284872_285544_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_002641580.1\|285543_285732_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_002641581.1\|285923_286694_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_002641582.1\|286882_287437_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_002641583.1\|287482_287680_-	DUF2788 domain-containing protein	NA	NA	NA	NA
WP_002641584.1\|287775_288948_-	O-succinylhomoserine sulfhydrylase	NA	NA	NA	NA
WP_002641585.1\|289053_289248_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_002641586.1\|289594_291064_+	pyruvate kinase	NA	NA	NA	NA
WP_040628840.1\|291174_292599_-	sodium:proton antiporter	NA	NA	NA	NA
WP_155999534.1\|292695_292848_+	hypothetical protein	NA	NA	NA	NA
WP_002641588.1\|292967_293891_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	4.3e-56	42.0
WP_002641589.1\|293939_294398_+	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
WP_002641590.1\|294742_295252_+	cytochrome b	NA	NA	NA	NA
WP_040628723.1\|295303_295537_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_002641592.1\|295792_297082_+\|tRNA	histidine--tRNA ligase	A0A1V0SLE3	Klosneuvirus	1.9e-22	26.3
WP_002641593.1\|297084_297681_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_040628727.1\|297814_299284_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_002641595.1\|299315_300341_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_002641596.1\|300392_300740_-	hypothetical protein	NA	NA	NA	NA
WP_002641597.1\|300742_301867_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_002641598.1\|302252_303446_+	acetate kinase	NA	NA	NA	NA
WP_002641599.1\|303543_304209_-	beta-phosphoglucomutase	M1HXP3	Paramecium_bursaria_Chlorella_virus	9.7e-10	29.1
WP_104930386.1\|306328_306607_+	PIN domain-containing protein	NA	NA	NA	NA
WP_002641602.1\|306657_307242_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_002641603.1\|307486_308938_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	6.6e-19	27.1
WP_002641604.1\|309375_310296_+	pseudouridine synthase	NA	NA	NA	NA
WP_002641605.1\|310387_311647_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.5e-120	53.6

DBSCAN-SWA_2

357125 : 365915

Stenotrophomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002641648.1\|357125_357815_-	hypothetical protein	A0A0B5A6U7	Achromobacter_phage	1.3e-17	40.5
WP_002641649.1\|357831_358278_-	lysozyme	A0A0M5M782	Salmonella_phage	1.8e-31	52.1
WP_002641650.1\|358264_358636_-	hypothetical protein	NA	NA	NA	NA
WP_002641651.1\|358636_359104_-	hypothetical protein	NA	NA	NA	NA
WP_002641652.1\|359114_359348_-	hypothetical protein	NA	NA	NA	NA
WP_002641653.1\|359376_361176_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.7e-32	27.2
WP_002641654.1\|361179_361473_-	hypothetical protein	NA	NA	NA	NA
WP_002641655.1\|361473_362364_-	hypothetical protein	A0A2D2W2T7	Stenotrophomonas_phage	1.5e-10	29.0
WP_002641656.1\|362376_364071_-	hypothetical protein	A0A076G9K4	Pseudoalteromonas_phage	5.3e-52	31.2
WP_002641657.1\|364088_365915_-	hypothetical protein	B7SYE9	Stenotrophomonas_phage	3.1e-42	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_JH815304

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

139288 : 144834

Vibrio_phage(16.67%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051010367.1\|139288_139771_-	Rha family transcriptional regulator	Q8H9L9	Vibrio_phage	1.9e-15	41.6
WP_002642187.1\|139912_140440_-\|terminase	terminase small subunit	A0A0M3LSU1	Mannheimia_phage	3.9e-22	44.4
WP_002642188.1\|140436_141036_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104930440.1\|141066_141435_-	recombination protein NinB	Q7Y5V7	Haemophilus_phage	7.7e-33	62.7
WP_002642190.1\|141500_142052_-	recombination protein NinG	A0A2H4JGI2	uncultured_Caudovirales_phage	1.5e-35	46.7
WP_002642191.1\|142092_142620_-	hypothetical protein	NA	NA	NA	NA
WP_002642192.1\|142917_143184_-	hypothetical protein	NA	NA	NA	NA
WP_002642193.1\|143170_143437_-	hypothetical protein	NA	NA	NA	NA
WP_002642194.1\|143433_143592_-	hypothetical protein	NA	NA	NA	NA
WP_002642195.1\|143639_144479_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	1.4e-29	34.2
WP_169315046.1\|144489_144834_-	hypothetical protein	F8TUJ5	EBPR_podovirus	1.5e-09	48.5

DBSCAN-SWA_2

202207 : 212940

Pseudomonas_phage(33.33%)

integrase,transposase

attL 191407:191426|attR 209298:209317

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
191407:191426	attL	NA	NA	NA	NA
WP_040629062.1\|202207_203047_-	DNA adenine methylase	A0A0R6PH56	Moraxella_phage	1.3e-83	53.1
WP_002642255.1\|203178_203532_-	hypothetical protein	NA	NA	NA	NA
WP_002642256.1\|203528_204023_-	hypothetical protein	NA	NA	NA	NA
WP_002642257.1\|204603_204972_-	helix-turn-helix transcriptional regulator	A0A1S5NPU3	Burkholderia_phage	4.3e-07	37.5
WP_002642258.1\|205089_205266_+	DNA-binding protein	Q5ZQZ9	Pseudomonas_phage	2.7e-12	57.9
WP_002642259.1\|205404_207528_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0M3LPN5	Mannheimia_phage	1.6e-101	36.1
WP_002642260.1\|207569_208469_+	AAA family ATPase	A0A0M3LP72	Mannheimia_phage	1.4e-43	36.3
WP_104930374.1\|208630_208843_+	hypothetical protein	NA	NA	NA	NA
WP_002642262.1\|208896_209067_+	hypothetical protein	NA	NA	NA	NA
WP_002642264.1\|209559_210093_+	hypothetical protein	L7P7I4	Pseudomonas_phage	4.1e-27	41.3
209298:209317	attR	NA	NA	NA	NA
WP_002642265.1\|210089_210308_+	hypothetical protein	NA	NA	NA	NA
WP_002642266.1\|210483_210918_+	regulatory protein GemA	A0A0M3LP80	Mannheimia_phage	2.2e-18	42.0
WP_002642267.1\|210908_211361_+	hypothetical protein	A0A0A7DJP6	Pseudomonas_phage	1.7e-13	31.7
WP_002642268.1\|211500_211743_+	hypothetical protein	NA	NA	NA	NA
WP_155999587.1\|211775_211931_+	hypothetical protein	NA	NA	NA	NA
WP_002642269.1\|211927_212137_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002642270.1\|212289_212940_+	hypothetical protein	E2GM11	Acinetobacter_phage	1.4e-48	51.3

Anti-CRISPR protein detection

Acr_ID: NZ_JH815304.1|WP_002642161.1|112350_112743_-|anti-CRISPR-protein-AcrIIC5

Click the colored protein region to show detailed information

Acr_ID: NZ_JH815304.1|WP_002642162.1|112970_113387_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_JH815304.1|WP_002642161.1|112350_112743_-|anti-CRISPR-protein-AcrIIC5

112350_112743_-

130 aa aa

AcrIIC5

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0554\|WP_002642161.1\|AcrIIC5\|II-C\|Verified\|Simonsiella-muelleri	1.0	1	1.0

NZ_JH815304.1_111867_112296_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_JH815304.1_111867_112296_-	WP_002642160.1	1.0	1	1.0

NZ_JH815304.1|WP_002642162.1|112970_113387_-|hypothetical-protein

112970_113387_-

138 aa aa

NZ_JH815304.1_111867_112296_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_JH815304.1_111867_112296_-	WP_002642160.1	1.0	1	1.0

3. NZ_JH815311

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_JH815311_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_JH815311_1

12891-12973

Orphan

Consensus_repeat	Method
GAAGACGTGAAAAATCAAACCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_JH815311_1

>merge|NZ_JH815311|1|12891-12973|CRISPRCasFinder
GAAGACGTGAAAAATCAAACCACACAGGCTGTGGAAACCAAAACTGAAAAAACTACTGCTGAAGACGTGAAAAATCAAACCAC

>NZ_JH815311|1|1|12891-12973|CRISPRCasFinder
GAAGACGTGAAAAATCAAACCAC	ACAGGCTGTGGAAACCAAAACTGAAAAAACTACTGCT
GAAGACGTGAAAAATCAAACCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_JH815311.1\|WP_002642961.1\|24558_25530_-\|putative-transporter	unknown	unknown	gnl\|CDD\|283613
NZ_JH815311.1\|WP_002642955.1\|17609_18728_+\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_JH815311.1\|WP_002642946.1\|11925_12372_+\|hypothetical-protein	unknown	unknown	unknown
NZ_JH815311.1\|WP_002642959.1\|22430_23987_+\|L-lactate-permease	unknown	unknown	gnl\|CDD\|224535
NZ_JH815311.1\|WP_081579000.1\|617_965_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_JH815311.1\|WP_002642939.1\|2067_3441_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	unknown	unknown	gnl\|CDD\|235392
NZ_JH815311.1\|WP_002642957.1\|19912_20611_+\|lactate-utilization-protein-C	unknown	unknown	gnl\|CDD\|224473
NZ_JH815311.1\|WP_002642943.1\|6766_7471_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|381176
NZ_JH815311.1\|WP_155999641.1\|850_1903_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271177
NZ_JH815311.1\|WP_002642942.1\|5868_6582_+\|hypothetical-protein	unknown	unknown	unknown
NZ_JH815311.1\|WP_002642944.1\|7812_8853_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176246
NZ_JH815311.1\|WP_002642952.1\|14974_15766_-\|phosphatidate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|366491
NZ_JH815311.1\|WP_002642958.1\|20749_22192_+\|iron-sulfur-cluster-binding-protein	unknown	unknown	gnl\|CDD\|224062
NZ_JH815311.1\|WP_002642954.1\|16616_17498_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_JH815311.1\|WP_104930425.1\|9204_10941_-\|outer-membrane-protein-assembly-factor	unknown	unknown	gnl\|CDD\|223801
NZ_JH815311.1\|WP_002642953.1\|15898_16534_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
NZ_JH815311.1\|WP_002642940.1\|3548_4469_+\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|223597
NZ_JH815311.1\|WP_002642941.1\|4767_5832_+\|phosphate-acyltransferase-PlsX	unknown	unknown	gnl\|CDD\|235414
NZ_JH815311.1\|WP_002642960.1\|24089_24527_+\|DUF4189-domain-containing-protein	unknown	unknown	gnl\|CDD\|372741
NZ_JH815311.1\|WP_002642956.1\|19160_19916_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325

Protein	Function_ID	Function_description	E-value
NZ_JH815311.1\|WP_002642961.1\|24558_25530_-\|putative-transporter	gnl\|CDD\|283613	pfam05992, SbmA_BacA, SbmA/BacA-like family. The Rhizobium meliloti bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R. meliloti and alfalfa. An Escherichia coli homolog of BacA, SbmA, is implicated in the uptake of microcins and bleomycin. This family is likely to be a subfamily of the ABC transporter family.	1.98756e-159
NZ_JH815311.1\|WP_002642955.1\|17609_18728_+\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	0
NZ_JH815311.1\|WP_002642959.1\|22430_23987_+\|L-lactate-permease	gnl\|CDD\|224535	COG1620, LldP, L-lactate permease [Energy production and conversion].	3.34862e-99
NZ_JH815311.1\|WP_081579000.1\|617_965_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	2.74172e-10
NZ_JH815311.1\|WP_002642939.1\|2067_3441_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	gnl\|CDD\|235392	PRK05291, trmE, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE.	0
NZ_JH815311.1\|WP_002642957.1\|19912_20611_+\|lactate-utilization-protein-C	gnl\|CDD\|224473	COG1556, COG1556, Uncharacterized conserved protein [Function unknown].	5.86694e-50
NZ_JH815311.1\|WP_002642943.1\|6766_7471_+\|SAM-dependent-methyltransferase	gnl\|CDD\|381176	cd11649, RsmI_like, uncharacterized subfamily of the tetrapyrrole methylase family similar to Ribosomal RNA small subunit methyltransferase I (RsmI). RsmI, also known as rRNA (cytidine-2'-O-)-methyltransferase, is an S-AdoMet (S-adenosyl-L-methionine or SAM)-dependent methyltransferase responsible for the 2'-O-methylation of cytidine 1402 (C1402) at the P site of bacterial 16S rRNA. Another S-AdoMet-dependent methyltransferase, RsmH (not included in this family), is responsible for N4-methylation at C1402. These methylation reactions may occur at a late step during 30S assembly in the cell. The dimethyl modification is believed to be conserved in bacteria, may play a role in fine-tuning the shape and functions of the P-site to increase the translation fidelity, and has been shown for Staphylococcus aureus, to contribute to virulence in host animals by conferring resistance to oxidative stress.	6.92119e-128
NZ_JH815311.1\|WP_155999641.1\|850_1903_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	8.50809e-40
NZ_JH815311.1\|WP_002642960.1\|24089_24527_+\|DUF4189-domain-containing-protein	gnl\|CDD\|372741	pfam13827, DUF4189, Domain of unknown function (DUF4189). This domain of unknown function contains six well-conserved cysteine residues.	0.00145519
NZ_JH815311.1\|WP_002642944.1\|7812_8853_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176246	cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NZ_JH815311.1\|WP_002642952.1\|14974_15766_-\|phosphatidate-cytidylyltransferase	gnl\|CDD\|366491	pfam01148, CTP_transf_1, Cytidylyltransferase family. The members of this family are integral membrane protein cytidylyltransferases. The family includes phosphatidate cytidylyltransferase EC:2.7.7.41 as well as Sec59 from yeast. Sec59 is a dolichol kinase EC:2.7.1.108.	5.51163e-56
NZ_JH815311.1\|WP_002642958.1\|20749_22192_+\|iron-sulfur-cluster-binding-protein	gnl\|CDD\|224062	COG1139, COG1139, Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion].	0
NZ_JH815311.1\|WP_002642954.1\|16616_17498_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	4.29958e-30
NZ_JH815311.1\|WP_104930425.1\|9204_10941_-\|outer-membrane-protein-assembly-factor	gnl\|CDD\|223801	COG0729, COG0729, Outer membrane protein [Cell envelope biogenesis, outer membrane].	3.22418e-97
NZ_JH815311.1\|WP_002642953.1\|15898_16534_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	8.96094e-50
NZ_JH815311.1\|WP_002642940.1\|3548_4469_+\|GTP-binding-protein	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	3.55306e-70
NZ_JH815311.1\|WP_002642941.1\|4767_5832_+\|phosphate-acyltransferase-PlsX	gnl\|CDD\|235414	PRK05331, PRK05331, phosphate acyltransferase PlsX.	1.15152e-170
NZ_JH815311.1\|WP_002642956.1\|19160_19916_+\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	8.18656e-51

>NZ_JH815311.1|WP_002642946.1|11925_12372_+|hypothetical-protein
MRLFQYVGMLLVGLVLAACGSNGTSQAVRNAPKVAGSWKPLGNVNNGNIVVSYDAGSLKKNGNLAWLRDRKIVINPQRERYSDTPYFKVAVSDWEFNCKNHSFRLTAVQFLDDKGKIVSQERYTTNPIPPMPIQRGTMADRQFAVACR
>NZ_JH815311.1|WP_104930425.1|9204_10941_-|outer-membrane-protein-assembly-factor
MVQEKELTPKYPIKVHTEKQEITELLEKHLPIISYQKREEMDDEQISYLVEDTPKDVQNLVRTEGYFNAKTQITPQPEKKGYRVDVNLGKQTVIDNVNVALVGDVLQDNALASYYKQALSGWKLPVGAQFRQEDWGASKVSVLGAVTRKKYPLARLSQTQATINPNTQTADLNVMVDSHQPIYFGDLQISGNQRYPQSVISGLADFKAGDAYDLDKLLDYQQALESDSHYSGASVQADFDAMVNDRVPVKVAVSEVKRQKVEAGLSFDSEYGLGGKLSYDHYNLFNRGYVGSVSVEADKYQTLFGLGISQPRDAKGQYFTSNVSYNRSTTQNLEKRAISSGVWHVHDKNDTELRYGIEFIGEDSRVPDENIELGKSFATMLTVQWKRHNLETQMRPQNGYYADVKLGTTLGKVLSSAMMMRGVASGGYYFTPENKKLGTLVTRGNIGYVYTNKDEVNGEVPTSLMFRTGGASTVRGYELDSIGWRVPNSNTVLPERAMAVASVEYQYPIQKKLMGQEFAVAVFHDVGGTSETFQDIKWKHGTGLGLRWYSPVAPFSFDLAYGHQDKKLRWHISLGTRF
>NZ_JH815311.1|WP_002642944.1|7812_8853_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MKAMVYYGENDIRFEEHAKPTLIESTDAIVRITKTTICGTDLGIWKGKNPEIDAGRILGHEGIGIVEEVGAGVKNIKVGDKVIISCVSKCCTCDNCKQQLYSHCRNGGWILGYMIDGTQAEFVRTPYADNSLIVLPDSVNEEVALLLSDALPTAHEIGVQYGDVKPGDTVFIAGAGPVGMSALLTAQLYSPATLIVCDMDENRLKLAKELGATHTINPVSGDVSKQVFDIVGQDGVDVAIEAVGLPATWDLCQEIVKAGGNLAVVGVHGKPVDFKLEKLWIKNLKITTGLVNANTTEMLMKAISTSSVDYTKMLTHHFKFSELEQAYDVFKHAAEHNAMKVVLTMD
>NZ_JH815311.1|WP_002642943.1|6766_7471_+|SAM-dependent-methyltransferase
MPTLYLIPTPLGAPDAPCLLPHELVQISHLTDFIVEAEKTARAHLKHFVSTPIRELNLQTLNEHTPTNDVVALLQPLRDGRDMGLVSEAGCPAIADPGAQAVALAHREGFEVKPLVGATSIVLALMASGANGQSFAFKGYLPVDKDGRSGSLKTLEMRSRQTQETQIFIETPYRNDALLADALAVLQPETRLCVACDLTLPSQQIISKTVADWRKLAQLPNLKKRPAIFVLHAG
>NZ_JH815311.1|WP_002642942.1|5868_6582_+|hypothetical-protein
MKHKAAILLMCVVTTLAQAQHNDIIDLNEDTDGELVAKQVQTYYQHPDVKHAFELSNQLIDLPVFETQSQARLNTWLWGAQIIKQHPFRTRSWCKKMKEKHQHADIAPFFQFADTSSAKRCLKSLELTESERYELSQLPDLKEPLNRELLSPSDLDVLWTTFFATGNPQAIHKLVDLVINHQANNRNQNQNLTYMAARWSLQSNMKQDAQIRKIVNDYVRSLAPSQQQFAKNSLDLS
>NZ_JH815311.1|WP_002642941.1|4767_5832_+|phosphate-acyltransferase-PlsX
MITLSVDAMGGDIGLGVTAPAAAAFLAKQTDANLIMVGDAQSIHAALAAVNAPLNRIEIIHATQVVEMDEAPQSALKNKKDSSMRVAIEQVKNGKAQAAVSAGNTGALMATARFVLKTLNGIERPAIAKFLPAQNGHLTLMLDLGANADCTAEQLFQFAVMGSELVAALKPEKVPARVGLLNIGTEDIKGTEAVKQTFKLLKDSNLNFIGNIEGNSVFTGEVDVVVADGFVGNIVLKTIEGAVKFMGNEIRTEFHRNLWTKLGGVAAKPALNGFKQKLDPRRFNGAIFLGLRGVVIKSHGGTDAVGFAYALEEAFHEAQADSLHKIEQSVATQLTQFQEKKMLAEQASMTGSEV
>NZ_JH815311.1|WP_002642940.1|3548_4469_+|GTP-binding-protein
MKTQVHLFSGFLGTGKTTAIRSLIEQKPESEQWLIIVNEFGEIGIDGAVLSDNGIPVAEISGGCLCCTAGAQMGDTVKKMLKQNQPHRMLIEASGLAHAAGVIDELKAPEFQDKLDIAAVFTVVDPRQFIDPNYANHALYKDQICVCDVLLASKIDLCTPEQLAQFRVQAAQLFPPKSLIVEVENSQVKLEWLNTPTTEKSRYRIKTLPENTMGYQSQGFTFPAGRNFDGEKITNFFNELPKLAQDLVRAKGVFQVLDTWVWLNWVDGQWGANQVSWRRDSRFELIAKSFDTDEIERRLNDALEKK
>NZ_JH815311.1|WP_002642939.1|2067_3441_-|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE
MNTTHSPTIAAIATASGRGGVGVIRLSGKDLLPFVQRITGGKIPKPRTALYTDFLDAHGKTIDNGLLLYFAAPASFTGEDVIELQGHGGQIVLQMLLQRCLELGARIAEAGEFTKRAFLNNKIDLAQAESVADLIDASSQQAARMAIRSLKGEFSNQIHQLVEDLITLRMLVEATLDFPEEDIDFLQSADAKGKLRALQNQLAHILTNAQQGAILREGMTVVLVGAPNVGKSSLLNALAGDDVAIVTDIAGTTRDTVREQITLDGIPIHMIDTAGLRQTNDIVEKIGIERSEKAVQNADIALILIDPDNGVNETTREILFRLPENLKRIEIQNKIDLRNEQPERVDNLSGSLKSGADTLIKLSAKTGAGLDLLKQALLAQIGWQGESEGLFLARTRHLNALETAQFELNLAADCGHHQIELLAEHLRLAQMACSEITGEFTADDLLGVIFSRFCIGK
>NZ_JH815311.1|WP_155999641.1|850_1903_+|tyrosine-type-recombinase/integrase
MYQRDGVWYLDIRAGNQRIRRSTGTSDKAKAQAYRVQLEHEIWQQQHLGVLPKHLWDEAAAKWIKEKQDKKSIEDDICRIRQLTALRGRYLQDLDRKTIMKVVSELPCSNSTKNRYLALIRSILNKCVNEWDWLSKAPKLTLYKEPKKRIRWLKPQEAQKLVHAFENLPYMQHMIIFSLVTGLRQNNVLNLKWEQIDLKRRIAWIYPDETKNSQALGVPLNQVALQVLAVRQKTTPFVFNNSKGQPVKAVSHRIWRKGLKEAGISNFKWHDLRHTWASWLVQSGVPLLALKEMGGWESLEMVQKYAHLSSQHLQDHADNLLLNWDTIWTQSKKSDNSGTKEKSLNNCLGL
>NZ_JH815311.1|WP_081579000.1|617_965_+|helix-turn-helix-domain-containing-protein
MKTYTVTEAAKLAHCHPETLREYIRAGKLVAAKIGRAYCIRQAKLDEFLQSLENDVVQTSLQQRSEQQCPKSKVKTKVSTRETAFGILTSEQAISELDALLAPATRRRLKRTECS
>NZ_JH815311.1|WP_002642952.1|14974_15766_-|phosphatidate-cytidylyltransferase
MLKQRILTALILLPIMLLMLLWANQAIWGLFCGLIALLALWEYGRIVGFSRTTQRSYLIGTAFFLLTALMGDWALPAFVWLLALAFWLVVMPMWLRKKWIPQDVWAMACGWLLMLPFWFGMLLLRPENESVASLLSVMLLVWIADSGAYFVGRAWGKHKLAPVISPKKSWEGAIGGWIIVLIYMCWAREWGWLGVKMSWFGTMLLSTILVAVSIGGDLLESWLKRAHGVKDSSQLLPGHGGVFDRIDSLIAVIVVYSAMMVLW
>NZ_JH815311.1|WP_002642953.1|15898_16534_+|N-acetylmuramoyl-L-alanine-amidase
MKFLIKVALLLFCTIHVAWAASIVIDAGHGGHDPGAKRTFDGVTYLEKNLTLKISQQVAQEFRTHGHDVAMTRTKDQFLNLNTRLLKGRQLCQNAFISVHIDASRQEKQTQAQGATVHVYPTANTRTRKIAQATQRALNPKRRYKISRFRVIRDKKPSCVSMLVEMGYLNNPNDLKKLNDPKYQREISKKLAQSVSNGLTKYKNYAILNSI
>NZ_JH815311.1|WP_002642954.1|16616_17498_+|IS982-family-transposase
MPQDEFIIKTYLMVDALYNQLVQKPLRQGGFAPKLSDCELICMEIVGEFLGMDTDKKIWQYFKQHWQNWVPNLGSYPNFAKQCANLYWVKQQMHQKITANWCEQTEYYADAFPIAVCKFARAKRHQNFRAYATFGYYASKKETYYGFKGHLLITRSGMIKAFTFTAANVDERQVLPELLEGKTGFVGADKGYLSSELKDEMKQSHINLQTPYRSNMKDDRSPQFLKWLKNSRRIIETVIGQLTERFNMEIVRTKNLFHQSNRFIRKILSHNFCCLLNQQIQHPITQFAGLIGC
>NZ_JH815311.1|WP_002642955.1|17609_18728_+|glycerate-kinase
MKIVIATDSFKESLTAPQACAAIQRGFAKIAPNVQYVQIPMADGGEGTAAALVSACGGEWVNVRVSDPLGRQVLAKYGVLPNGTAVMEIAEAAGLHLLTPAERNPMKTSTYGVGEMIADALGRGIKRIILGIGGSATNDGGAGMAQALGFRLLDKAGRDLPRGGAALRYLAAVNTSSSLYELDDCEIVAACDVVNPLCGDSGASAVFGKQKGANIQMVRELDTALTNFADVLARNGTDFRDEAGSGAAGGLGFGLRALLGAQLRSGIDIVLEVTELANKISGADLVITGEGCMDGQTTFGKAPLGVLRVAQEYGVPVVGLAGSVADVDELYALGFAAVFPSIDRVASLPDVLANAEQNVERTARAIAAIWAL
>NZ_JH815311.1|WP_002642956.1|19160_19916_+|(Fe-S)-binding-protein
MNTNSTKPTDIYFFGTCVLDMFMPEAGMDAITLIEQQGIKVHFPMEQSCCGQPAYSSGHPKEAFEVAKAQLDLFPENYPIVVPSGSCGGMMALHWRKLFAGSEYETKANQIADRVVEFTHFLLNIGYEPKDQGEPIKVAVHTSCAARREMDVHTSGWKLIDSLQNVERVVHDHESECCGFGGTFSVKHSNISGAMVTDKVQALKDTGATAIVSADCGCMMNIGGKIAKDEPNMPRPQHIASFLLKRTGGKA
>NZ_JH815311.1|WP_002642957.1|19912_20611_+|lactate-utilization-protein-C
MSAARYNILNKLKAANATVLREPEVAEYYAEMTPTWESDVARLKHWAKTMRAVKTEIFWVTEKNWTDVLNQVIEQKNLQNILLPTQTESGKKAIKAVQAAGKAQVKHFDRVIEDWKDEFFADIQAGFTDVRCGIAHTGTVMLFPTPAEPRTQSLVPPVHIALFDASKMYDTFYAAMIGEKMAEDMPTNVVLVSGPSKTADIQLTLAYGAHGPKDMVILAILPKGVKAEDLAE
>NZ_JH815311.1|WP_002642958.1|20749_22192_+|iron-sulfur-cluster-binding-protein
MTTQTVHFYPETFKQNAEVALADKPLRKSLRTAMDMLMTKRKAVLSDEHELQLLRDLCSHVRKRSLSRLPELLEQLESNLTKLGVKVHWAETPLEACQIIHGIIGDHQGKLMVKGKSMVSEEVELNHYLADHGVQAIESDLGEYIVQMAGEKPTHIVMPAIHKTKEQVSELFHKNIGTELTDDVDKLTGFARMALRDIYRTADVGLSGVNFAVAETGTLCLVENEGNGRLTTSVPPVHIAITGIEKVVAKLTDVVPLYSQLPRTAIGQNITTYFNMITGPRRSEELDGPQEMHLVLLDNGRTQAYVEEQMRQTLQCIRCGACMNHCPVYSRVGGAAYGTTYPGPIGEILSPHLLGLDKTRDLPTACSMCGACVEVCPVKIPITEQMQRLRVEAQRSPDEVVPHPIKGQGASHSLGEQLSWRIFDGLFSGKKSYMALGWTITKFRNLTPSWQFDWTKNHVPMKPAEKTLHQLMKEKLANKN
>NZ_JH815311.1|WP_002642959.1|22430_23987_+|L-lactate-permease
MSIFLSIFPILLLIVLMIGFKMRGDHSAMLAVLSAVLIAIFAVPNLAGFTPPEGYNAGYVGWAFVEGILKAVFPILIVILMALFSYNVLLESKQIEVIKQQFTNISGDKRIQVLLIVWGFGGLLEGMAGFGTAVAIPAAILIGLGFSPRFAALVSLIGNSVATGFGAVGIPVITLAKEVFGSTVTAEQTHAIAGDVVIQLGLLMFLVPFVILTLTDTAKKYILPNVILSAVVGGLSLAVQFVSAYFIGAETPAILGSIACIVFIVLYAKLTEKKETPADKVITGKQMAKAWAVYGFILFFIIMASPLSGPISAFLKSTLVSKIHLPIYAEGKAFSFGWLSNAGLMLFLGAFIGGLVQGVSASKLFQILGQTLIKMKSSGITVISLVAMSAIMSHSSMIAVIAKGLVDATGTLYPLVAPLVGAIGTFATGSDTSSNILFGKLQASVADQLGMDKAWLAAANTAGATGGKIISPQSIAIATAACEQQGQEGAFLRSAMPYAAVYVIIAGITVYCFTTLAL
>NZ_JH815311.1|WP_002642960.1|24089_24527_+|DUF4189-domain-containing-protein
MMIRCIFCLLLCAVSPLAVAETHGYLGFWHNPNDPLTVPETKTTQENNNREDARAEIEQFCSKQDKSLKNGQSGCFSITPLHDTCAAVAWSRKRGLMSPDNIVISIHPKFQKVAKLASKACRKQFGWFARCEIETVYCTDKQMYE
>NZ_JH815311.1|WP_002642961.1|24558_25530_-|putative-transporter
MFKSFFGNRKWWAWSLGGSLIILLATWYRVELDVQINQWFGEFYDTIQQVLKKPNSMTFPDFMKLLLKFAQIAGISMIVAVLGDFFGRHYIFRWREAMTEYYQSHWEKVRHIEGSSQRIQEDTMRFAKIMETLGVSFLQAILTLIAFLPLLWELSKQVTQMPWIGYVDHALVYVALLFSLAGTVILAVVGIKLPGLEFNNQKVEAAYRKELVLGEDHIDRAQLSVLKDLFEDIRKNNYRLYWHYMYFDLARWSYLQFAVIVPYIALAPSLLMGLLTLGTLQQIVRAFNKVQDSFQFLVQSWTTIVELLSIYKRLKGFEQQIRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_JH815317

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8031 : 13577

Vibrio_phage(16.67%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051010367.1\|8031_8514_-	Rha family transcriptional regulator	Q8H9L9	Vibrio_phage	1.9e-15	41.6
WP_002642187.1\|8655_9183_-\|terminase	terminase small subunit	A0A0M3LSU1	Mannheimia_phage	3.9e-22	44.4
WP_002642188.1\|9179_9779_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104930440.1\|9809_10178_-	recombination protein NinB	Q7Y5V7	Haemophilus_phage	7.7e-33	62.7
WP_002642190.1\|10243_10795_-	recombination protein NinG	A0A2H4JGI2	uncultured_Caudovirales_phage	1.5e-35	46.7
WP_002643095.1\|10835_11363_-	hypothetical protein	NA	NA	NA	NA
WP_002642192.1\|11660_11927_-	hypothetical protein	NA	NA	NA	NA
WP_002642193.1\|11913_12180_-	hypothetical protein	NA	NA	NA	NA
WP_002642194.1\|12176_12335_-	hypothetical protein	NA	NA	NA	NA
WP_002642195.1\|12382_13222_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	1.4e-29	34.2
WP_169315046.1\|13232_13577_-	hypothetical protein	F8TUJ5	EBPR_podovirus	1.5e-09	48.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_JH815301

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_JH815304

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

3. NZ_JH815311

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_JH815317

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection