CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_ANDK01000013	Streptococcus agalactiae CCUG 44110 ctg120003703675, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000035	Streptococcus agalactiae CCUG 44110 ctg120003703697, whole genome shotgun sequence	1 crisprs	cas9,cas1,cas2,csn2	10	1	0
NZ_ANDK01000005	Streptococcus agalactiae CCUG 44110 ctg120003703664, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000032	Streptococcus agalactiae CCUG 44110 ctg120003703694, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000008	Streptococcus agalactiae CCUG 44110 ctg120003703670, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000021	Streptococcus agalactiae CCUG 44110 ctg120003703683, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000024	Streptococcus agalactiae CCUG 44110 ctg120003703686, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000007	Streptococcus agalactiae CCUG 44110 ctg120003703669, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000033	Streptococcus agalactiae CCUG 44110 ctg120003703695, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000009	Streptococcus agalactiae CCUG 44110 ctg120003703671, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000031	Streptococcus agalactiae CCUG 44110 ctg120003703693, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_ANDK01000003	Streptococcus agalactiae CCUG 44110 ctg120003702791, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000028	Streptococcus agalactiae CCUG 44110 ctg120003703690, whole genome shotgun sequence	0 crisprs	DinG	0	0	0
NZ_ANDK01000006	Streptococcus agalactiae CCUG 44110 ctg120003703668, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000004	Streptococcus agalactiae CCUG 44110 ctg120003702926, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000001	Streptococcus agalactiae CCUG 44110 ctg120003702603, whole genome shotgun sequence	1 crisprs	NA	0	0	0
NZ_ANDK01000016	Streptococcus agalactiae CCUG 44110 ctg120003703678, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000022	Streptococcus agalactiae CCUG 44110 ctg120003703684, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000017	Streptococcus agalactiae CCUG 44110 ctg120003703679, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000020	Streptococcus agalactiae CCUG 44110 ctg120003703682, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000027	Streptococcus agalactiae CCUG 44110 ctg120003703689, whole genome shotgun sequence	1 crisprs	csm6	0	1	0
NZ_ANDK01000014	Streptococcus agalactiae CCUG 44110 ctg120003703676, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_ANDK01000034	Streptococcus agalactiae CCUG 44110 ctg120003703696, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_ANDK01000012	Streptococcus agalactiae CCUG 44110 ctg120003703674, whole genome shotgun sequence	0 crisprs	csa3	0	0	0
NZ_ANDK01000010	Streptococcus agalactiae CCUG 44110 ctg120003703672, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000025	Streptococcus agalactiae CCUG 44110 ctg120003703687, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000023	Streptococcus agalactiae CCUG 44110 ctg120003703685, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_ANDK01000018	Streptococcus agalactiae CCUG 44110 ctg120003703680, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_ANDK01000030	Streptococcus agalactiae CCUG 44110 ctg120003703692, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000029	Streptococcus agalactiae CCUG 44110 ctg120003703691, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_ANDK01000002	Streptococcus agalactiae CCUG 44110 ctg120003702727, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000026	Streptococcus agalactiae CCUG 44110 ctg120003703688, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_ANDK01000015	Streptococcus agalactiae CCUG 44110 ctg120003703677, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_ANDK01000019	Streptococcus agalactiae CCUG 44110 ctg120003703681, whole genome shotgun sequence	0 crisprs	NA	0	0	1
NZ_ANDK01000011	Streptococcus agalactiae CCUG 44110 ctg120003703673, whole genome shotgun sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

85754 : 96026

Streptococcus_phage(57.14%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000721268.1\|85754_87899_-	LTA synthase family protein	W6LM83	Streptococcus_phage	6.3e-260	67.5
WP_001037596.1\|88033_89191_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.3e-139	66.0
WP_000707048.1\|89190_89868_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	5.3e-88	68.4
WP_001195736.1\|89961_91029_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_001269901.1\|91029_92196_+	chorismate synthase	A0A291AU41	Pandoravirus	9.3e-40	34.1
WP_000024620.1\|92279_92615_+	YlbF/YmcA family competence regulator	A0A1X9I5Y8	Streptococcus_phage	8.9e-20	39.4
WP_000043887.1\|92789_94139_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-32	25.5
WP_000033715.1\|94181_94634_-	hypothetical protein	NA	NA	NA	NA
WP_000638889.1\|94880_96026_+	cysteine desulfurase	A0A1X6WFP1	Pacmanvirus	4.3e-29	28.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_ANDK01000035

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ANDK01000035_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ANDK01000035_1

88533-88965

TypeII

II-A

Consensus_repeat	Method
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACAT	PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CRISPRCasFinder
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CRT
TTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACG	PILER-CR

6 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_ANDK01000035_1

>merge|NZ_ANDK01000035|1|88533-88965|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACATTTGACTTAGTGTCAACGTAAATTGTCGCGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTTGGATAAAACTATTGTTAATAGAGCTAAAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCTGTTATATCAACAATTACCAAGTCTGCTGGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAAGGAATGGAAGACGAAAGAATGAAATTAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTGAGCATAAAGTATATTGTCTTACGACATTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAACATGAAAGATTTTAAAAAAGAACATTTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACG

>NZ_ANDK01000035|1|1|88533-88702|PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACAT	TTGACTTAGTGTCAACGTAAATTGTCGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTT	GGATAAAACTATTGTTAATAGAGCTAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCTGTTATATCAACAATTACCAAGTCTGCTGGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAAGGAATGGAAGACGAAAGAATGAAATTAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTGA	GCATAAAGTATATTGTCTTACGACATT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAA	CATGAAAGATTTTAAAAAAGAACATTT


>NZ_ANDK01000035|1|1|88533-88964|CRISPRCasFinder
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATTTGACTTAGTGTCAACGTAAATTGTCGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTGGATAAAACTATTGTTAATAGAGCTAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CTGTTATATCAACAATTACCAAGTCTGCTG
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	GAAGGAATGGAAGACGAAAGAATGAAATTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TGAGCATAAAGTATATTGTCTTACGACATT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	GAACATGAAAGATTTTAAAAAAGAACATTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC

>NZ_ANDK01000035|1|1|88533-88964|CRT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATTTGACTTAGTGTCAACGTAAATTGTCGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTGGATAAAACTATTGTTAATAGAGCTAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CTGTTATATCAACAATTACCAAGTCTGCTG
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	GAAGGAATGGAAGACGAAAGAATGAAATTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TGAGCATAAAGTATATTGTCTTACGACATT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	GAACATGAAAGATTTTAAAAAAGAACATTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC

>NZ_ANDK01000035|1|2|88797-88965|PILER-CR
	TTGACTTAGTGTCAACGTAAATTGTCGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTT	GGATAAAACTATTGTTAATAGAGCTAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCTGTTATATCAACAATTACCAAGTCTGCTGGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAAGGAATGGAAGACGAAAGAATGAAATTAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTGA	GCATAAAGTATATTGTCTTACGACATT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACGAA	CATGAAAGATTTTAAAAAAGAACATTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ANDK01000035.1\|WP_000621139.1\|95617_96082_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_ANDK01000035.1\|WP_000438313.1\|89586_90003_+\|nucleoside-diphosphate-kinase	unknown	unknown	gnl\|CDD\|179085
NZ_ANDK01000035.1\|WP_017645981.1\|96667_99460_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|223550
NZ_ANDK01000035.1\|WP_001241816.1\|78287_78668_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131381
NZ_ANDK01000035.1\|WP_000122197.1\|87438_87780_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NZ_ANDK01000035.1\|WP_000653357.1\|81392_82049_+\|TIGR01906-family-membrane-protein	unknown	unknown	gnl\|CDD\|226884
NZ_ANDK01000035.1\|WP_001040077.1\|82437_86571_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226044
NZ_ANDK01000035.1\|WP_000914659.1\|78760_79891_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236309
NZ_ANDK01000035.1\|WP_017645980.1\|90138_91971_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_ANDK01000035.1\|WP_000590706.1\|87766_88432_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	pfam09711_csn2_CAS-II-A	gnl\|CDD\|213408
NZ_ANDK01000035.1\|WP_000900527.1\|89016_89277_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000035.1\|WP_000929490.1\|86572_87442_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NZ_ANDK01000035.1\|WP_000159235.1\|77891_78263_+\|YbgA-family-protein	unknown	unknown	gnl\|CDD\|377982
NZ_ANDK01000035.1\|WP_000065320.1\|99459_100563_+\|DUF2974-domain-containing-protein	unknown	unknown	gnl\|CDD\|371412
NZ_ANDK01000035.1\|WP_000678287.1\|92216_94850_+\|pneumococcal-type-histidine-triad-protein	unknown	unknown	gnl\|CDD\|380193
NZ_ANDK01000035.1\|WP_000665410.1\|96081_96516_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|234692
NZ_ANDK01000035.1\|WP_000523795.1\|79894_80632_+\|acyl-ACP-thioesterase	unknown	unknown	gnl\|CDD\|366738
NZ_ANDK01000035.1\|WP_000323544.1\|80632_81403_+\|TIGR01457-family-HAD-type-hydrolase	unknown	unknown	gnl\|CDD\|319832
NZ_ANDK01000035.1\|WP_000180008.1\|94949_95609_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224336
NZ_ANDK01000035.1\|WP_001875996.1\|100683_101265_-\|CatB-related-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100040

Protein	Function_ID	Function_description	E-value
NZ_ANDK01000035.1\|WP_017645981.1\|96667_99460_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|223550	COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism].	0
NZ_ANDK01000035.1\|WP_001875996.1\|100683_101265_-\|CatB-related-O-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	3.28709e-71
NZ_ANDK01000035.1\|WP_001241816.1\|78287_78668_+\|hypothetical-protein	gnl\|CDD\|131381	TIGR02328, TIGR02328, conserved hypothetical protein. Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown. [Hypothetical proteins, Conserved].	6.45558e-80
NZ_ANDK01000035.1\|WP_000122197.1\|87438_87780_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.70123e-50
NZ_ANDK01000035.1\|WP_000653357.1\|81392_82049_+\|TIGR01906-family-membrane-protein	gnl\|CDD\|226884	COG4478, COG4478, Predicted membrane protein [Function unknown].	9.75792e-52
NZ_ANDK01000035.1\|WP_001040077.1\|82437_86571_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|226044	COG3513, COG3513, Predicted CRISPR-associated nuclease, contains McrA/HNH-nuclease and RuvC-like nuclease domain [Defense mechanisms].	0
NZ_ANDK01000035.1\|WP_000914659.1\|78760_79891_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236309	PRK08599, PRK08599, oxygen-independent coproporphyrinogen III oxidase.	0
NZ_ANDK01000035.1\|WP_017645980.1\|90138_91971_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_ANDK01000035.1\|WP_000590706.1\|87766_88432_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213408	cd09758, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	3.61399e-122
NZ_ANDK01000035.1\|WP_000621139.1\|95617_96082_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.90455e-18
NZ_ANDK01000035.1\|WP_000929490.1\|86572_87442_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	5.3759e-138
NZ_ANDK01000035.1\|WP_000159235.1\|77891_78263_+\|YbgA-family-protein	gnl\|CDD\|377982	pfam08349, DUF1722, Protein of unknown function (DUF1722). This domain of unknown function is found in bacteria and archaea and is homologous to the hypothetical protein ybgA from E. coli.	7.7979e-28
NZ_ANDK01000035.1\|WP_000065320.1\|99459_100563_+\|DUF2974-domain-containing-protein	gnl\|CDD\|371412	pfam11187, DUF2974, Protein of unknown function (DUF2974). This bacterial family of proteins has no known function.	1.44123e-105
NZ_ANDK01000035.1\|WP_000323544.1\|80632_81403_+\|TIGR01457-family-HAD-type-hydrolase	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.19143e-132
NZ_ANDK01000035.1\|WP_000665410.1\|96081_96516_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|234692	PRK00222, PRK00222, peptide-methionine (R)-S-oxide reductase MsrB.	6.40832e-86
NZ_ANDK01000035.1\|WP_000523795.1\|79894_80632_+\|acyl-ACP-thioesterase	gnl\|CDD\|366738	pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase. This family consists of various acyl-acyl carrier protein (ACP) thioesterases (TE) these terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid.	3.68196e-111
NZ_ANDK01000035.1\|WP_000438313.1\|89586_90003_+\|nucleoside-diphosphate-kinase	gnl\|CDD\|179085	PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated.	6.25805e-79
NZ_ANDK01000035.1\|WP_000180008.1\|94949_95609_+\|HD-domain-containing-protein	gnl\|CDD\|224336	COG1418, COG1418, Predicted HD superfamily hydrolase [General function prediction only].	1.30028e-33
NZ_ANDK01000035.1\|WP_000678287.1\|92216_94850_+\|pneumococcal-type-histidine-triad-protein	gnl\|CDD\|380193	NF033189, internalin_A, class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.	8.24068e-22

>NZ_ANDK01000035.1|WP_000590706.1|87766_88432_+|type-II-A-CRISPR-associated-protein-Csn2
MIKINFPILDEPLVLSNATILTIEDVSVYSSLVKHFYQYDVDEHLKLFDDKQKSLKATELMLVTDILGYDVNSAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIKALGVKIETQSDTIFEKCFEIIQVYHYLTKKNLLVFVNSGAYLTKDEVIKLCEYINLMQKSVLFLEPRRLYDLPQYVIDKDYFLIGENMV
>NZ_ANDK01000035.1|WP_000122197.1|87438_87780_+|CRISPR-associated-endonuclease-Cas2
MSYRYMRMILMFDMPTETVEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNNTANNAMIGRLKVNNPKKGSITLLTVTEKQFARMVYLHGEHNMSVANSDSRLVFLGDSYDQD
>NZ_ANDK01000035.1|WP_000929490.1|86572_87442_+|type-II-CRISPR-associated-endonuclease-Cas1
MAGWRTVVVNTHSKLSYKNNHLIFKDSYQTEMIHLSEIDILIMETTDIVLSTMLIKRLVDENILVIFCDDKRLPTAMLMPYYARHDSSLQLSRQMSWIEDVKADVWTSIIAQKILNQSFYLGECSFFEKSQSIMNLYHDLESFDPSNREGHAARIYFNTLFGNDFSREQDNPINAGLDYGYSLILSMFAREVVKCGCMTQFGLKHANQFNQFNLASDIMEPFRPIVDRIIYENRQSDFVKMKRELFSMFSETYSYNGKEMYLSNIVSDYTKKVIKSLNSDGNGIPEFRI
>NZ_ANDK01000035.1|WP_001040077.1|82437_86571_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MNKPYSIGLDIGTNSVGWSIITDDYKVPAKKMRVLGNTDKEYIKKNLIGALLFDGGNTAADRRFKRTARRRYTRRRNRILYLQEIFAEEMSKVDDSFFHRLEDSFLVEEDKRGSKYPIFATMQEEKYYHEKFPTIYHLRKELADKKEKADLRLVYLALAHIIKFRGHFLIEDDRFDVRNTDIQKQYQAFLEIFDTTFENNHLLSQNVDVEAILTDKISKSAKKDRILAQYPNQKSTGIFAEFLKLIVGNQADFKKHFNLEDKTPLQFAKDSYDEDLENLLGQIGDEFADLFSVAKKLYDSVLLSGILTVTDLSTKAPLSASMIQRYDEHHEDLKHLKQFVKASLPENYREVFADSSKDGYAGYIEGKTNQEAFYKYLLKLLTKQEGSEYFLEKIKNEDFLRKQRTFDNGSIPHQVHLTELRAIIRRQSEYYPFLKENQDRIEKILTFRIPYYVGPLAREKSDFAWMTRKTDDSIRPWNFEDLVDKEKSAEAFIHRMTNNDLYLPEEKVLPKHSLIYEKFTVYNELTKVRFLAEGFKDFQFLNRKQKETIFNSLFKEKRKVTEKDIISFLNKVDGYEGIAIKGIEKQFNASLSTYHDLKKILGKDFLDNTDNELILEDIVQTLTLFEDREMIKKCLDIYKDFFTESQLKKLYRRHYTGWGRLSAKLINGIRNKENQKTILDYLIDDGSANRNFMQLINDDDLSFKPIIDKARTGSHSDNLKEVVGELAGSPAIKKGILQSLKIVDELVKVMGYEPEQIVVEMARENQTTAKGLSRSRQRLTTLRESLANLKSNILEEKKPKYVKDQVENHHLSDDRLFLYYLQNGRDMYTKKALDIDNLSQYDIDHIIPQAFIKDDSIDNRVLVSSAKNRGKSDDVPSIEIVKARKMFWKNLLDAKLMSQRKYDNLTKAERGGLTSDDKARFIQRQLVETRQITKHVARILDERFNNEVDNGKKICKVKIVTLKSNLVSNFRKEFGFYKIREVNDYHHAHDAYLNAVVAKAILTKYPQLEPEFVYGMYRQKKLSKIVHEDKEEKYSEATRKMFFYSNLMNMFKRVVRLADGSIVVRPVIETGRYMGKTAWDKKKHFATVRKVLSYPQNNIVKKTEIQTGGFSKESILAHGNSDKLIPRKTKDIYLDPKKYGGFDSPIVAYSVLVVADIKKGKAQKLKTVTELLGITIMERSRFEKNPSAFLESKGYLNIRDDKLMILPKYSLFELENGRRRLLASAGELQKGNELALPTQFMKFLYLASRYNESKGKPEEIEKKQEFVNQHVSYFDDILQLINDFSKRVILADANLEKINKLYQDNKENIPVDELANNIINLFTFTSLGAPAAFKFFDKIVDRKRYTSTKEVLNSTLIHQSITGLYETRIDLGKLGED
>NZ_ANDK01000035.1|WP_000653357.1|81392_82049_+|TIGR01906-family-membrane-protein
MKDKLLVVLTWIWIISLATLATIYIAWLIYPIEIQFLKLEKVVYLKAETIYYNFNKLMIYLTHPFISDLNMPSFPSSEDGLKHFADVKYLFTLAHGLFVILTFPVIYFLRRGWKQKSIFLYEGFFKIAIMLPIFIVVCAFLLGFDQFFTLFHEVLFPGDSTWQFNPLTDPVIWILPETFFLHCFIIFLLIYETITIILLIIGRKHLKLRKYKNKMQAL
>NZ_ANDK01000035.1|WP_000323544.1|80632_81403_+|TIGR01457-family-HAD-type-hydrolase
MAYKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLRGFNVETPLETIYTATMATVDYMNDMNRGKTAYVIGEEGLKKAIADAGYVEDTKNPAYVVVGLDWNVTYDKLATATLAIQNGALFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKPVFIGKPNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDIDTLLVTTGFTTVEEVPDLPIQPSYVLASLDEWTFNEG
>NZ_ANDK01000035.1|WP_000523795.1|79894_80632_+|acyl-ACP-thioesterase
MGLLYRETYEVPFYESDTNHYMKLPQLLALALQISAKQSLKLGIGDDIVFKRYGLVWVVTDYIIDIERLPKHAEKIVIETEAKAHNKLLCYRYFYIYGEDGQKIITISSAFVLMDFKTRKIHPVLDDITSIYQSQRIKKVIRGPKYHPIGDSKVKQYHVRYFDLDMNGHVNNSKYLEWMYDVLDLDFLSSHIPKKIDLKYIKEIQYGTDIKSHWYQDGLVTRHDIIGGDAIHAQARIEWQEKKED
>NZ_ANDK01000035.1|WP_000914659.1|78760_79891_+|oxygen-independent-coproporphyrinogen-III-oxidase
MLKKPTSAYVHIPFCTQICYYCDFSKVFIKNQPVDAYLQALIREFRSYDITELRTLYIGGGTPTSISAVQLDYLLTELIRDLNLNTLEEFTIEANPGDLTVDKIEVLQKSAVNRVSLGVQTFNDKHLKRIGRSHNEAQIYSTIDALKTAGFQNISIDLIYALPGQTMDDVRSNVAKALSLNIPHLSLYSLILEHHTVFMNKMRRGKLHLPTEDLEAEMFEYIISEMERNGFEHYEISNFTKPGFESRHNLMYWENVEYYGVGAGASGYLDGIRYRNRGPIQHYLKGVSEGNARLSEEVLSKNEMMEEELFLGLRKKEGVSIGKFEQKFGTSFEKRYGQIVQELQSDGLLKENNGFIQMTKKGLFLGDTVAEKFIVE
>NZ_ANDK01000035.1|WP_001241816.1|78287_78668_+|hypothetical-protein
MRLWHQDIIELLPRQQLLGQHRECCALRGNGWGRKHETVDYVFRYSPYRLFAYHQLVMEEMMERGYRVSKEWLIAEYRGMKCPRYDTLNPVDLETPIYPEHNQDYLQECLWNLKAKGIDLPINKIK
>NZ_ANDK01000035.1|WP_000159235.1|77891_78263_+|YbgA-family-protein
MTKEAKLLWAKHKYLVLSKSQKIYLDIRQTLKSPNCTVLDVQSLIDQAVLLEESPSQVTNAYMHIWGYFKNKAERQEKEEFLTLLEKYRKTGYQRRKLLAFLKQLLAKYPNSYLQNSSIFEEE
>NZ_ANDK01000035.1|WP_000900527.1|89016_89277_+|hypothetical-protein
MLGHHCGVLVFCYTEINFQRMWGKAVIRLIQDVIQNLVGQANEITPIYQFDWETYILATKKYERHLEVCLLVENSNCFSDSKRMCR
>NZ_ANDK01000035.1|WP_000438313.1|89586_90003_+|nucleoside-diphosphate-kinase
MEQTFFMIKPDGVKRGFIGEVISRIERRGFSIDRLEVRHADADILKRHYAELTDRPFFPTLVDYMTSGPVIIGVISGEEVISTWRTMMGSTNPKDALPGTIRGDFAQAPSPNQATCNIVHGSDSPESATREIAIWFNN
>NZ_ANDK01000035.1|WP_017645980.1|90138_91971_+|elongation-factor-4
MNIEDLKKRQEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYTAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPTGEVDAPLQALIFDSVYDAYRGVILQVRIVNGMVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTITLANNPAIEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRVDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRRSQLVKMDIFLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLSMDDDDKK
>NZ_ANDK01000035.1|WP_000678287.1|92216_94850_+|pneumococcal-type-histidine-triad-protein
MKGQKIIALAGLVLSCHFALTACHTQEHKNSHHIKTKQVAKKKANKKKVSVKESHKKRKGVAGVDFPTDDGFLLTKDSKILSHTDSGIVVAHGNHSHFIFYSDLKGSKFSYLIPNANAKTNKKQAVRNFKAGAVAVNTLNDGYVFNPADIVSEDANGYVVRHGDHFHYIPKASLSQQKQVQASRAVSRLGNQNNSHYRVNSSKIAGLHHPTSDGFLFNGQGIKGTTPTGILVEHHNHLHFISFADLRKGGWGSIADRYQPQKKVDSKKQSPSSKKPRTENTLPKDIKDKLAYLARELHLDISRIRVLKTLNGEIGFEYPHDDHTHVIMAKDIDLSKPIPNPHHDDEDHHKGHHHDESDHKHEEHEHTKSNKLSDEDQKKLIYLAEKLGLNPNQIEVLTSEDGSIIFKYPHDDHSHTIASKDIEIGKPIPDGHHDHSHAKDKVGMATLKQIGFDDEIIQDILHADAPTPFPSNETNPEKMRQWLATVTKINIGQRTNPFQRFGLSLMPNIEVLGIGFTPINDMTPVLQFKKLKQLWMTNTGITDYSFLDKMPLLEGLDISQNGIKDLSFLTKYKQLSLIAAANNGITSLKPLAELPNLQFLVLSHNNISDLTPLSNLTKLQELHLDHNNVKNLSALSGKKDLKVLDLSNNKSADLSTLKTTSLETLLLNETNTSNLSFLKQNPKVSNLTINNAKLASLDGIEESDEIVKVEAEGNQIKSLVLKNKQGSLKFLNVTNNQLTSLEGVNNYTSLETLSVSKNKLESLDIKTPNKTVTNLDFSHNNVPTSQLKLNEKNIPEAVAKNFPAVVEGSMVGNGSLAEKAAMASKEDKQVSDNTNHQKNTEKSAQANADSKKENPKTHDEHHDHEETDHAHVGHHHH
>NZ_ANDK01000035.1|WP_000180008.1|94949_95609_+|HD-domain-containing-protein
MTMVKREDVILNATENMVYHKLKNDPSGHDWFHIVRVRNLAVELAHKEGANTFICQMAALLHDIIDDKICQDSKQASYELTQWLYSQDLAIAEVEHILDILENISFKAGTGLTMKTLEGQIVQDADRLDAMGAIGIARTMAYSGSKGRLIHDPNLKPRENLTLEEYRNGQDTAIMHFYEKLLKLKDLMNTKQGKMLAQKRHDFLELYLAEFYAEWNGKG
>NZ_ANDK01000035.1|WP_000621139.1|95617_96082_+|GNAT-family-N-acetyltransferase
MIRRAKEKDLPAIAELLKQILVLHHGVRPDIFHTRGSKFSKEQLKEMLMDESRPIFVYESDEGKVVAHLFLQLQEKRDLPRKSFKTLYIDDLCIDEEVRGQQIGQKLMDFARQYAKKHGCYNITLNVWNDNQRAVSFYEKLGFKPQQTQMEEIL
>NZ_ANDK01000035.1|WP_000665410.1|96081_96516_+|peptide-methionine-(R)-S-oxide-reductase-MsrB
MKETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSGCGWPAFSKPIENRMVTNHQDHSHGMHRIEVRSRQADSHLGHVFNDGPVDAGGLRYCINSAALDFIPYDQMAKRGYGDYLSLFD
>NZ_ANDK01000035.1|WP_017645981.1|96667_99460_+|cation-transporting-P-type-ATPase
MASTNNVSDTNTCFAKEELEEIFEELGTTQGGLSDEEVAVRQKKYGLNLLSEVEQESIILLFLKNFTSLMAILLWVGGFVAIVSNSLELGLAIWMVNVINGIFSFIQEYRASQATQALKKMLPSYSRVLRKSSEEKILSEQLVPGDIVLIEEGDRISADGRLIKTTDLQVNQSALTGESNPIYKDSNVENDQSKTLIECDNMVFAGTTVSSGSATMVVTAIGMQTQFGQIADLTQGMKSEKSPLQRELDRLTKQISIISITVGIIFFLAATFFVKEPVSKSFIFALGMIVAFIPEGLLPTVTLSLAMAVQRMAKEHALVKKLSSVETLGATSVICSDKTGTLTQNEMTVNHLWQNGKSYQVTGLGYAPEGQILFEGDNICFGNSDRGDLEKLIRFAHLCSNAQVLPPNDERSTYTVLGDPTEACLNVLLEKSGINRQENRKFAPRLKELPFDSVRKRMTTIHSLGGDEKDKKISITKGAPKEILDLSDYVLSDGKVIPLNKEERNKIQLANDTFAKDGLRVLAVSYCDIEGFSKEQWTQENLEQHMVFIGLIAMSDPPREGVREAIDKCHAASIRIIMVTGDYGLTALSIAKNIGIIRNDGAKVISGLELSEMTDSQLKKELSGEAVFARVAPEQKYRVVTILQEMGEVVAVTGDGVNDAPALKKSDIGVAMGVTGTDVTKESADMILTDDHFASIVHAVEEGRAVYQNIKKFLTYIFNSNTPEAVPSAFFLFSKGFIPLPLTVMQILAVDLGTDMLPALGLGVEPPETDVMNRPPRRLTDRLLDKGLLIKSFLWYGTIESVLAMGGFFWAHYLRYGNFTFFVANGIPYREATTMTLGAIIFSQIGMVMNSRTSYQSIKTLSIFGNKLINFGIIMEILAFLVLVYVPLFHNLFNTASLGLSHWLYLIGCPFIMIGLDEVRKLFSSRKNKR
>NZ_ANDK01000035.1|WP_000065320.1|99459_100563_+|DUF2974-domain-containing-protein
MSNIITYLKNNSNLTFDELALNDVDILCLNEFGYISFEKLINTTEMKSVLVCELYHEYLQTMAKSYSFMFTSQRHDLCQLMMTSKRFKNLTLSYYRAEISLEFEKQFAAMVFTIPNINYHQVVFRGTDANLIGWKEDFKLTYMREISAHRSAIKYLNTILPYFDKVVLSGHSKGGNLALYAAMFTKPDLKAKIDLIWLIDSPGLQKTLLPTTEYKTTKQKCIRLLPEESIVGMMLYSDIEPLIISSNARGILQHDVTTWEIQEPAILKTGTGLSLKSICFEKTFQQWMAELKSQERKLFFDLLFDSFLSSGVSSLDDFNLASRAKMMKAFHSFRELDDDKKRLFNKSLKLLVTIFLGAYHDNSRETK
>NZ_ANDK01000035.1|WP_001875996.1|100683_101265_-|CatB-related-O-acetyltransferase
MRTDMSTGASYPKYRFSVGKYTYGYQQFFYEGVNLKEIGAFCSIAQNVTITGMNHPTDHITTNPFIYYKSRGFINEDRADLIDEKKNGKVIIGNDVWIGTNVTILPSVTIGNGAIIGAGSVITKDIPDYAVVAGTPAKIIKYRFSEEEITLLNASQWWNWSDEAIKEHISEFSDKKEFFNTLKSISENKNHKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_ANDK01000035_1	1.1\|88571\|28\|NZ_ANDK01000035\|PILER-CR	88571-88598	28	MK448971	Streptococcus phage Javan52, complete genome	37423-37450	0	1.0
NZ_ANDK01000035_1	1.1\|88571\|28\|NZ_ANDK01000035\|PILER-CR	88571-88598	28	MK448829	Streptococcus phage Javan7, complete genome	32116-32143	0	1.0
NZ_ANDK01000035_1	1.1\|88571\|28\|NZ_ANDK01000035\|PILER-CR	88571-88598	28	MH853355	Streptococcus phage LF1, complete genome	22973-23000	0	1.0
NZ_ANDK01000035_1	1.1\|88571\|28\|NZ_ANDK01000035\|PILER-CR	88571-88598	28	MH853358	Streptococcus phage LF4, complete genome	22973-23000	0	1.0
NZ_ANDK01000035_1	1.3\|88569\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88569-88598	30	MK448971	Streptococcus phage Javan52, complete genome	37423-37452	0	1.0
NZ_ANDK01000035_1	1.3\|88569\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88569-88598	30	MK448829	Streptococcus phage Javan7, complete genome	32116-32145	0	1.0
NZ_ANDK01000035_1	1.3\|88569\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88569-88598	30	MH853355	Streptococcus phage LF1, complete genome	22973-23002	0	1.0
NZ_ANDK01000035_1	1.3\|88569\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88569-88598	30	MH853358	Streptococcus phage LF4, complete genome	22973-23002	0	1.0
NZ_ANDK01000035_1	1.5\|88701\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88701-88730	30	MK448971	Streptococcus phage Javan52, complete genome	4375-4404	0	1.0
NZ_ANDK01000035_1	1.5\|88701\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88701-88730	30	MK448742	Streptococcus phage Javan37, complete genome	3719-3748	0	1.0
NZ_ANDK01000035_1	1.6\|88767\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88767-88796	30	MK448837	Streptococcus phage Javan10, complete genome	6149-6178	0	1.0
NZ_ANDK01000035_1	1.7\|88833\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88833-88862	30	MK448956	Streptococcus phage Javan48, complete genome	4002-4031	0	1.0
NZ_ANDK01000035_1	1.7\|88833\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88833-88862	30	MK448749	Streptococcus phage Javan39, complete genome	4002-4031	0	1.0
NZ_ANDK01000035_1	1.9\|88836\|27\|NZ_ANDK01000035\|PILER-CR	88836-88862	27	MK448956	Streptococcus phage Javan48, complete genome	4004-4030	0	1.0
NZ_ANDK01000035_1	1.9\|88836\|27\|NZ_ANDK01000035\|PILER-CR	88836-88862	27	MK448749	Streptococcus phage Javan39, complete genome	4004-4030	0	1.0
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP035396	Bacillus subtilis strain SRCM103697 plasmid unnamed1, complete sequence	5262-5288	3	0.889
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP032856	Bacillus subtilis subsp. subtilis strain PJ-7 plasmid unnamed1, complete sequence	45543-45569	3	0.889
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	KC465899	Pelagibacter phage HTVC008M, complete genome	125202-125231	4	0.867
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MT074138	Bacteroides phage DAC17, complete genome	95751-95777	4	0.852
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MT074136	Bacteroides phage DAC15, complete genome	96341-96367	4	0.852
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MN693256	Marine virus AFVG_25M339, complete genome	27549-27575	4	0.852
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP016971	Staphylococcus epidermidis strain DAR1907 plasmid unnamed3, complete sequence	1755-1782	5	0.821
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_MG557999	Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence	51742-51768	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_MF497781	Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence	51742-51768	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP012100	Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence	417641-417667	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP012103	Bacillus thuringiensis strain HS18-1 plasmid pHS18-4, complete sequence	20111-20137	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP009352	Francisella tularensis subsp. novicida F6168 plasmid unnamed, complete sequence	2298-2324	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NC_004952	Francisella novicida plasmid pFNL10, complete sequence	112-138	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NC_002109	Francisella tularensis plasmid pOM1, complete sequence	112-138	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MN855807	Siphoviridae sp. isolate 122, partial genome	13519-13545	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	LC494302	Escherichia phage SP27 DNA, complete genome	245481-245507	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	230965-230991	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NC_027364	Escherichia phage PBECO 4, complete genome	39410-39436	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MH383160	Escherichia phage UB, complete genome	99997-100023	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MK327931	Escherichia phage vB_EcoM_G17, complete genome	256259-256285	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	187104-187130	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	KM507819	Escherichia phage 121Q, complete genome	246580-246606	5	0.815
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	FJ429185	Lactococcus phage P087, complete genome	18715-18741	5	0.815
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KY436021	Staphylococcus aureus strain NRL 99/049 plasmid pETB049, complete sequence	3532-3559	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KY436022	Staphylococcus aureus strain NRL 03/459 plasmid pETB459, complete sequence	9884-9911	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KY436024	Staphylococcus aureus strain NRL 13/791 plasmid pETB791, complete sequence	2090-2117	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KY436025	Staphylococcus aureus strain NRL 08/797 plasmid pETB797, complete sequence	3513-3540	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP016859	Staphylococcus aureus subsp. aureus strain 1971.C01 plasmid p1971.C01b, complete sequence	16994-17021	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_022126	Staphylococcus aureus subsp. aureus 55/2053 plasmid, complete sequence	20174-20201	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KU882683	Staphylococcus lugdunensis strain Tlug33G-4 plasmid pT33G-1, complete sequence	39935-39962	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KU882684	Staphylococcus lugdunensis strain Tlug8G-4 plasmid pT8G, complete sequence	5731-5758	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KX274135	Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence	6001-6028	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KR270450	Staphylococcus aureus strain SM31 plasmid pSM31, complete sequence	745-772	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KR230047	Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence	61023-61050	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KJ756353	Staphylococcus aureus strain SM39 plasmid pSM39, complete sequence	3191-3218	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP018769	Staphylococcus aureus subsp. aureus strain UCI 28 plasmid pUCI28, complete sequence	23304-23331	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007658	Staphylococcus aureus strain V2200 plasmid pV2200, complete sequence	8549-8576	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LT671860	Staphylococcus aureus subsp. aureus isolate Clinical isolate plasmid II	26926-26953	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP022909	Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence	13679-13706	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP022911	Staphylococcus aureus strain 164 plasmid pPS00089.1A.1, complete sequence	14546-14573	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	32139-32166	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030394	Staphylococcus aureus strain ER01425.3 plasmid unnamed1, complete sequence	16004-16031	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP026081	Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed	8178-8205	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029475	Staphylococcus aureus strain USA 100 isolate 30-47 plasmid unnamed, complete sequence	26501-26528	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	MN687830	Staphylococcus aureus strain 8N plasmid p_8N_qac, complete sequence	7711-7738	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030682	Staphylococcus aureus strain ER05857.3 plasmid unnamed1, complete sequence	11135-11162	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007500	Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence	11144-11171	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP031668	Staphylococcus aureus strain 199 plasmid pPS00120.1A.1, complete sequence	14895-14922	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_KF831356	Staphylococcus aureus strain A960649 plasmid pBU108b, complete sequence	18508-18535	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP026969	Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1	4897-4924	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	13776-13803	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030687	Staphylococcus aureus strain ER02919.3 plasmid unnamed1, complete sequence	22471-22498	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029659	Staphylococcus aureus strain AR_0467 plasmid unnamed1, complete sequence	7141-7168	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	34552-34579	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP046305	Staphylococcus hominis strain FDAARGOS_746 plasmid unnamed2, complete sequence	12249-12276	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP031662	Staphylococcus aureus strain 82 plasmid pPS00051.1A.1, complete sequence	14884-14911	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP031671	Staphylococcus aureus strain 64 plasmid pPS00119.1A.1, complete sequence	14896-14923	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP013958	Staphylococcus aureus strain V521 isolate Sequencing plasmid pV521, complete sequence	23842-23869	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR735438	Staphylococcus epidermidis strain none isolate Se_BPH0723 plasmid 2	39369-39396	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	25662-25689	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_018965	Staphylococcus aureus plasmid SAP077A, complete sequence	5718-5745	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_018972	Staphylococcus aureus plasmid pWBG744, complete sequence	26343-26370	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_019007	Staphylococcus aureus plasmid SAP048A, complete sequence	17151-17178	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_019008	Staphylococcus aureus plasmid SAP074A, complete sequence	26726-26753	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_019009	Staphylococcus aureus plasmid SAP078A, complete sequence	7685-7712	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_019010	Staphylococcus aureus plasmid pSK67, complete sequence	26122-26149	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029679	Staphylococcus aureus strain AR_0215 plasmid unnamed1, complete sequence	19218-19245	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP035289	Staphylococcus epidermidis strain ATCC 14990 plasmid unnamed1, complete sequence	19610-19637	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_002774	Staphylococcus aureus subsp. aureus Mu50 plasmid VRSAp, complete sequence	24914-24941	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP027420	Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence	27478-27505	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	LC377536	Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence	41702-41729	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_018976	Staphylococcus aureus plasmid p19321-P03, complete sequence	26914-26941	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_022598	Staphylococcus aureus TY825 plasmid pETB DNA, complete sequence	50226-50253	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP018843	Staphylococcus epidermidis strain 14.1.R1 plasmid pHOB1, complete sequence	5279-5306	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030413	Staphylococcus aureus strain ER02947.3 plasmid unnamed1, complete sequence	9889-9916	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP031272	Staphylococcus caprae strain 26D plasmid unnamed1, complete sequence	9885-9912	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007673	Staphylococcus aureus strain CA12 plasmid pCA12, complete sequence	1820-1847	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	1292-1319	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007677	Staphylococcus aureus strain HUV05 plasmid pHUV05-01, complete sequence	14234-14261	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007678	Staphylococcus aureus strain HUV05 plasmid pHUV05-02, complete sequence	17892-17919	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP026075	Staphylococcus aureus strain FDAARGOS_47 plasmid unnamed	730-757	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR130512	Staphylococcus aureus strain BPH2819 isolate BPH2819 plasmid 2	26693-26720	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013334	Staphylococcus aureus plasmid SAP057A, complete sequence	3536-3563	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013337	Staphylococcus aureus plasmid SAP064A, complete sequence	13632-13659	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR735430	Staphylococcus epidermidis strain none isolate Se_BPH0704 plasmid 2	14523-14550	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP035293	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence	25601-25628	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR027879	Staphylococcus aureus strain BPH2003 isolate BPH2003 plasmid 2	28143-28170	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047850	Staphylococcus aureus strain UP_403 plasmid unnamed, complete sequence	25193-25220	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029085	Staphylococcus aureus strain AR462 plasmid unnamed1, complete sequence	25215-25242	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029081	Staphylococcus aureus strain AR465 plasmid unnamed1, complete sequence	16694-16721	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP026065	Staphylococcus aureus strain FDAARGOS_19 plasmid unnamed	23513-23540	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP017683	Staphylococcus aureus strain CFSAN007850 plasmid pCFSAN007850, complete sequence	24042-24069	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013318	Staphylococcus aureus plasmid SAP012A, complete sequence	25960-25987	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013319	Staphylococcus aureus plasmid pI258, complete sequence	26014-26041	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013321	Staphylococcus aureus plasmid SAP017A, complete sequence	11089-11116	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013323	Staphylococcus aureus plasmid pCM05, complete sequence	9899-9926	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	6807-6834	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013328	Staphylococcus aureus plasmid pWBG753, complete sequence	2006-2033	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013333	Staphylococcus aureus plasmid SAP055A, complete sequence	16652-16679	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013335	Staphylococcus aureus plasmid SAP060A, complete sequence	16164-16191	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013340	Staphylococcus aureus plasmid SAP076A, complete sequence	1008-1035	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013347	Staphylococcus aureus plasmid pSK62, complete sequence	22015-22042	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	37751-37778	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013351	Staphylococcus aureus plasmid SAP063A, complete sequence	16067-16094	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013352	Staphylococcus aureus plasmid pSK76, complete sequence	11092-11119	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_005005	Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-04, complete sequence	5468-5495	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR130516	Staphylococcus aureus strain BPH2947 isolate BPH2947 plasmid 2	26808-26835	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP053641	Staphylococcus aureus strain 14505 plasmid unnamed, complete sequence	26757-26784	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_017352	Staphylococcus aureus subsp. aureus TW20 plasmid pTW20_1, complete sequence	12239-12266	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP033781	Staphylococcus epidermidis strain FDAARGOS_529 plasmid unnamed1, complete sequence	18840-18867	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030472	Staphylococcus aureus strain ER01121.3 plasmid unnamed1, complete sequence	25341-25368	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047855	Staphylococcus aureus strain UP_1525 plasmid unnamed, complete sequence	26648-26675	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047860	Staphylococcus aureus strain UP_1405 plasmid unnamed, complete sequence	26757-26784	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047864	Staphylococcus aureus strain UP_1106 plasmid unnamed, complete sequence	26757-26784	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047862	Staphylococcus aureus strain UP_1322 plasmid unnamed, complete sequence	26756-26783	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_022610	Staphylococcus aureus subsp. aureus Z172 plasmid pZ172_1, complete sequence	1671-1698	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP009047	Staphylococcus epidermidis strain SEI plasmid unnamed, complete sequence	16429-16456	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007455	Staphylococcus aureus strain 502A isolate RN6607 plasmid unnamed, complete sequence	3843-3870	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP031665	Staphylococcus aureus strain 28 plasmid pPS00026.1A.1, complete sequence	16432-16459	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030500	Staphylococcus aureus strain ER02612.3 plasmid unnamed1, complete sequence	6230-6257	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030711	Staphylococcus aureus strain ER01174.3 plasmid unnamed2, complete sequence	14954-14981	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	7257-7284	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	39472-39499	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030691	Staphylococcus aureus strain ER01422.3 plasmid unnamed1, complete sequence	8018-8045	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP023967	Staphylococcus capitis strain FDAARGOS_378 plasmid unnamed1, complete sequence	17329-17356	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047866	Staphylococcus aureus strain UP_844 plasmid unnamed, complete sequence	26755-26782	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030541	Staphylococcus aureus strain ER04164.3 plasmid unnamed1, complete sequence	19902-19929	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP045647	Staphylococcus epidermidis strain IRL01 plasmid pBPH0747-01, complete sequence	13061-13088	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047821	Staphylococcus aureus strain UP_1395 plasmid unnamed, complete sequence	26895-26922	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047818	Staphylococcus aureus strain UP_1433 plasmid unnamed1, complete sequence	26754-26781	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP010891	Staphylococcus aureus strain SA564 plasmid pSA564, complete sequence	20281-20308	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP048645	Staphylococcus aureus strain SR153 plasmid pSR02, complete sequence	25548-25575	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	13504-13531	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	30541-30568	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030627	Staphylococcus aureus strain ER01823.3 plasmid unnamed1, complete sequence	19783-19810	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP010403	Staphylococcus aureus subsp. aureus strain GR2 plasmid pGR2A, complete sequence	16629-16656	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP035792	Staphylococcus aureus strain 592 plasmid unnamed, complete sequence	26756-26783	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030543	Staphylococcus aureus strain ER04166.3 plasmid unnamed1, complete sequence	22470-22497	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP045867	Staphylococcus aureus strain CFSAN007894 plasmid pCFSAN007894, complete sequence	14105-14132	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	MK992500	Staphylococcus aureus strain 5Sau489 plasmid p5Sau489, complete sequence	43012-43039	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP022907	Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence	13680-13707	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020530	Staphylococcus aureus subsp. aureus ST228 plasmid pI1T1, complete sequence	13632-13659	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020538	Staphylococcus aureus subsp. aureus ST228 plasmid pI7S6, complete sequence	13632-13659	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020567	Staphylococcus aureus subsp. aureus ST228 plasmid pI6T6, complete sequence	13632-13659	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030594	Staphylococcus aureus strain ER03588.3 plasmid unnamed1, complete sequence	11139-11166	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	MK992499	Staphylococcus aureus strain 17Sau58 plasmid p17Sau58, complete sequence	37793-37820	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP051645	Staphylococcus caprae strain SY333 plasmid pSY333-41, complete sequence	12820-12847	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LR736240	Staphylococcus epidermidis isolate BPH0662 plasmid 4	13062-13089	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007675	Staphylococcus aureus strain CA15 plasmid pCA15, complete sequence	1109-1136	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030423	Staphylococcus aureus strain ER02972.3 plasmid unnamed1, complete sequence	23218-23245	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	32062-32089	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020565	Staphylococcus aureus subsp. aureus ST228 plasmid pI3T3, complete sequence	14962-14989	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_003265	Staphylococcus aureus TY4 plasmid pETB, complete sequence	74-101	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP027490	Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed5	2094-2121	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP007671	Staphylococcus aureus strain M121 plasmid pM121, complete sequence	6866-6893	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP020462	Staphylococcus epidermidis strain 1457 plasmid p1457, complete sequence	13055-13082	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029654	Staphylococcus aureus strain AR_0469 plasmid unnamed1, complete sequence	16716-16743	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029674	Staphylococcus aureus strain AR_0219 plasmid unnamed1, complete sequence	25036-25063	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LN831037	Staphylococcus aureus strain NCTC13435 plasmid 2, complete sequence	5628-5655	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP039163	Staphylococcus aureus strain Lr12 plasmid pLr12, complete sequence	5866-5893	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030504	Staphylococcus aureus strain ER04402.3 plasmid unnamed1, complete sequence	22470-22497	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030546	Staphylococcus aureus strain ER04181.3 plasmid unnamed1, complete sequence	14954-14981	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047858	Staphylococcus aureus strain UP_1435 plasmid unnamed2, complete sequence	26757-26784	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020534	Staphylococcus aureus subsp. aureus ST228 plasmid pI4T8, complete sequence	13631-13658	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_020539	Staphylococcus aureus subsp. aureus ST228 plasmid pI8T7, complete sequence	13631-13658	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP033731	Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence	30532-30559	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP040561	Staphylococcus aureus strain Col52-A5 plasmid pCOL52-A5, complete sequence	37074-37101	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030440	Staphylococcus aureus strain ER02746.3 plasmid unnamed1, complete sequence	7480-7507	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030450	Staphylococcus aureus strain ER04225.3 plasmid unnamed1, complete sequence	7246-7273	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP041009	Staphylococcus aureus strain FDAARGOS_766 plasmid unnamed1, complete sequence	10395-10422	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP047840	Staphylococcus aureus strain UP_678 plasmid unnamed, complete sequence	24991-25018	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	32146-32173	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030392	Staphylococcus aureus strain ER04142.3 plasmid unnamed1, complete sequence	22470-22497	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030389	Staphylococcus aureus strain ER01689.3 plasmid unnamed1, complete sequence	24174-24201	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029167	Staphylococcus aureus strain SVH7513 plasmid pSVH7513a	27376-27403	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029672	Staphylococcus aureus strain AR_0220 plasmid unnamed1, complete sequence	6305-6332	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029662	Staphylococcus aureus strain AR_0228 plasmid unnamed2, complete sequence	20288-20315	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP038184	Staphylococcus aureus strain MJ015 plasmid unnamed1, complete sequence	18634-18661	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_013378	Staphylococcus epidermidis plasmid SAP105B, complete sequence	1559-1586	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP014130	Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed1, complete sequence	11414-11441	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_017350	Staphylococcus aureus subsp. aureus 11819-97 plasmid p11819-97, complete sequence	15897-15924	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030589	Staphylococcus aureus strain ER04314.3 plasmid unnamed1, complete sequence	11136-11163	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP043303	Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence	40110-40137	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP028469	Staphylococcus aureus strain IT1-S plasmid pIT1-S, complete sequence	1008-1035	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029670	Staphylococcus aureus strain AR_0222 plasmid unnamed1, complete sequence	22250-22277	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	25178-25205	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NC_017344	Staphylococcus aureus subsp. aureus ECT-R 2 plasmid pLUH02, complete sequence	5411-5438	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP012596	Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_03, complete sequence	14418-14445	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030703	Staphylococcus aureus strain ER03321.3 plasmid unnamed1, complete sequence	6439-6466	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP029656	Staphylococcus aureus strain AR_0468 plasmid unnamed1, complete sequence	19983-20010	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MN602039	Staphylococcus capitis strain APC2923 plasmid pJOS_01, complete sequence	19231-19258	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP053355	Staphylococcus aureus strain 14507 plasmid unnamed, complete sequence	16550-16577	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_CP022683	Staphylococcus aureus strain 78 plasmid pPS00085.1A.1, complete sequence	9195-9222	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MH470063	Staphylococcus aureus strain CMRSA3 plasmid pCMRSA3, complete sequence	26843-26870	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MH785232	Staphylococcus aureus strain ch5 plasmid pLUH02, complete sequence	5402-5429	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MH785250	Staphylococcus aureus strain ch3 plasmid pLUH02, complete sequence	5410-5437	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MH587574	Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence	34968-34995	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	NZ_MF622050	Staphylococcus aureus strain ST6 plasmid pSA564-fus, complete sequence	11902-11929	6	0.786
NZ_ANDK01000035_1	1.2\|88637\|28\|NZ_ANDK01000035\|PILER-CR	88637-88664	28	CP030551	Staphylococcus aureus strain ER03481.3 plasmid unnamed1, complete sequence	22475-22502	6	0.786
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	30539-30568	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP035396	Bacillus subtilis strain SRCM103697 plasmid unnamed1, complete sequence	5260-5289	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP032856	Bacillus subtilis subsp. subtilis strain PJ-7 plasmid unnamed1, complete sequence	45542-45571	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_MG557999	Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence	51740-51769	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_MF497781	Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence	51740-51769	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MT074138	Bacteroides phage DAC17, complete genome	95749-95778	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MT074136	Bacteroides phage DAC15, complete genome	96339-96368	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP046030	Staphylococcus chromogenes strain 1401 plasmid unnamed2, complete sequence	15565-15594	6	0.8
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	AP014166	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61-MedDCM-OCT-S46-C82, * SEQUENCING IN PROGRESS *	5438-5467	6	0.8
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	73253-73279	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	620824-620850	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	384735-384761	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	384774-384800	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	192960-192986	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_AP019717	Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence	659240-659266	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_KR091915	Klebsiella pneumoniae strain KPC-DK05 plasmid pKPC-DK05, complete sequence	42925-42951	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP025915	Escherichia coli strain 203740 plasmid p203740_35, complete sequence	8595-8621	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_LS999564	Escherichia coli isolate EC-TO143 plasmid 5, complete sequence	683-709	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_LN824136	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_C_Kpneumoniae_MS6671	16677-16703	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP054370	Escherichia coli strain SCU-115 plasmid pSCU-115-2, complete sequence	19260-19286	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP006640	Escherichia coli PCN061 plasmid PCN061p4, complete sequence	5958-5984	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP029801	Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_34k, complete sequence	7885-7911	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP015505	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 5, complete sequence	27844-27870	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP026060	Proteus mirabilis strain FDAARGOS_80 plasmid unnamed1, complete sequence	16879-16905	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP024853	Escherichia coli strain AR_0006 plasmid tig00000176, complete sequence	327-353	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_LT985287	Escherichia coli strain RPC3 plasmid RCS69_pI, complete sequence	31254-31280	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP046030	Staphylococcus chromogenes strain 1401 plasmid unnamed2, complete sequence	15566-15592	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP028999	Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence	14732-14758	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP027258	Escherichia coli strain EC11 plasmid unnamed3, complete sequence	21720-21746	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP051681	Cohnella sp. MFER-1 plasmid unnamed1	74378-74404	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP019200	Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence	31778-31804	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP023823	Escherichia coli strain 7/2 plasmid p7_2.3, complete sequence	16677-16703	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP026025	Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence	33044-33070	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_CP018988	Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence	683-709	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_MK033500	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence	7492-7518	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_MK033501	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence	55791-55817	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	107899-107925	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	HQ683709	Planktothrix phage PaV-LD, complete genome	72163-72189	6	0.778
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	KT725776	Bacillus phage vB_BceS-MY192, partial genome	2350-2376	6	0.778
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP016971	Staphylococcus epidermidis strain DAR1907 plasmid unnamed3, complete sequence	1755-1784	7	0.767
NZ_ANDK01000035_1	1.5\|88701\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88701-88730	30	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	122646-122675	7	0.767
NZ_ANDK01000035_1	1.5\|88701\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88701-88730	30	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	64627-64656	7	0.767
NZ_ANDK01000035_1	1.5\|88701\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88701-88730	30	MN855942	Bacteriophage sp. isolate 506, complete genome	3198-3227	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_KR091915	Klebsiella pneumoniae strain KPC-DK05 plasmid pKPC-DK05, complete sequence	42923-42952	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP025915	Escherichia coli strain 203740 plasmid p203740_35, complete sequence	8594-8623	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_LS999564	Escherichia coli isolate EC-TO143 plasmid 5, complete sequence	682-711	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_LN824136	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_C_Kpneumoniae_MS6671	16675-16704	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP054370	Escherichia coli strain SCU-115 plasmid pSCU-115-2, complete sequence	19258-19287	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP006640	Escherichia coli PCN061 plasmid PCN061p4, complete sequence	5957-5986	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP029801	Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_34k, complete sequence	7884-7913	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP015505	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 5, complete sequence	27842-27871	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP026060	Proteus mirabilis strain FDAARGOS_80 plasmid unnamed1, complete sequence	16877-16906	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP024853	Escherichia coli strain AR_0006 plasmid tig00000176, complete sequence	326-355	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_LT985287	Escherichia coli strain RPC3 plasmid RCS69_pI, complete sequence	31253-31282	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP028999	Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence	14730-14759	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP027258	Escherichia coli strain EC11 plasmid unnamed3, complete sequence	21718-21747	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP019200	Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence	31777-31806	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP023823	Escherichia coli strain 7/2 plasmid p7_2.3, complete sequence	16675-16704	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP026025	Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence	33042-33071	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP018988	Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence	682-711	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_MK033500	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence	7491-7520	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_MK033501	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence	55790-55819	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	107898-107927	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MN693256	Marine virus AFVG_25M339, complete genome	27548-27577	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_LR215001	Mycoplasma conjunctivae strain NCTC10147 plasmid 5	7233-7262	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MN855807	Siphoviridae sp. isolate 122, partial genome	13518-13547	7	0.767
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	FJ429185	Lactococcus phage P087, complete genome	18714-18743	7	0.767
NZ_ANDK01000035_1	1.10\|88902\|27\|NZ_ANDK01000035\|PILER-CR	88902-88928	27	MK448636	Streptococcus satellite phage Javan749, complete genome	10388-10414	7	0.741
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KY436021	Staphylococcus aureus strain NRL 99/049 plasmid pETB049, complete sequence	3530-3559	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KY436022	Staphylococcus aureus strain NRL 03/459 plasmid pETB459, complete sequence	9882-9911	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KY436024	Staphylococcus aureus strain NRL 13/791 plasmid pETB791, complete sequence	2088-2117	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KY436025	Staphylococcus aureus strain NRL 08/797 plasmid pETB797, complete sequence	3511-3540	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP016859	Staphylococcus aureus subsp. aureus strain 1971.C01 plasmid p1971.C01b, complete sequence	16992-17021	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_022126	Staphylococcus aureus subsp. aureus 55/2053 plasmid, complete sequence	20174-20203	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KU882683	Staphylococcus lugdunensis strain Tlug33G-4 plasmid pT33G-1, complete sequence	39935-39964	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KU882684	Staphylococcus lugdunensis strain Tlug8G-4 plasmid pT8G, complete sequence	5729-5758	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KX274135	Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence	6001-6030	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KR270450	Staphylococcus aureus strain SM31 plasmid pSM31, complete sequence	745-774	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KR230047	Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence	61021-61050	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KJ756353	Staphylococcus aureus strain SM39 plasmid pSM39, complete sequence	3189-3218	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP018769	Staphylococcus aureus subsp. aureus strain UCI 28 plasmid pUCI28, complete sequence	23302-23331	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007658	Staphylococcus aureus strain V2200 plasmid pV2200, complete sequence	8549-8578	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LT671860	Staphylococcus aureus subsp. aureus isolate Clinical isolate plasmid II	26926-26955	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP022909	Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence	13679-13708	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP022911	Staphylococcus aureus strain 164 plasmid pPS00089.1A.1, complete sequence	14544-14573	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	32139-32168	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030394	Staphylococcus aureus strain ER01425.3 plasmid unnamed1, complete sequence	16004-16033	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP026081	Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed	8176-8205	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029475	Staphylococcus aureus strain USA 100 isolate 30-47 plasmid unnamed, complete sequence	26499-26528	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	MN687830	Staphylococcus aureus strain 8N plasmid p_8N_qac, complete sequence	7709-7738	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030682	Staphylococcus aureus strain ER05857.3 plasmid unnamed1, complete sequence	11135-11164	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007500	Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence	11142-11171	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP031668	Staphylococcus aureus strain 199 plasmid pPS00120.1A.1, complete sequence	14893-14922	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_KF831356	Staphylococcus aureus strain A960649 plasmid pBU108b, complete sequence	18506-18535	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP026969	Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1	4897-4926	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	13776-13805	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030687	Staphylococcus aureus strain ER02919.3 plasmid unnamed1, complete sequence	22469-22498	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029659	Staphylococcus aureus strain AR_0467 plasmid unnamed1, complete sequence	7141-7170	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	34552-34581	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP046305	Staphylococcus hominis strain FDAARGOS_746 plasmid unnamed2, complete sequence	12247-12276	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP031662	Staphylococcus aureus strain 82 plasmid pPS00051.1A.1, complete sequence	14884-14913	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP031671	Staphylococcus aureus strain 64 plasmid pPS00119.1A.1, complete sequence	14894-14923	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP013958	Staphylococcus aureus strain V521 isolate Sequencing plasmid pV521, complete sequence	23840-23869	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR735438	Staphylococcus epidermidis strain none isolate Se_BPH0723 plasmid 2	39369-39398	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	25660-25689	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_018965	Staphylococcus aureus plasmid SAP077A, complete sequence	5718-5747	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_018972	Staphylococcus aureus plasmid pWBG744, complete sequence	26341-26370	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_019007	Staphylococcus aureus plasmid SAP048A, complete sequence	17151-17180	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_019008	Staphylococcus aureus plasmid SAP074A, complete sequence	26724-26753	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_019009	Staphylococcus aureus plasmid SAP078A, complete sequence	7683-7712	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_019010	Staphylococcus aureus plasmid pSK67, complete sequence	26122-26151	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029679	Staphylococcus aureus strain AR_0215 plasmid unnamed1, complete sequence	19216-19245	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP035289	Staphylococcus epidermidis strain ATCC 14990 plasmid unnamed1, complete sequence	19610-19639	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_002774	Staphylococcus aureus subsp. aureus Mu50 plasmid VRSAp, complete sequence	24914-24943	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP027420	Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence	27478-27507	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	LC377536	Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence	41700-41729	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_018976	Staphylococcus aureus plasmid p19321-P03, complete sequence	26914-26943	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_022598	Staphylococcus aureus TY825 plasmid pETB DNA, complete sequence	50224-50253	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP018843	Staphylococcus epidermidis strain 14.1.R1 plasmid pHOB1, complete sequence	5277-5306	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030413	Staphylococcus aureus strain ER02947.3 plasmid unnamed1, complete sequence	9887-9916	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP031272	Staphylococcus caprae strain 26D plasmid unnamed1, complete sequence	9883-9912	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007673	Staphylococcus aureus strain CA12 plasmid pCA12, complete sequence	1820-1849	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	1290-1319	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007677	Staphylococcus aureus strain HUV05 plasmid pHUV05-01, complete sequence	14234-14263	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007678	Staphylococcus aureus strain HUV05 plasmid pHUV05-02, complete sequence	17890-17919	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP026075	Staphylococcus aureus strain FDAARGOS_47 plasmid unnamed	730-759	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR130512	Staphylococcus aureus strain BPH2819 isolate BPH2819 plasmid 2	26693-26722	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013334	Staphylococcus aureus plasmid SAP057A, complete sequence	3534-3563	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013337	Staphylococcus aureus plasmid SAP064A, complete sequence	13632-13661	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR735430	Staphylococcus epidermidis strain none isolate Se_BPH0704 plasmid 2	14523-14552	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP035293	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence	25601-25630	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR027879	Staphylococcus aureus strain BPH2003 isolate BPH2003 plasmid 2	28143-28172	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047850	Staphylococcus aureus strain UP_403 plasmid unnamed, complete sequence	25193-25222	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029085	Staphylococcus aureus strain AR462 plasmid unnamed1, complete sequence	25215-25244	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029081	Staphylococcus aureus strain AR465 plasmid unnamed1, complete sequence	16694-16723	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP026065	Staphylococcus aureus strain FDAARGOS_19 plasmid unnamed	23511-23540	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP017683	Staphylococcus aureus strain CFSAN007850 plasmid pCFSAN007850, complete sequence	24042-24071	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013318	Staphylococcus aureus plasmid SAP012A, complete sequence	25958-25987	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013319	Staphylococcus aureus plasmid pI258, complete sequence	26014-26043	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013321	Staphylococcus aureus plasmid SAP017A, complete sequence	11087-11116	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013323	Staphylococcus aureus plasmid pCM05, complete sequence	9899-9928	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	6805-6834	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013328	Staphylococcus aureus plasmid pWBG753, complete sequence	2004-2033	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013333	Staphylococcus aureus plasmid SAP055A, complete sequence	16652-16681	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013335	Staphylococcus aureus plasmid SAP060A, complete sequence	16164-16193	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013340	Staphylococcus aureus plasmid SAP076A, complete sequence	1008-1037	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013347	Staphylococcus aureus plasmid pSK62, complete sequence	22015-22044	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	37751-37780	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013351	Staphylococcus aureus plasmid SAP063A, complete sequence	16065-16094	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013352	Staphylococcus aureus plasmid pSK76, complete sequence	11092-11121	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_005005	Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-04, complete sequence	5466-5495	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR130516	Staphylococcus aureus strain BPH2947 isolate BPH2947 plasmid 2	26808-26837	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP053641	Staphylococcus aureus strain 14505 plasmid unnamed, complete sequence	26757-26786	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_017352	Staphylococcus aureus subsp. aureus TW20 plasmid pTW20_1, complete sequence	12237-12266	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP033781	Staphylococcus epidermidis strain FDAARGOS_529 plasmid unnamed1, complete sequence	18838-18867	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030472	Staphylococcus aureus strain ER01121.3 plasmid unnamed1, complete sequence	25341-25370	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047855	Staphylococcus aureus strain UP_1525 plasmid unnamed, complete sequence	26648-26677	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047860	Staphylococcus aureus strain UP_1405 plasmid unnamed, complete sequence	26757-26786	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047864	Staphylococcus aureus strain UP_1106 plasmid unnamed, complete sequence	26757-26786	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047862	Staphylococcus aureus strain UP_1322 plasmid unnamed, complete sequence	26756-26785	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_022610	Staphylococcus aureus subsp. aureus Z172 plasmid pZ172_1, complete sequence	1671-1700	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP009047	Staphylococcus epidermidis strain SEI plasmid unnamed, complete sequence	16427-16456	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007455	Staphylococcus aureus strain 502A isolate RN6607 plasmid unnamed, complete sequence	3841-3870	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP031665	Staphylococcus aureus strain 28 plasmid pPS00026.1A.1, complete sequence	16432-16461	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030500	Staphylococcus aureus strain ER02612.3 plasmid unnamed1, complete sequence	6228-6257	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030711	Staphylococcus aureus strain ER01174.3 plasmid unnamed2, complete sequence	14954-14983	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	7257-7286	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	39472-39501	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030691	Staphylococcus aureus strain ER01422.3 plasmid unnamed1, complete sequence	8018-8047	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP023967	Staphylococcus capitis strain FDAARGOS_378 plasmid unnamed1, complete sequence	17329-17358	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047866	Staphylococcus aureus strain UP_844 plasmid unnamed, complete sequence	26755-26784	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030541	Staphylococcus aureus strain ER04164.3 plasmid unnamed1, complete sequence	19902-19931	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP045647	Staphylococcus epidermidis strain IRL01 plasmid pBPH0747-01, complete sequence	13061-13090	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047821	Staphylococcus aureus strain UP_1395 plasmid unnamed, complete sequence	26895-26924	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047818	Staphylococcus aureus strain UP_1433 plasmid unnamed1, complete sequence	26754-26783	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP010891	Staphylococcus aureus strain SA564 plasmid pSA564, complete sequence	20281-20310	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP048645	Staphylococcus aureus strain SR153 plasmid pSR02, complete sequence	25548-25577	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	13502-13531	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030627	Staphylococcus aureus strain ER01823.3 plasmid unnamed1, complete sequence	19783-19812	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP010403	Staphylococcus aureus subsp. aureus strain GR2 plasmid pGR2A, complete sequence	16629-16658	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP035792	Staphylococcus aureus strain 592 plasmid unnamed, complete sequence	26756-26785	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030543	Staphylococcus aureus strain ER04166.3 plasmid unnamed1, complete sequence	22468-22497	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP045867	Staphylococcus aureus strain CFSAN007894 plasmid pCFSAN007894, complete sequence	14103-14132	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	MK992500	Staphylococcus aureus strain 5Sau489 plasmid p5Sau489, complete sequence	43012-43041	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP022907	Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence	13680-13709	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020530	Staphylococcus aureus subsp. aureus ST228 plasmid pI1T1, complete sequence	13632-13661	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020538	Staphylococcus aureus subsp. aureus ST228 plasmid pI7S6, complete sequence	13632-13661	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020567	Staphylococcus aureus subsp. aureus ST228 plasmid pI6T6, complete sequence	13632-13661	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030594	Staphylococcus aureus strain ER03588.3 plasmid unnamed1, complete sequence	11139-11168	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	MK992499	Staphylococcus aureus strain 17Sau58 plasmid p17Sau58, complete sequence	37793-37822	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP051645	Staphylococcus caprae strain SY333 plasmid pSY333-41, complete sequence	12820-12849	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LR736240	Staphylococcus epidermidis isolate BPH0662 plasmid 4	13062-13091	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007675	Staphylococcus aureus strain CA15 plasmid pCA15, complete sequence	1107-1136	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030423	Staphylococcus aureus strain ER02972.3 plasmid unnamed1, complete sequence	23218-23247	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	32062-32091	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020565	Staphylococcus aureus subsp. aureus ST228 plasmid pI3T3, complete sequence	14962-14991	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_003265	Staphylococcus aureus TY4 plasmid pETB, complete sequence	72-101	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP027490	Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed5	2094-2123	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP007671	Staphylococcus aureus strain M121 plasmid pM121, complete sequence	6866-6895	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP020462	Staphylococcus epidermidis strain 1457 plasmid p1457, complete sequence	13053-13082	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029654	Staphylococcus aureus strain AR_0469 plasmid unnamed1, complete sequence	16716-16745	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029674	Staphylococcus aureus strain AR_0219 plasmid unnamed1, complete sequence	25036-25065	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LN831037	Staphylococcus aureus strain NCTC13435 plasmid 2, complete sequence	5628-5657	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP039163	Staphylococcus aureus strain Lr12 plasmid pLr12, complete sequence	5866-5895	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030504	Staphylococcus aureus strain ER04402.3 plasmid unnamed1, complete sequence	22468-22497	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030546	Staphylococcus aureus strain ER04181.3 plasmid unnamed1, complete sequence	14954-14983	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047858	Staphylococcus aureus strain UP_1435 plasmid unnamed2, complete sequence	26757-26786	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020534	Staphylococcus aureus subsp. aureus ST228 plasmid pI4T8, complete sequence	13631-13660	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_020539	Staphylococcus aureus subsp. aureus ST228 plasmid pI8T7, complete sequence	13631-13660	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP033731	Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence	30530-30559	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP040561	Staphylococcus aureus strain Col52-A5 plasmid pCOL52-A5, complete sequence	37074-37103	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030440	Staphylococcus aureus strain ER02746.3 plasmid unnamed1, complete sequence	7480-7509	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030450	Staphylococcus aureus strain ER04225.3 plasmid unnamed1, complete sequence	7246-7275	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP041009	Staphylococcus aureus strain FDAARGOS_766 plasmid unnamed1, complete sequence	10395-10424	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP047840	Staphylococcus aureus strain UP_678 plasmid unnamed, complete sequence	24991-25020	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	32146-32175	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030392	Staphylococcus aureus strain ER04142.3 plasmid unnamed1, complete sequence	22468-22497	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030389	Staphylococcus aureus strain ER01689.3 plasmid unnamed1, complete sequence	24174-24203	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029167	Staphylococcus aureus strain SVH7513 plasmid pSVH7513a	27376-27405	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029672	Staphylococcus aureus strain AR_0220 plasmid unnamed1, complete sequence	6303-6332	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029662	Staphylococcus aureus strain AR_0228 plasmid unnamed2, complete sequence	20288-20317	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP038184	Staphylococcus aureus strain MJ015 plasmid unnamed1, complete sequence	18634-18663	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_013378	Staphylococcus epidermidis plasmid SAP105B, complete sequence	1557-1586	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP014130	Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed1, complete sequence	11414-11443	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_017350	Staphylococcus aureus subsp. aureus 11819-97 plasmid p11819-97, complete sequence	15897-15926	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030589	Staphylococcus aureus strain ER04314.3 plasmid unnamed1, complete sequence	11136-11165	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP043303	Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence	40110-40139	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP028469	Staphylococcus aureus strain IT1-S plasmid pIT1-S, complete sequence	1008-1037	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029670	Staphylococcus aureus strain AR_0222 plasmid unnamed1, complete sequence	22248-22277	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	25178-25207	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NC_017344	Staphylococcus aureus subsp. aureus ECT-R 2 plasmid pLUH02, complete sequence	5409-5438	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP012596	Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_03, complete sequence	14416-14445	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030703	Staphylococcus aureus strain ER03321.3 plasmid unnamed1, complete sequence	6439-6468	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP029656	Staphylococcus aureus strain AR_0468 plasmid unnamed1, complete sequence	19981-20010	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MN602039	Staphylococcus capitis strain APC2923 plasmid pJOS_01, complete sequence	19229-19258	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP053355	Staphylococcus aureus strain 14507 plasmid unnamed, complete sequence	16548-16577	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_CP022683	Staphylococcus aureus strain 78 plasmid pPS00085.1A.1, complete sequence	9193-9222	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MH470063	Staphylococcus aureus strain CMRSA3 plasmid pCMRSA3, complete sequence	26843-26872	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MH785232	Staphylococcus aureus strain ch5 plasmid pLUH02, complete sequence	5400-5429	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MH785250	Staphylococcus aureus strain ch3 plasmid pLUH02, complete sequence	5408-5437	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MH587574	Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence	34966-34995	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	NZ_MF622050	Staphylococcus aureus strain ST6 plasmid pSA564-fus, complete sequence	11902-11931	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	CP030551	Staphylococcus aureus strain ER03481.3 plasmid unnamed1, complete sequence	22473-22502	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	MK504443	Lactobacillus phage 521B, complete genome	133154-133183	8	0.733
NZ_ANDK01000035_1	1.4\|88635\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88635-88664	30	MK504446	Lactobacillus phage SAC12B, complete genome	132147-132176	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP039286	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence	70939-70968	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP012103	Bacillus thuringiensis strain HS18-1 plasmid pHS18-4, complete sequence	20110-20139	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_LR214953	Mycoplasma neurolyticum strain NCTC10166 plasmid 3	5510-5539	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP009352	Francisella tularensis subsp. novicida F6168 plasmid unnamed, complete sequence	2297-2326	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NZ_CP051681	Cohnella sp. MFER-1 plasmid unnamed1	74376-74405	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NC_004952	Francisella novicida plasmid pFNL10, complete sequence	110-139	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NC_002109	Francisella tularensis plasmid pOM1, complete sequence	110-139	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	LC494302	Escherichia phage SP27 DNA, complete genome	245480-245509	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	230963-230992	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	NC_027364	Escherichia phage PBECO 4, complete genome	39408-39437	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MH383160	Escherichia phage UB, complete genome	99995-100024	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MK327931	Escherichia phage vB_EcoM_G17, complete genome	256257-256286	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MN871445	UNVERIFIED: Serratia phage KpHz_2, complete genome	75797-75826	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MK448636	Streptococcus satellite phage Javan749, complete genome	10387-10416	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MN871444	UNVERIFIED: Serratia phage KpGz_1, complete genome	13324-13353	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	MN693101	Marine virus AFVG_25M559, complete genome	25633-25662	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	KT725776	Bacillus phage vB_BceS-MY192, partial genome	2349-2378	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	187103-187132	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	KM507819	Escherichia phage 121Q, complete genome	246579-246608	8	0.733
NZ_ANDK01000035_1	1.8\|88899\|30\|NZ_ANDK01000035\|CRISPRCasFinder,CRT	88899-88928	30	HQ683709	Planktothrix phage PaV-LD, complete genome	72162-72191	9	0.7

1. spacer 1.1|88571|28|NZ_ANDK01000035|PILER-CR matches to MK448971 (Streptococcus phage Javan52, complete genome) position: , mismatch: 0, identity: 1.0

ttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
ttgacttagtgtcaacgtaaattgtcgc	Protospacer
****************************

2. spacer 1.1|88571|28|NZ_ANDK01000035|PILER-CR matches to MK448829 (Streptococcus phage Javan7, complete genome) position: , mismatch: 0, identity: 1.0

ttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
ttgacttagtgtcaacgtaaattgtcgc	Protospacer
****************************

3. spacer 1.1|88571|28|NZ_ANDK01000035|PILER-CR matches to MH853355 (Streptococcus phage LF1, complete genome) position: , mismatch: 0, identity: 1.0

ttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
ttgacttagtgtcaacgtaaattgtcgc	Protospacer
****************************

4. spacer 1.1|88571|28|NZ_ANDK01000035|PILER-CR matches to MH853358 (Streptococcus phage LF4, complete genome) position: , mismatch: 0, identity: 1.0

ttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
ttgacttagtgtcaacgtaaattgtcgc	Protospacer
****************************

5. spacer 1.3|88569|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448971 (Streptococcus phage Javan52, complete genome) position: , mismatch: 0, identity: 1.0

atttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
atttgacttagtgtcaacgtaaattgtcgc	Protospacer
******************************

6. spacer 1.3|88569|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448829 (Streptococcus phage Javan7, complete genome) position: , mismatch: 0, identity: 1.0

atttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
atttgacttagtgtcaacgtaaattgtcgc	Protospacer
******************************

7. spacer 1.3|88569|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MH853355 (Streptococcus phage LF1, complete genome) position: , mismatch: 0, identity: 1.0

atttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
atttgacttagtgtcaacgtaaattgtcgc	Protospacer
******************************

8. spacer 1.3|88569|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MH853358 (Streptococcus phage LF4, complete genome) position: , mismatch: 0, identity: 1.0

atttgacttagtgtcaacgtaaattgtcgc	CRISPR spacer
atttgacttagtgtcaacgtaaattgtcgc	Protospacer
******************************

9. spacer 1.5|88701|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448971 (Streptococcus phage Javan52, complete genome) position: , mismatch: 0, identity: 1.0

ctgttatatcaacaattaccaagtctgctg	CRISPR spacer
ctgttatatcaacaattaccaagtctgctg	Protospacer
******************************

10. spacer 1.5|88701|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448742 (Streptococcus phage Javan37, complete genome) position: , mismatch: 0, identity: 1.0

ctgttatatcaacaattaccaagtctgctg	CRISPR spacer
ctgttatatcaacaattaccaagtctgctg	Protospacer
******************************

11. spacer 1.6|88767|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448837 (Streptococcus phage Javan10, complete genome) position: , mismatch: 0, identity: 1.0

gaaggaatggaagacgaaagaatgaaatta	CRISPR spacer
gaaggaatggaagacgaaagaatgaaatta	Protospacer
******************************

12. spacer 1.7|88833|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448956 (Streptococcus phage Javan48, complete genome) position: , mismatch: 0, identity: 1.0

tgagcataaagtatattgtcttacgacatt	CRISPR spacer
tgagcataaagtatattgtcttacgacatt	Protospacer
******************************

13. spacer 1.7|88833|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448749 (Streptococcus phage Javan39, complete genome) position: , mismatch: 0, identity: 1.0

tgagcataaagtatattgtcttacgacatt	CRISPR spacer
tgagcataaagtatattgtcttacgacatt	Protospacer
******************************

14. spacer 1.9|88836|27|NZ_ANDK01000035|PILER-CR matches to MK448956 (Streptococcus phage Javan48, complete genome) position: , mismatch: 0, identity: 1.0

gagcataaagtatattgtcttacgaca	CRISPR spacer
gagcataaagtatattgtcttacgaca	Protospacer
***************************

15. spacer 1.9|88836|27|NZ_ANDK01000035|PILER-CR matches to MK448749 (Streptococcus phage Javan39, complete genome) position: , mismatch: 0, identity: 1.0

gagcataaagtatattgtcttacgaca	CRISPR spacer
gagcataaagtatattgtcttacgaca	Protospacer
***************************

16. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP035396 (Bacillus subtilis strain SRCM103697 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

aacatgaaagattttaaaaaagaacat	CRISPR spacer
cacatgaatgattttaaaaaagaactt	Protospacer
 ******* **************** *

17. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP032856 (Bacillus subtilis subsp. subtilis strain PJ-7 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

aacatgaaagattttaaaaaagaacat	CRISPR spacer
cacatgaatgattttaaaaaagaactt	Protospacer
 ******* **************** *

18. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to KC465899 (Pelagibacter phage HTVC008M, complete genome) position: , mismatch: 4, identity: 0.867

-gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tgaatat-aaagattttaaaaaagtagattt	Protospacer
 ***.** **************** * ****

19. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MT074138 (Bacteroides phage DAC17, complete genome) position: , mismatch: 4, identity: 0.852

aacatgaaagattttaaaaaagaacat	CRISPR spacer
acaatgcaagactttaaaaaagaacat	Protospacer
*  *** ****.***************

20. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MT074136 (Bacteroides phage DAC15, complete genome) position: , mismatch: 4, identity: 0.852

aacatgaaagattttaaaaaagaacat	CRISPR spacer
acaatgcaagactttaaaaaagaacat	Protospacer
*  *** ****.***************

21. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MN693256 (Marine virus AFVG_25M339, complete genome) position: , mismatch: 4, identity: 0.852

aacatgaaagattttaaaaaagaacat	CRISPR spacer
agcatgaaagatttaaaaaaagaagaa	Protospacer
*.************ ********* *

22. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP016971 (Staphylococcus epidermidis strain DAR1907 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.821

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaaaaaactattgttaataatgctaaa	Protospacer
 .* ****************. ******

23. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_MG557999 (Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagattttaaaaaagaacct	Protospacer
.. .********************* *

24. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_MF497781 (Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagattttaaaaaagaacct	Protospacer
.. .********************* *

25. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP012100 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tacatgaaagattttaaaaaatcattt	Protospacer
 ********************  *. *

26. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP012103 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-4, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
aacatcaaagattttaaaaaatgaggt	Protospacer
***** *************** .* .*

27. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP009352 (Francisella tularensis subsp. novicida F6168 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tgcatgaacgattttaaaaaagagaat	Protospacer
 .****** **************. **

28. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NC_004952 (Francisella novicida plasmid pFNL10, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tgcatgaacgattttaaaaaagagaat	Protospacer
 .****** **************. **

29. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NC_002109 (Francisella tularensis plasmid pOM1, complete sequence) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tgcatgaacgattttaaaaaagagaat	Protospacer
 .****** **************. **

30. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MN855807 (Siphoviridae sp. isolate 122, partial genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
accatgaaagatattaaaaaagattac	Protospacer
* ********** ********** .*.

31. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

32. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

33. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

34. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

35. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

36. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

37. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
catatgaaagctttgaaaaaagaacag	Protospacer
 *.******* *** ***********

38. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to FJ429185 (Lactococcus phage P087, complete genome) position: , mismatch: 5, identity: 0.815

aacatgaaagattttaaaaaagaacat	CRISPR spacer
accatgaaagatattaaaaaagattac	Protospacer
* ********** ********** .*.

39. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KY436021 (Staphylococcus aureus strain NRL 99/049 plasmid pETB049, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

40. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KY436022 (Staphylococcus aureus strain NRL 03/459 plasmid pETB459, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

41. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KY436024 (Staphylococcus aureus strain NRL 13/791 plasmid pETB791, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

42. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KY436025 (Staphylococcus aureus strain NRL 08/797 plasmid pETB797, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

43. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP016859 (Staphylococcus aureus subsp. aureus strain 1971.C01 plasmid p1971.C01b, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

44. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_022126 (Staphylococcus aureus subsp. aureus 55/2053 plasmid, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

45. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KU882683 (Staphylococcus lugdunensis strain Tlug33G-4 plasmid pT33G-1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

46. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KU882684 (Staphylococcus lugdunensis strain Tlug8G-4 plasmid pT8G, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

47. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KX274135 (Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

48. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KR270450 (Staphylococcus aureus strain SM31 plasmid pSM31, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

49. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KR230047 (Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

50. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KJ756353 (Staphylococcus aureus strain SM39 plasmid pSM39, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

51. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP018769 (Staphylococcus aureus subsp. aureus strain UCI 28 plasmid pUCI28, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

52. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007658 (Staphylococcus aureus strain V2200 plasmid pV2200, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

53. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LT671860 (Staphylococcus aureus subsp. aureus isolate Clinical isolate plasmid II) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

54. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP022909 (Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

55. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP022911 (Staphylococcus aureus strain 164 plasmid pPS00089.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

56. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

57. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030394 (Staphylococcus aureus strain ER01425.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

58. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP026081 (Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

59. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029475 (Staphylococcus aureus strain USA 100 isolate 30-47 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

60. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to MN687830 (Staphylococcus aureus strain 8N plasmid p_8N_qac, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

61. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030682 (Staphylococcus aureus strain ER05857.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

62. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007500 (Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

63. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP031668 (Staphylococcus aureus strain 199 plasmid pPS00120.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

64. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_KF831356 (Staphylococcus aureus strain A960649 plasmid pBU108b, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

65. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP026969 (Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

66. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

67. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030687 (Staphylococcus aureus strain ER02919.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

68. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029659 (Staphylococcus aureus strain AR_0467 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

69. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

70. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP046305 (Staphylococcus hominis strain FDAARGOS_746 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

71. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP031662 (Staphylococcus aureus strain 82 plasmid pPS00051.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

72. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP031671 (Staphylococcus aureus strain 64 plasmid pPS00119.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

73. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP013958 (Staphylococcus aureus strain V521 isolate Sequencing plasmid pV521, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

74. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR735438 (Staphylococcus epidermidis strain none isolate Se_BPH0723 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

75. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

76. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_018965 (Staphylococcus aureus plasmid SAP077A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

77. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_018972 (Staphylococcus aureus plasmid pWBG744, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

78. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_019007 (Staphylococcus aureus plasmid SAP048A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

79. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_019008 (Staphylococcus aureus plasmid SAP074A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

80. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_019009 (Staphylococcus aureus plasmid SAP078A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

81. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_019010 (Staphylococcus aureus plasmid pSK67, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

82. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029679 (Staphylococcus aureus strain AR_0215 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

83. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP035289 (Staphylococcus epidermidis strain ATCC 14990 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

84. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_002774 (Staphylococcus aureus subsp. aureus Mu50 plasmid VRSAp, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

85. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP027420 (Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

86. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to LC377536 (Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

87. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_018976 (Staphylococcus aureus plasmid p19321-P03, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

88. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_022598 (Staphylococcus aureus TY825 plasmid pETB DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

89. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP018843 (Staphylococcus epidermidis strain 14.1.R1 plasmid pHOB1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

90. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030413 (Staphylococcus aureus strain ER02947.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

91. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP031272 (Staphylococcus caprae strain 26D plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

92. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007673 (Staphylococcus aureus strain CA12 plasmid pCA12, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

93. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

94. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007677 (Staphylococcus aureus strain HUV05 plasmid pHUV05-01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

95. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007678 (Staphylococcus aureus strain HUV05 plasmid pHUV05-02, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

96. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP026075 (Staphylococcus aureus strain FDAARGOS_47 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

97. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR130512 (Staphylococcus aureus strain BPH2819 isolate BPH2819 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

98. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013334 (Staphylococcus aureus plasmid SAP057A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

99. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013337 (Staphylococcus aureus plasmid SAP064A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

100. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR735430 (Staphylococcus epidermidis strain none isolate Se_BPH0704 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

101. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP035293 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

102. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR027879 (Staphylococcus aureus strain BPH2003 isolate BPH2003 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

103. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047850 (Staphylococcus aureus strain UP_403 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

104. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029085 (Staphylococcus aureus strain AR462 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

105. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029081 (Staphylococcus aureus strain AR465 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

106. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP026065 (Staphylococcus aureus strain FDAARGOS_19 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

107. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP017683 (Staphylococcus aureus strain CFSAN007850 plasmid pCFSAN007850, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

108. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013318 (Staphylococcus aureus plasmid SAP012A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

109. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013319 (Staphylococcus aureus plasmid pI258, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

110. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013321 (Staphylococcus aureus plasmid SAP017A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

111. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013323 (Staphylococcus aureus plasmid pCM05, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

112. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

113. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013328 (Staphylococcus aureus plasmid pWBG753, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

114. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013333 (Staphylococcus aureus plasmid SAP055A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

115. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013335 (Staphylococcus aureus plasmid SAP060A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

116. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013340 (Staphylococcus aureus plasmid SAP076A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

117. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013347 (Staphylococcus aureus plasmid pSK62, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

118. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

119. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013351 (Staphylococcus aureus plasmid SAP063A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

120. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013352 (Staphylococcus aureus plasmid pSK76, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

121. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_005005 (Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-04, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

122. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR130516 (Staphylococcus aureus strain BPH2947 isolate BPH2947 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

123. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP053641 (Staphylococcus aureus strain 14505 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

124. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_017352 (Staphylococcus aureus subsp. aureus TW20 plasmid pTW20_1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

125. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP033781 (Staphylococcus epidermidis strain FDAARGOS_529 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

126. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030472 (Staphylococcus aureus strain ER01121.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

127. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047855 (Staphylococcus aureus strain UP_1525 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

128. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047860 (Staphylococcus aureus strain UP_1405 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

129. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047864 (Staphylococcus aureus strain UP_1106 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

130. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047862 (Staphylococcus aureus strain UP_1322 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

131. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_022610 (Staphylococcus aureus subsp. aureus Z172 plasmid pZ172_1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

132. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP009047 (Staphylococcus epidermidis strain SEI plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

133. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007455 (Staphylococcus aureus strain 502A isolate RN6607 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

134. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP031665 (Staphylococcus aureus strain 28 plasmid pPS00026.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

135. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030500 (Staphylococcus aureus strain ER02612.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

136. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030711 (Staphylococcus aureus strain ER01174.3 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

137. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
caaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

138. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
caaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

139. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030691 (Staphylococcus aureus strain ER01422.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

140. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP023967 (Staphylococcus capitis strain FDAARGOS_378 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

141. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047866 (Staphylococcus aureus strain UP_844 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

142. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030541 (Staphylococcus aureus strain ER04164.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

143. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP045647 (Staphylococcus epidermidis strain IRL01 plasmid pBPH0747-01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

144. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047821 (Staphylococcus aureus strain UP_1395 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

145. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047818 (Staphylococcus aureus strain UP_1433 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

146. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP010891 (Staphylococcus aureus strain SA564 plasmid pSA564, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

147. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP048645 (Staphylococcus aureus strain SR153 plasmid pSR02, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

148. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

149. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

150. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030627 (Staphylococcus aureus strain ER01823.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

151. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP010403 (Staphylococcus aureus subsp. aureus strain GR2 plasmid pGR2A, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

152. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP035792 (Staphylococcus aureus strain 592 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

153. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030543 (Staphylococcus aureus strain ER04166.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

154. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP045867 (Staphylococcus aureus strain CFSAN007894 plasmid pCFSAN007894, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

155. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to MK992500 (Staphylococcus aureus strain 5Sau489 plasmid p5Sau489, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

156. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP022907 (Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

157. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020530 (Staphylococcus aureus subsp. aureus ST228 plasmid pI1T1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

158. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020538 (Staphylococcus aureus subsp. aureus ST228 plasmid pI7S6, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

159. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020567 (Staphylococcus aureus subsp. aureus ST228 plasmid pI6T6, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

160. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030594 (Staphylococcus aureus strain ER03588.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

161. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to MK992499 (Staphylococcus aureus strain 17Sau58 plasmid p17Sau58, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

162. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP051645 (Staphylococcus caprae strain SY333 plasmid pSY333-41, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

163. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LR736240 (Staphylococcus epidermidis isolate BPH0662 plasmid 4) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

164. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007675 (Staphylococcus aureus strain CA15 plasmid pCA15, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

165. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030423 (Staphylococcus aureus strain ER02972.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

166. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

167. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020565 (Staphylococcus aureus subsp. aureus ST228 plasmid pI3T3, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

168. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_003265 (Staphylococcus aureus TY4 plasmid pETB, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

169. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP027490 (Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed5) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

170. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP007671 (Staphylococcus aureus strain M121 plasmid pM121, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

171. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP020462 (Staphylococcus epidermidis strain 1457 plasmid p1457, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

172. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029654 (Staphylococcus aureus strain AR_0469 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

173. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029674 (Staphylococcus aureus strain AR_0219 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

174. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LN831037 (Staphylococcus aureus strain NCTC13435 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

175. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP039163 (Staphylococcus aureus strain Lr12 plasmid pLr12, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

176. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030504 (Staphylococcus aureus strain ER04402.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

177. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030546 (Staphylococcus aureus strain ER04181.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

178. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047858 (Staphylococcus aureus strain UP_1435 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

179. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020534 (Staphylococcus aureus subsp. aureus ST228 plasmid pI4T8, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

180. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_020539 (Staphylococcus aureus subsp. aureus ST228 plasmid pI8T7, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

181. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP033731 (Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

182. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP040561 (Staphylococcus aureus strain Col52-A5 plasmid pCOL52-A5, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

183. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030440 (Staphylococcus aureus strain ER02746.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

184. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030450 (Staphylococcus aureus strain ER04225.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

185. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP041009 (Staphylococcus aureus strain FDAARGOS_766 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

186. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP047840 (Staphylococcus aureus strain UP_678 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

187. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

188. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030392 (Staphylococcus aureus strain ER04142.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

189. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030389 (Staphylococcus aureus strain ER01689.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

190. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029167 (Staphylococcus aureus strain SVH7513 plasmid pSVH7513a) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

191. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029672 (Staphylococcus aureus strain AR_0220 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

192. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029662 (Staphylococcus aureus strain AR_0228 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

193. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP038184 (Staphylococcus aureus strain MJ015 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

194. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_013378 (Staphylococcus epidermidis plasmid SAP105B, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

195. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP014130 (Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

196. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_017350 (Staphylococcus aureus subsp. aureus 11819-97 plasmid p11819-97, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

197. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030589 (Staphylococcus aureus strain ER04314.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

198. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP043303 (Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

199. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP028469 (Staphylococcus aureus strain IT1-S plasmid pIT1-S, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

200. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029670 (Staphylococcus aureus strain AR_0222 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

201. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

202. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NC_017344 (Staphylococcus aureus subsp. aureus ECT-R 2 plasmid pLUH02, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

203. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP012596 (Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_03, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

204. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030703 (Staphylococcus aureus strain ER03321.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

205. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP029656 (Staphylococcus aureus strain AR_0468 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

206. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MN602039 (Staphylococcus capitis strain APC2923 plasmid pJOS_01, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

207. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP053355 (Staphylococcus aureus strain 14507 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

208. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_CP022683 (Staphylococcus aureus strain 78 plasmid pPS00085.1A.1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

209. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MH470063 (Staphylococcus aureus strain CMRSA3 plasmid pCMRSA3, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

210. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MH785232 (Staphylococcus aureus strain ch5 plasmid pLUH02, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

211. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MH785250 (Staphylococcus aureus strain ch3 plasmid pLUH02, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

212. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MH587574 (Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

213. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to NZ_MF622050 (Staphylococcus aureus strain ST6 plasmid pSA564-fus, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

214. spacer 1.2|88637|28|NZ_ANDK01000035|PILER-CR matches to CP030551 (Staphylococcus aureus strain ER03481.3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggataaaactattgttaatagagctaaa	CRISPR spacer
taaacaaactattgttaataatgctaaa	Protospacer
 .*  ***************. ******

215. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 6, identity: 0.8

ttggata---aaactattgttaatagagctaaa	CRISPR spacer
---aataaacaaactattgttaataatgctaaa	Protospacer
   .***   ***************. ******

216. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP035396 (Bacillus subtilis strain SRCM103697 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
acacatgaatgattttaaaaaagaacttgg	Protospacer
. ******* **************** *

217. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP032856 (Bacillus subtilis subsp. subtilis strain PJ-7 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
acacatgaatgattttaaaaaagaacttgg	Protospacer
. ******* **************** *

218. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MG557999 (Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagattttaaaaaagaaccttc	Protospacer
*.. .********************* **.

219. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MF497781 (Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagattttaaaaaagaaccttc	Protospacer
*.. .********************* **.

220. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MT074138 (Bacteroides phage DAC17, complete genome) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
aacaatgcaagactttaaaaaagaacatat	Protospacer
.*  *** ****.*************** *

221. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MT074136 (Bacteroides phage DAC15, complete genome) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
aacaatgcaagactttaaaaaagaacatat	Protospacer
.*  *** ****.*************** *

222. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP046030 (Staphylococcus chromogenes strain 1401 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt---	CRISPR spacer
caccatgaaagattttagaaaag---atttagc	Protospacer
 * **************.*****   ****

223. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to AP014166 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61-MedDCM-OCT-S46-C82, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
taaagttaaagattctaaaaaagaagattt	Protospacer
 ** .* *******.********** ****

224. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

225. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

226. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

227. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

228. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

229. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_AP019717 (Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
gacatgaaagattttaaaaaaagtact	Protospacer
.********************..   *

230. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_KR091915 (Klebsiella pneumoniae strain KPC-DK05 plasmid pKPC-DK05, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

231. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP025915 (Escherichia coli strain 203740 plasmid p203740_35, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

232. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_LS999564 (Escherichia coli isolate EC-TO143 plasmid 5, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

233. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_LN824136 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_C_Kpneumoniae_MS6671) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

234. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP054370 (Escherichia coli strain SCU-115 plasmid pSCU-115-2, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

235. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP006640 (Escherichia coli PCN061 plasmid PCN061p4, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

236. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP029801 (Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_34k, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

237. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP015505 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 5, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

238. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP026060 (Proteus mirabilis strain FDAARGOS_80 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

239. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP024853 (Escherichia coli strain AR_0006 plasmid tig00000176, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

240. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_LT985287 (Escherichia coli strain RPC3 plasmid RCS69_pI, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

241. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP046030 (Staphylococcus chromogenes strain 1401 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
accatgaaagattttagaaaagattta	Protospacer
* **************.****** .

242. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP028999 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

243. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP027258 (Escherichia coli strain EC11 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

244. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP051681 (Cohnella sp. MFER-1 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
cacatgaacgattttgaaaaagaaacg	Protospacer
 ******* ******.********

245. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP019200 (Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

246. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP023823 (Escherichia coli strain 7/2 plasmid p7_2.3, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

247. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP026025 (Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

248. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_CP018988 (Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

249. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_MK033500 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

250. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_MK033501 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

251. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
ggggtgaaagatttcaaaaaagaacct	Protospacer
.. .**********.********** *

252. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to HQ683709 (Planktothrix phage PaV-LD, complete genome) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
cacatgacagattttaacaaagaattg	Protospacer
 ****** ********* ******.

253. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to KT725776 (Bacillus phage vB_BceS-MY192, partial genome) position: , mismatch: 6, identity: 0.778

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tggatgattgattttaaaaaagaacaa	Protospacer
 . ****  *****************

254. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP016971 (Staphylococcus epidermidis strain DAR1907 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaaaaaactattgttaataatgctaaa	Protospacer
 . .* ****************. ******

255. spacer 1.5|88701|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctgttatatcaacaattaccaagtctgctg	CRISPR spacer
atgttataacaacaattaccaacggtgttt	Protospacer
 ******* *************   **.*

256. spacer 1.5|88701|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ctgttatatcaacaattaccaagtctgctg	CRISPR spacer
atgttataacaacaattaccaacggtgttt	Protospacer
 ******* *************   **.*

257. spacer 1.5|88701|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN855942 (Bacteriophage sp. isolate 506, complete genome) position: , mismatch: 7, identity: 0.767

ctgttatatcaacaattaccaagtctgctg	CRISPR spacer
ttgggtcatcaataattaacaagtctgctg	Protospacer
.**   .*****.***** ***********

258. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KR091915 (Klebsiella pneumoniae strain KPC-DK05 plasmid pKPC-DK05, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

259. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP025915 (Escherichia coli strain 203740 plasmid p203740_35, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

260. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LS999564 (Escherichia coli isolate EC-TO143 plasmid 5, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

261. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LN824136 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_C_Kpneumoniae_MS6671) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

262. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP054370 (Escherichia coli strain SCU-115 plasmid pSCU-115-2, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

263. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP006640 (Escherichia coli PCN061 plasmid PCN061p4, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

264. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029801 (Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_34k, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

265. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP015505 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 5, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

266. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026060 (Proteus mirabilis strain FDAARGOS_80 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

267. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP024853 (Escherichia coli strain AR_0006 plasmid tig00000176, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

268. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LT985287 (Escherichia coli strain RPC3 plasmid RCS69_pI, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

269. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP028999 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

270. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP027258 (Escherichia coli strain EC11 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

271. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP019200 (Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

272. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP023823 (Escherichia coli strain 7/2 plasmid p7_2.3, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

273. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026025 (Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

274. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP018988 (Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

275. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MK033500 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

276. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MK033501 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

277. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gggggtgaaagatttcaaaaaagaaccttc	Protospacer
*.. .**********.********** **.

278. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN693256 (Marine virus AFVG_25M339, complete genome) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
cagcatgaaagatttaaaaaaagaagaaga	Protospacer
 *.************ ********* *

279. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR215001 (Mycoplasma conjunctivae strain NCTC10147 plasmid 5) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
ggaagataaaaattttaaaaaagagcattt	Protospacer
*.* .  ***.*************.*****

280. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN855807 (Siphoviridae sp. isolate 122, partial genome) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
caccatgaaagatattaaaaaagattacta	Protospacer
 * ********** ********** .*.*

281. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to FJ429185 (Lactococcus phage P087, complete genome) position: , mismatch: 7, identity: 0.767

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
caccatgaaagatattaaaaaagattacta	Protospacer
 * ********** ********** .*.*

282. spacer 1.10|88902|27|NZ_ANDK01000035|PILER-CR matches to MK448636 (Streptococcus satellite phage Javan749, complete genome) position: , mismatch: 7, identity: 0.741

aacatgaaagattttaaaaaagaacat	CRISPR spacer
tttataaaagattttaaaaaagaaatc	Protospacer
  .**.******************  .

283. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KY436021 (Staphylococcus aureus strain NRL 99/049 plasmid pETB049, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

284. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KY436022 (Staphylococcus aureus strain NRL 03/459 plasmid pETB459, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

285. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KY436024 (Staphylococcus aureus strain NRL 13/791 plasmid pETB791, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

286. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KY436025 (Staphylococcus aureus strain NRL 08/797 plasmid pETB797, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

287. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP016859 (Staphylococcus aureus subsp. aureus strain 1971.C01 plasmid p1971.C01b, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

288. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_022126 (Staphylococcus aureus subsp. aureus 55/2053 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

289. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KU882683 (Staphylococcus lugdunensis strain Tlug33G-4 plasmid pT33G-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

290. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KU882684 (Staphylococcus lugdunensis strain Tlug8G-4 plasmid pT8G, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

291. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KX274135 (Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

292. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KR270450 (Staphylococcus aureus strain SM31 plasmid pSM31, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

293. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KR230047 (Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

294. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KJ756353 (Staphylococcus aureus strain SM39 plasmid pSM39, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

295. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP018769 (Staphylococcus aureus subsp. aureus strain UCI 28 plasmid pUCI28, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

296. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007658 (Staphylococcus aureus strain V2200 plasmid pV2200, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

297. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LT671860 (Staphylococcus aureus subsp. aureus isolate Clinical isolate plasmid II) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

298. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP022909 (Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

299. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP022911 (Staphylococcus aureus strain 164 plasmid pPS00089.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

300. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

301. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030394 (Staphylococcus aureus strain ER01425.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

302. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026081 (Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

303. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029475 (Staphylococcus aureus strain USA 100 isolate 30-47 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

304. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN687830 (Staphylococcus aureus strain 8N plasmid p_8N_qac, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

305. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030682 (Staphylococcus aureus strain ER05857.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

306. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007500 (Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

307. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP031668 (Staphylococcus aureus strain 199 plasmid pPS00120.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

308. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_KF831356 (Staphylococcus aureus strain A960649 plasmid pBU108b, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

309. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026969 (Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

310. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

311. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030687 (Staphylococcus aureus strain ER02919.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

312. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029659 (Staphylococcus aureus strain AR_0467 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

313. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

314. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP046305 (Staphylococcus hominis strain FDAARGOS_746 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

315. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP031662 (Staphylococcus aureus strain 82 plasmid pPS00051.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

316. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP031671 (Staphylococcus aureus strain 64 plasmid pPS00119.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

317. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP013958 (Staphylococcus aureus strain V521 isolate Sequencing plasmid pV521, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

318. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR735438 (Staphylococcus epidermidis strain none isolate Se_BPH0723 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

319. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

320. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_018965 (Staphylococcus aureus plasmid SAP077A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

321. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_018972 (Staphylococcus aureus plasmid pWBG744, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

322. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_019007 (Staphylococcus aureus plasmid SAP048A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

323. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_019008 (Staphylococcus aureus plasmid SAP074A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

324. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_019009 (Staphylococcus aureus plasmid SAP078A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

325. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_019010 (Staphylococcus aureus plasmid pSK67, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

326. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029679 (Staphylococcus aureus strain AR_0215 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

327. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP035289 (Staphylococcus epidermidis strain ATCC 14990 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

328. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_002774 (Staphylococcus aureus subsp. aureus Mu50 plasmid VRSAp, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

329. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP027420 (Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

330. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to LC377536 (Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

331. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_018976 (Staphylococcus aureus plasmid p19321-P03, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

332. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_022598 (Staphylococcus aureus TY825 plasmid pETB DNA, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

333. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP018843 (Staphylococcus epidermidis strain 14.1.R1 plasmid pHOB1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

334. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030413 (Staphylococcus aureus strain ER02947.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

335. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP031272 (Staphylococcus caprae strain 26D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

336. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007673 (Staphylococcus aureus strain CA12 plasmid pCA12, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

337. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

338. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007677 (Staphylococcus aureus strain HUV05 plasmid pHUV05-01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

339. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007678 (Staphylococcus aureus strain HUV05 plasmid pHUV05-02, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

340. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026075 (Staphylococcus aureus strain FDAARGOS_47 plasmid unnamed) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

341. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR130512 (Staphylococcus aureus strain BPH2819 isolate BPH2819 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

342. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013334 (Staphylococcus aureus plasmid SAP057A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

343. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013337 (Staphylococcus aureus plasmid SAP064A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

344. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR735430 (Staphylococcus epidermidis strain none isolate Se_BPH0704 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

345. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP035293 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

346. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR027879 (Staphylococcus aureus strain BPH2003 isolate BPH2003 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

347. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047850 (Staphylococcus aureus strain UP_403 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

348. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029085 (Staphylococcus aureus strain AR462 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

349. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029081 (Staphylococcus aureus strain AR465 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

350. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP026065 (Staphylococcus aureus strain FDAARGOS_19 plasmid unnamed) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

351. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP017683 (Staphylococcus aureus strain CFSAN007850 plasmid pCFSAN007850, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

352. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013318 (Staphylococcus aureus plasmid SAP012A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

353. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013319 (Staphylococcus aureus plasmid pI258, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

354. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013321 (Staphylococcus aureus plasmid SAP017A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

355. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013323 (Staphylococcus aureus plasmid pCM05, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

356. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

357. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013328 (Staphylococcus aureus plasmid pWBG753, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

358. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013333 (Staphylococcus aureus plasmid SAP055A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

359. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013335 (Staphylococcus aureus plasmid SAP060A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

360. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013340 (Staphylococcus aureus plasmid SAP076A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

361. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013347 (Staphylococcus aureus plasmid pSK62, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

362. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

363. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013351 (Staphylococcus aureus plasmid SAP063A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

364. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013352 (Staphylococcus aureus plasmid pSK76, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

365. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_005005 (Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-04, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

366. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR130516 (Staphylococcus aureus strain BPH2947 isolate BPH2947 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

367. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP053641 (Staphylococcus aureus strain 14505 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

368. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_017352 (Staphylococcus aureus subsp. aureus TW20 plasmid pTW20_1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

369. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP033781 (Staphylococcus epidermidis strain FDAARGOS_529 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

370. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030472 (Staphylococcus aureus strain ER01121.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

371. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047855 (Staphylococcus aureus strain UP_1525 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

372. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047860 (Staphylococcus aureus strain UP_1405 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

373. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047864 (Staphylococcus aureus strain UP_1106 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

374. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047862 (Staphylococcus aureus strain UP_1322 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

375. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_022610 (Staphylococcus aureus subsp. aureus Z172 plasmid pZ172_1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

376. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP009047 (Staphylococcus epidermidis strain SEI plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

377. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007455 (Staphylococcus aureus strain 502A isolate RN6607 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

378. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP031665 (Staphylococcus aureus strain 28 plasmid pPS00026.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

379. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030500 (Staphylococcus aureus strain ER02612.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

380. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030711 (Staphylococcus aureus strain ER01174.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

381. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
accaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

382. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
accaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

383. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030691 (Staphylococcus aureus strain ER01422.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

384. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP023967 (Staphylococcus capitis strain FDAARGOS_378 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

385. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047866 (Staphylococcus aureus strain UP_844 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

386. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030541 (Staphylococcus aureus strain ER04164.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

387. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP045647 (Staphylococcus epidermidis strain IRL01 plasmid pBPH0747-01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

388. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047821 (Staphylococcus aureus strain UP_1395 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

389. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047818 (Staphylococcus aureus strain UP_1433 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

390. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP010891 (Staphylococcus aureus strain SA564 plasmid pSA564, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

391. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP048645 (Staphylococcus aureus strain SR153 plasmid pSR02, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

392. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

393. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030627 (Staphylococcus aureus strain ER01823.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

394. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP010403 (Staphylococcus aureus subsp. aureus strain GR2 plasmid pGR2A, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

395. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP035792 (Staphylococcus aureus strain 592 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

396. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030543 (Staphylococcus aureus strain ER04166.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

397. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP045867 (Staphylococcus aureus strain CFSAN007894 plasmid pCFSAN007894, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

398. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK992500 (Staphylococcus aureus strain 5Sau489 plasmid p5Sau489, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

399. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP022907 (Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

400. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020530 (Staphylococcus aureus subsp. aureus ST228 plasmid pI1T1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

401. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020538 (Staphylococcus aureus subsp. aureus ST228 plasmid pI7S6, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

402. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020567 (Staphylococcus aureus subsp. aureus ST228 plasmid pI6T6, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

403. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030594 (Staphylococcus aureus strain ER03588.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

404. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK992499 (Staphylococcus aureus strain 17Sau58 plasmid p17Sau58, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

405. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP051645 (Staphylococcus caprae strain SY333 plasmid pSY333-41, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

406. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR736240 (Staphylococcus epidermidis isolate BPH0662 plasmid 4) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

407. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007675 (Staphylococcus aureus strain CA15 plasmid pCA15, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

408. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030423 (Staphylococcus aureus strain ER02972.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

409. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

410. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020565 (Staphylococcus aureus subsp. aureus ST228 plasmid pI3T3, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

411. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_003265 (Staphylococcus aureus TY4 plasmid pETB, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

412. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP027490 (Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed5) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

413. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP007671 (Staphylococcus aureus strain M121 plasmid pM121, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

414. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP020462 (Staphylococcus epidermidis strain 1457 plasmid p1457, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

415. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029654 (Staphylococcus aureus strain AR_0469 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

416. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029674 (Staphylococcus aureus strain AR_0219 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

417. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LN831037 (Staphylococcus aureus strain NCTC13435 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

418. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP039163 (Staphylococcus aureus strain Lr12 plasmid pLr12, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

419. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030504 (Staphylococcus aureus strain ER04402.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

420. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030546 (Staphylococcus aureus strain ER04181.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

421. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047858 (Staphylococcus aureus strain UP_1435 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

422. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020534 (Staphylococcus aureus subsp. aureus ST228 plasmid pI4T8, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

423. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_020539 (Staphylococcus aureus subsp. aureus ST228 plasmid pI8T7, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

424. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP033731 (Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

425. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP040561 (Staphylococcus aureus strain Col52-A5 plasmid pCOL52-A5, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

426. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030440 (Staphylococcus aureus strain ER02746.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

427. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030450 (Staphylococcus aureus strain ER04225.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

428. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP041009 (Staphylococcus aureus strain FDAARGOS_766 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

429. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP047840 (Staphylococcus aureus strain UP_678 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

430. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

431. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030392 (Staphylococcus aureus strain ER04142.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

432. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030389 (Staphylococcus aureus strain ER01689.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

433. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029167 (Staphylococcus aureus strain SVH7513 plasmid pSVH7513a) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

434. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029672 (Staphylococcus aureus strain AR_0220 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

435. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029662 (Staphylococcus aureus strain AR_0228 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

436. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP038184 (Staphylococcus aureus strain MJ015 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

437. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_013378 (Staphylococcus epidermidis plasmid SAP105B, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

438. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP014130 (Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

439. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_017350 (Staphylococcus aureus subsp. aureus 11819-97 plasmid p11819-97, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

440. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030589 (Staphylococcus aureus strain ER04314.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

441. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP043303 (Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

442. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP028469 (Staphylococcus aureus strain IT1-S plasmid pIT1-S, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

443. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029670 (Staphylococcus aureus strain AR_0222 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

444. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

445. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_017344 (Staphylococcus aureus subsp. aureus ECT-R 2 plasmid pLUH02, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

446. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP012596 (Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_03, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

447. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030703 (Staphylococcus aureus strain ER03321.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

448. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP029656 (Staphylococcus aureus strain AR_0468 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

449. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MN602039 (Staphylococcus capitis strain APC2923 plasmid pJOS_01, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

450. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP053355 (Staphylococcus aureus strain 14507 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

451. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP022683 (Staphylococcus aureus strain 78 plasmid pPS00085.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

452. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MH470063 (Staphylococcus aureus strain CMRSA3 plasmid pCMRSA3, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

453. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MH785232 (Staphylococcus aureus strain ch5 plasmid pLUH02, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

454. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MH785250 (Staphylococcus aureus strain ch3 plasmid pLUH02, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

455. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MH587574 (Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

456. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_MF622050 (Staphylococcus aureus strain ST6 plasmid pSA564-fus, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

457. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to CP030551 (Staphylococcus aureus strain ER03481.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
actaaacaaactattgttaataatgctaaa	Protospacer
 . .*  ***************. ******

458. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK504443 (Lactobacillus phage 521B, complete genome) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
ttagataaaactattgttaatcattatagt	Protospacer
**.****************** .   **.

459. spacer 1.4|88635|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK504446 (Lactobacillus phage SAC12B, complete genome) position: , mismatch: 8, identity: 0.733

ttggataaaactattgttaatagagctaaa	CRISPR spacer
ttagataaaactattgttaatcattatagt	Protospacer
**.****************** .   **.

460. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP039286 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tatactagtagaatttaaaaaagaacattt	Protospacer
 *   *.. *** *****************

461. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP012103 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-4, complete sequence) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
aaacatcaaagattttaaaaaatgaggtcg	Protospacer
.***** *************** .* .*.

462. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_LR214953 (Mycoplasma neurolyticum strain NCTC10166 plasmid 3) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
aattgataaaaattttaaaaaacaacattt	Protospacer
.* ..  ***.*********** *******

463. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP009352 (Francisella tularensis subsp. novicida F6168 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
ttgcatgaacgattttaaaaaagagaatag	Protospacer
  .****** **************. **

464. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NZ_CP051681 (Cohnella sp. MFER-1 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcacatgaacgattttgaaaaagaaacggt	Protospacer
  ******* ******.********    *

465. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_004952 (Francisella novicida plasmid pFNL10, complete sequence) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
ttgcatgaacgattttaaaaaagagaatag	Protospacer
  .****** **************. **

466. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_002109 (Francisella tularensis plasmid pOM1, complete sequence) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
ttgcatgaacgattttaaaaaagagaatag	Protospacer
  .****** **************. **

467. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

468. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

469. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

470. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

471. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

472. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN871445 (UNVERIFIED: Serratia phage KpHz_2, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
attcctcttagatttaaaaaaagaacattt	Protospacer
.  * *   ****** **************

473. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MK448636 (Streptococcus satellite phage Javan749, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gtttataaaagattttaaaaaagaaatcta	Protospacer
*  .**.******************  .*

474. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN871444 (UNVERIFIED: Serratia phage KpGz_1, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
attcctcttagatttaaaaaaagaacattt	Protospacer
.  * *   ****** **************

475. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to MN693101 (Marine virus AFVG_25M559, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
aagagtagaagaatttaaaaaagaacattg	Protospacer
.*. .*..**** ****************

476. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to KT725776 (Bacillus phage vB_BceS-MY192, partial genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
gtggatgattgattttaaaaaagaacaagg	Protospacer
* . ****  *****************

477. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

478. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 8, identity: 0.733

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
tcatatgaaagctttgaaaaaagaacagaa	Protospacer
  *.******* *** ***********

479. spacer 1.8|88899|30|NZ_ANDK01000035|CRISPRCasFinder,CRT matches to HQ683709 (Planktothrix phage PaV-LD, complete genome) position: , mismatch: 9, identity: 0.7

gaacatgaaagattttaaaaaagaacattt	CRISPR spacer
ccacatgacagattttaacaaagaattggc	Protospacer
  ****** ********* ******.   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

172106 : 181490

uncultured_Caudovirales_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000120355.1\|172106_172808_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.2e-35	39.9
WP_000246600.1\|172944_175065_-	type I DNA topoisomerase	E3T4K4	Cafeteria_roenbergensis_virus	1.4e-102	37.7
WP_001015250.1\|175159_176002_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	8.5e-27	35.8
WP_000162771.1\|176139_177168_-	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000614751.1\|177229_177991_-	ATP-binding cassette domain-containing protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.7e-18	28.6
WP_000588576.1\|177987_178962_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.6e-05	21.2
WP_000735588.1\|178958_179921_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.3e-83	50.3
WP_000136509.1\|180159_180708_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_000201088.1\|180728_181490_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	1.5e-25	40.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_ANDK01000014

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13267 : 59360

Streptococcus_phage(73.77%)

capsid,tail,portal,integrase,terminase,transposase,holin

attL 19196:19211|attR 55623:55638

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000595708.1\|13267_14464_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	4.6e-103	54.5
WP_001068667.1\|15043_15391_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_000264734.1\|15615_16695_-\|integrase	site-specific integrase	A0A1S5SCC5	Streptococcus_phage	4.8e-67	41.3
WP_000505363.1\|16817_17021_-	hypothetical protein	D2J022	Enterococcus_phage	7.3e-09	47.5
WP_000891067.1\|17123_17681_-	GTP pyrophosphokinase	Q0H269	Geobacillus_phage	1.6e-18	30.2
WP_000550055.1\|17682_18480_-	XRE family transcriptional regulator	A0A1S5S8S8	Streptococcus_phage	2.6e-65	74.7
WP_000392846.1\|18840_18984_+	hypothetical protein	NA	NA	NA	NA
WP_001107539.1\|18980_19205_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.2e-22	67.6
19196:19211	attL	NA	NA	NA	NA
WP_001104154.1\|19263_19422_+	hypothetical protein	J7KH24	Streptococcus_phage	9.9e-22	92.3
WP_000394501.1\|19451_19640_+	hypothetical protein	NA	NA	NA	NA
WP_000573030.1\|19622_20429_-	DUF4393 domain-containing protein	A0A1S5SD60	Streptococcus_phage	1.9e-28	36.5
WP_001183891.1\|20480_20672_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001072517.1\|20739_21489_+	phage antirepressor Ant	F8HGQ0	Streptococcus_phage	6.5e-79	60.0
WP_001247544.1\|21500_21644_+	hypothetical protein	J7KIV4	Streptococcus_phage	1.6e-18	100.0
WP_000879943.1\|21793_22024_+	hypothetical protein	NA	NA	NA	NA
WP_000431178.1\|22161_22386_+	hypothetical protein	J7KBY5	Streptococcus_phage	1.7e-35	95.9
WP_000774716.1\|22396_23257_+	DnaD domain protein	J7KBV5	Streptococcus_phage	5.6e-58	85.5
WP_000371783.1\|23237_23471_+	hypothetical protein	Q938N1	Temperate_phage	8.0e-36	94.8
WP_000166038.1\|23467_23608_+	hypothetical protein	A0A1X9I6Y1	Streptococcus_phage	2.6e-05	54.5
WP_000229417.1\|23618_23873_+	hypothetical protein	J7KK18	Streptococcus_phage	1.1e-30	79.8
WP_001001351.1\|23875_24037_+	hypothetical protein	J7KDI4	Streptococcus_phage	5.2e-18	84.9
WP_000323859.1\|24038_24521_+	siphovirus Gp157 family protein	Q938M9	Temperate_phage	1.2e-44	92.5
WP_001231960.1\|24521_25196_+	single-stranded DNA-binding protein	Q938M8	Temperate_phage	7.6e-95	82.6
WP_000609377.1\|25188_25605_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.5e-56	80.6
WP_000165747.1\|25608_25812_+	hypothetical protein	J7KIX6	Streptococcus_phage	1.7e-26	96.8
WP_000143298.1\|25801_26278_+	RusA family crossover junction endodeoxyribonuclease	J7KBT1	Streptococcus_phage	1.3e-59	98.2
WP_000129030.1\|26267_26615_+	hypothetical protein	J7KK12	Streptococcus_phage	2.2e-53	87.0
WP_000763909.1\|26626_26929_+	DUF1599 domain-containing protein	J7KDH9	Streptococcus_phage	1.0e-30	74.7
WP_000906736.1\|26932_27064_+	hypothetical protein	NA	NA	NA	NA
WP_000612734.1\|27063_27480_+	hypothetical protein	Q938M1	Temperate_phage	1.1e-32	58.5
WP_000159369.1\|27476_27641_+	hypothetical protein	NA	NA	NA	NA
WP_000139629.1\|27637_27907_+	hypothetical protein	A7J287	Streptococcus_phage	1.3e-24	70.8
WP_000052302.1\|27909_28242_+	hypothetical protein	J7KDM7	Streptococcus_phage	2.6e-27	55.8
WP_011058321.1\|28324_28456_+	hypothetical protein	NA	NA	NA	NA
WP_001019148.1\|28548_29082_+	DUF1642 domain-containing protein	A0A097PAV5	Streptococcus_pyogenes_phage	1.6e-23	41.4
WP_000660741.1\|29078_29345_+	hypothetical protein	NA	NA	NA	NA
WP_011058322.1\|29732_30161_+	DUF1492 domain-containing protein	A0A0B5A564	Streptococcus_phage	6.4e-31	49.3
WP_017646473.1\|30743_31121_+	HNH endonuclease	Q7Y4J1	Streptococcus_phage	2.1e-41	71.3
WP_000725957.1\|31272_31629_+	hypothetical protein	A0A0B5A7G9	Streptococcus_phage	5.9e-22	49.6
WP_001108669.1\|31625_32894_+\|portal	phage portal protein	A0A1X9I693	Streptococcus_phage	8.2e-191	76.2
WP_000227333.1\|32886_34107_+	hypothetical protein	Q7Y4I9	Streptococcus_phage	6.6e-113	66.0
WP_000421991.1\|34106_34295_+	hypothetical protein	NA	NA	NA	NA
WP_000256853.1\|34402_35818_+\|terminase	terminase	A0A0B5A091	Streptococcus_phage	6.3e-216	74.8
WP_001288694.1\|35898_36363_+	DUF4355 domain-containing protein	A0A0B5A7G6	Streptococcus_phage	9.7e-41	51.3
WP_000841023.1\|36365_37268_+\|capsid	phage major capsid protein	A0A0B5A5W3	Streptococcus_phage	9.7e-146	86.0
WP_000640307.1\|37264_37480_+	hypothetical protein	M1PRX2	Streptococcus_phage	6.5e-08	52.9
WP_000180800.1\|37493_37925_+	hypothetical protein	A0A0B5A2F6	Streptococcus_phage	3.8e-47	70.1
WP_000517229.1\|37875_38214_+	hypothetical protein	A0A0B5A086	Streptococcus_phage	1.4e-41	67.9
WP_000032787.1\|38206_38443_+	hypothetical protein	A0A1P8BMT2	Lactococcus_phage	2.5e-21	66.7
WP_000573598.1\|38443_38779_+	hypothetical protein	A0A1P8BMR5	Lactococcus_phage	9.8e-35	64.9
WP_000226354.1\|38788_39346_+\|tail	tail protein	M1PKG8	Streptococcus_phage	3.4e-64	65.8
WP_000858406.1\|39345_39591_+	hypothetical protein	A0A0B5A2F3	Streptococcus_phage	9.7e-16	55.3
WP_000916438.1\|39605_39977_+	DUF5361 domain-containing protein	A0A1P8BMT6	Lactococcus_phage	7.3e-31	54.0
WP_000224695.1\|39976_41989_+	hypothetical protein	Q9F4J3	Streptococcus_phage	9.8e-13	58.9
WP_000228810.1\|41982_43503_+	hypothetical protein	J7KH53	Streptococcus_phage	2.9e-203	74.6
WP_000955555.1\|43503_47628_+	CHAP domain-containing protein	J7KBT9	Streptococcus_phage	0.0e+00	75.6
WP_000536253.1\|47638_49645_+	hypothetical protein	J7KK23	Streptococcus_phage	3.6e-140	43.3
WP_000494205.1\|49670_50000_+	DUF1366 domain-containing protein	J7KDI9	Streptococcus_phage	7.2e-22	54.3
WP_000698337.1\|49974_50187_+	hypothetical protein	J7KDP6	Streptococcus_phage	2.1e-14	60.0
WP_000215499.1\|50199_50502_+	hypothetical protein	X2KT07	Streptococcus_phage	2.2e-25	59.6
WP_001001742.1\|50503_50839_+\|holin	phage holin	A0A1P8VVK6	Streptococcus_phage	6.8e-36	71.2
WP_000236381.1\|50840_51560_+	CHAP domain-containing protein	A0A1U9WRD0	Streptococcus_virus	1.6e-58	72.1
WP_000812952.1\|51892_52864_+	Abi family protein	A0A059NT88	Lactococcus_phage	1.3e-74	42.6
WP_000076715.1\|52967_53168_+	CsbD family protein	J7KJ36	Streptococcus_phage	9.6e-22	87.9
WP_000356856.1\|53208_53379_-	hypothetical protein	A0A286QNA2	Streptococcus_phage	1.1e-07	63.8
WP_000965642.1\|53795_53975_+	hypothetical protein	J7KIW4	Streptococcus_phage	2.1e-20	86.2
WP_079218646.1\|54074_54689_-\|integrase	site-specific integrase	F8HGP4	Streptococcus_phage	9.2e-55	60.7
WP_001872365.1\|54691_54958_-	hypothetical protein	Q77YW7	Streptococcus_phage	9.2e-20	65.2
WP_000640620.1\|54957_55362_+	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	1.3e-20	43.6
WP_001122304.1\|55523_55724_+\|transposase	IS3 family transposase	NA	NA	NA	NA
55623:55638	attR	NA	NA	NA	NA
WP_001872364.1\|55748_56006_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	5.8e-11	43.5
WP_001867107.1\|56131_56341_+\|transposase	transposase	NA	NA	NA	NA
WP_079261184.1\|56513_56675_-	TM2 domain-containing protein	NA	NA	NA	NA
WP_000594360.1\|57416_58694_+	ABC transporter permease	NA	NA	NA	NA
WP_000353149.1\|58703_59360_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-22	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_ANDK01000029

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

162409 : 173142

Streptococcus_phage(84.62%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001185979.1\|162409_163174_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-14	24.3
WP_000178150.1\|163173_163884_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-13	29.1
WP_001144242.1\|163902_164562_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	8.0e-65	56.5
WP_000715592.1\|164650_165286_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.8e-67	61.1
WP_000364568.1\|165305_166169_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.5e-74	50.0
WP_000358198.1\|166199_166526_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.2e-30	61.1
WP_001867099.1\|166531_167395_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-109	70.4
WP_079254671.1\|167370_167532_-	hypothetical protein	NA	NA	NA	NA
WP_001868293.1\|167516_167621_+	hypothetical protein	NA	NA	NA	NA
WP_000603271.1\|167664_168300_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_000158397.1\|168432_169524_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	3.9e-165	78.0
WP_001198082.1\|169592_170141_+	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	1.4e-54	57.9
WP_000232154.1\|170202_171384_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	9.1e-168	75.3
WP_000966769.1\|171439_171916_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.6e-38	50.9
WP_000287943.1\|171917_172274_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.2e-42	72.6
WP_000767486.1\|172314_173142_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.1e-124	78.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_ANDK01000001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ANDK01000001_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ANDK01000001_1

783-881

Orphan

Consensus_repeat	Method
TTACGGTGGTTTCATGGTTTCCTCCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ANDK01000001_1

>merge|NZ_ANDK01000001|1|783-881|CRISPRCasFinder
TTACGGTGGTTTCATGGTTTCCTCCTTATTAATGTAAAAATACTATCGTTTCAATGTTTTTATGTTTAATTTTTACGGTGGTTTCATGGTTTCCTCCTT

>NZ_ANDK01000001|1|1|783-881|CRISPRCasFinder
TTACGGTGGTTTCATGGTTTCCTCCTT	ATTAATGTAAAAATACTATCGTTTCAATGTTTTTATGTTTAATTT
TTACGGTGGTTTCATGGTTTCCTCCTT

>NZ_ANDK01000001.1|WP_000161978.1|922_1456_-|hypothetical-protein
MTKKERVKARKTYDERNYELMESLWKEELEKIPRWNRKENDGFTTIPRWLPIINRIMDKLSQGKPISSTYLSLWFRVNDEGFIHIKDEKQMAIESGFDSERNISTWKTRMRELEKFGFINSIRGVKGEFQYVLIVNPLNVIENLENITEYSSLPKSIKEIISQYKINLQERMSEVGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_ANDK01000027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ANDK01000027_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ANDK01000027_1

100574-100649

Orphan

Consensus_repeat	Method
TGATGTTAAACAAGTATCAGTTGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ANDK01000027_1

>merge|NZ_ANDK01000027|1|100574-100649|CRISPRCasFinder
TGATGTTAAACAAGTATCAGTTGCTAAAGCAAGCGTGTTGCCAAGTACTGGTGATGTTAAACAAGTATCAGTTGCT

>NZ_ANDK01000027|1|1|100574-100649|CRISPRCasFinder
TGATGTTAAACAAGTATCAGTTGCT	AAAGCAAGCGTGTTGCCAAGTACTGG
TGATGTTAAACAAGTATCAGTTGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ANDK01000027.1\|WP_000208122.1\|97593_97791_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_ANDK01000027.1\|WP_000651825.1\|105253_106006_+\|membrane-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000162146.1\|91950_93291_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341046
NZ_ANDK01000027.1\|WP_000176428.1\|107908_110260_+\|DUF87-domain-containing-protein	unknown	unknown	gnl\|CDD\|274279
NZ_ANDK01000027.1\|WP_017645959.1\|104719_105205_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000609828.1\|107048_107507_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_017645960.1\|110264_110408_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000447421.1\|95668_96112_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000447008.1\|104386_104614_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_001282475.1\|94590_94962_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_001037292.1\|107568_107928_+\|PrgI-family-protein	unknown	unknown	gnl\|CDD\|378907
NZ_ANDK01000027.1\|WP_000129105.1\|98173_98473_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000938679.1\|97411_97597_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000040950.1\|106019_106517_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000481327.1\|93493_94477_+\|GMP-reductase	unknown	unknown	gnl\|CDD\|235479
NZ_ANDK01000027.1\|WP_000362731.1\|106760_106988_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ANDK01000027.1\|WP_000191926.1\|95145_95403_+\|DUF3850-domain-containing-protein	unknown	unknown	gnl\|CDD\|372409
NZ_ANDK01000027.1\|WP_017645958.1\|101466_104112_+\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|375647
NZ_ANDK01000027.1\|WP_000822468.1\|96384_97410_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_ANDK01000027.1\|WP_001867987.1\|90987_91680_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_ANDK01000027.1\|WP_000208122.1\|97593_97791_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.56498e-16
NZ_ANDK01000027.1\|WP_001037292.1\|107568_107928_+\|PrgI-family-protein	gnl\|CDD\|378907	pfam12666, PrgI, PrgI family protein. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 116 and 146 amino acids in length. This protein is found in an operon that is part of a Type IV secretion system.	0.00186887
NZ_ANDK01000027.1\|WP_000162146.1\|91950_93291_+\|MFS-transporter	gnl\|CDD\|341046	cd17503, MFS_LmrB_MDR_like, Bacillus subtilis lincomycin resistance protein (LmrB) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including Bacillus subtilis lincomycin resistance protein LmrB, and several proteins from Escherichia coli such as the putative MDR transporters EmrB, MdtD, and YieQ. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.42202e-59
NZ_ANDK01000027.1\|WP_000176428.1\|107908_110260_+\|DUF87-domain-containing-protein	gnl\|CDD\|274279	TIGR02746, hypothetical_protein, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.	9.6429e-17
NZ_ANDK01000027.1\|WP_000481327.1\|93493_94477_+\|GMP-reductase	gnl\|CDD\|235479	PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional.	0
NZ_ANDK01000027.1\|WP_017645958.1\|101466_104112_+\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|375647	pfam18220, BspA_v, Adhesin BspA variable domain. This domain is found in BspA protein present in Streptococcus agalactiae. BspA is an antigen I/II family polypeptide that confers adhesion linked to pathogenesis in group B Streptococcus. This domain is referred to as the variable domain (BspA-V). BspA-V is responsible for binding to scavenger receptor gp340. BspA-V adopts a fold that is distinct from those of other AgI/II family polypeptide variable domains.	3.87373e-86
NZ_ANDK01000027.1\|WP_000822468.1\|96384_97410_+\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	2.54502e-32
NZ_ANDK01000027.1\|WP_000191926.1\|95145_95403_+\|DUF3850-domain-containing-protein	gnl\|CDD\|372409	pfam12961, DUF3850, Domain of Unknown Function with PDB structure (DUF3850). The search results from NCBI sequence alignment indicates a conserved domain belonging to ASCH superfamily. Dali searching results show that the protein is a structurally similar to the PUA domain, suggesting it may be involved in RNA recognition. It has been reported that the deletion of PUA genes results in impaired growth (RluD) and competitive disadvantage (TruB) in Escherichia coli. Suggestions have been put forward that, apart from their usual catalytic role, certain PUS enzymes (e.g. TruB) may also act as chaperones for RNA folding. The interface interaction indicates that the biomolecule of protein NP_809782.1 should be a dimer.	1.25228e-26

>NZ_ANDK01000027.1|WP_000129105.1|98173_98473_+|hypothetical-protein
MTDETKKVYLRDLRNLGKQGGATARLEDGTELFLKPDYAVRTAKGYVDGIPRDVEFHLTYRSIFNQIRTIKKDGHLVARKERSPSGLVLQLTGKGYKRP
>NZ_ANDK01000027.1|WP_000208122.1|97593_97791_+|helix-turn-helix-transcriptional-regulator
MTTITQNRVKELRKQAGLSQQALADQIGVMRKTISHWELGNHRISTDNAKKLSQFFQVSIDDLLE
>NZ_ANDK01000027.1|WP_000938679.1|97411_97597_+|hypothetical-protein
MLQDEFRPIPHKVLTIGRSPKESVIAIPKAIFNLPPEEKAQALKELEEDMEQHKAKGGDST
>NZ_ANDK01000027.1|WP_000822468.1|96384_97410_+|replication-initiator-protein-A
MKRISARQVQSSERFYRIPKIFVESPFYKSMSTDAKFTYAILKDRFELSLKNNWIDKNGDVYLIYTVTELQEILGYGNKKVIKLKKELQEYGLLEEVRQGLNKPNLLYLGNVDYQNVPTEEIHSKPSSVAEVSKQHFQKNQGNVKMTRQKMSKRHANDTENSETELSNDTNRYQGDASLDILSASDSFQMGQHGFLSSKTINRLSLFGKEAKLLENKIYQAKRQVEKDYSHLLQHQEIIYGEVWSQELEREVDKLIFKIKTGENEGKAIKNIPGYFYKMMVRFWKMALLIEKEQGFIALSNQSDYAKSFPEECPSLISYYYPNKLSEKELNQYLTTLRMEE
>NZ_ANDK01000027.1|WP_000447421.1|95668_96112_+|hypothetical-protein
METGIKKGHFKESVEKRIHSQHMRIEPNISNRSTRIRDISYDQSKKLYRVTIVRNGIRYGGKHFKKLGEAQKYKKQLLEDIKRKIKESQMSQTAIAQLTKNMMVFNVVVLSLGYFNVIPYKWSLILWGSAVFTAIFNEISKQIPDEK
>NZ_ANDK01000027.1|WP_000191926.1|95145_95403_+|DUF3850-domain-containing-protein
MTQHLLNCYPEYFEAIMDGTKTFECRYNDRDFKVGDELLLREYDPQKGYTYRCIVRKITYILSDFIGLKDGYVILGVTNEPIDYF
>NZ_ANDK01000027.1|WP_001282475.1|94590_94962_+|hypothetical-protein
MSDNIEIIMDIETLDIFEVIDLDEEKGVTVSDSETFPKEEKASPYDDLNRIWLRNGYYYKPSSLLWEVIENGIIHDLSSRNKHGTYPYYQNLRDGTWGHVKQLTQEEALWLTLELNPDLMNYV
>NZ_ANDK01000027.1|WP_000481327.1|93493_94477_+|GMP-reductase
MFNDIPVFDYEDIQLIPNKCIISSRSQADTSVKLGNYTFKLPVIPANMQTIIDEEVAETLACEGYFYIMHRFNEEERKPFIKRMHDKGLIASISVGVKDYEYDFVTSLKEDAPEFITIDIAHGHSNSVIEMIQHIKQELPETFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKVKTGFGTGGWQLAALRWCSKAARKPIIADGGIRTHGDIAKSIRFGASMVMIGSLFAGHLESPGKLVEVDGQQFKEYYGSASEYQKGEHKNVEGKKILLPVKGRLEDTLTEMQQDLQSSISYAGGKELDSLRHVDYVIVKNSIWNGDSI
>NZ_ANDK01000027.1|WP_000162146.1|91950_93291_+|MFS-transporter
MTKKGWRIMPAIITTAILGFSGILIETSMNVTFPLLMKEFGVNPAVIQWVTTGNLLAVAVTVPLSAFMIKNLSERQIFTLANVLFLSGVLIDSFAPNLAILLVGRVLQGVGTGLALPLLFHIILTQIPMERRGLMMGVAAMVTLLAPAVGPTYGGVISGMLGWKMIFMLLAPILIISTFIGLASIPKRQVRINDKLNFPAFVSLGIGLATLLLAIEKMSIFYLLVAIVSFVIFYYLNKQLEFLNLNVFKDKDFSILLYGVLAFQMIPLALSFLLPNLLQLVLHQTSTKAGLFMFPGAIAVVFLSPFAGYLLDKIGAFKPIMIGISLSLIGLIGTAIFIPAKFVVVLLAFDILTKIGMGIGASNMVTTALTKLKPAQSADGNSILNTLQQFAGAFATAVASQIFTIGQVAIPKNGAIIGSQFAVLFVIIVVILAIVGLTYLRKRKAI
>NZ_ANDK01000027.1|WP_001867987.1|90987_91680_-|hypothetical-protein
MLIPKKIVAFASNESENNFFITLKTYFNYLFSIQIITDISTLNHADFDGSFAFHDIETSIPHLVIDSNYLAISQTNSKTEANDIKTFSELSKTMTEFHYMLNFDLFNHLPYRFRLHNKDGQTIYSNHKPEDPFDIYPEEEYPIDKWVQNSLIEKKAKELHLLLPGASQDYILVQSYKRLENDSGQLVGYIEHVHNIKPLLEGYLKESGQAIVGWSDVTSGASISNDDFEL
>NZ_ANDK01000027.1|WP_017645958.1|101466_104112_+|LPXTG-cell-wall-anchor-domain-containing-protein
MNSQETKGHGFFRKSKAYGLVCGIALAGAFTLATSQVSADQVTTQATTQTVTQNQAETVTSTQLDKAVDTAKKAAVAVTTTTAVNHATTTDAQADLANQTQAVKDVTAKAQANTQAIKDATAENAKIDAENKAESQRVSQLNAQNKAKIDAENKDAQAKADATNAQLQKDYQTKLANIKSVEAYNAGVRQRNKDAQAKADATNAQLQKDYQAKLALYNQALKAKAEADKQSINNVAFDIKAQAKGVDNAEYGNSIMTAKTKPDGSFEFNHDMIDGVKTIGYGKLTGKVNHHYVANKDGSVTAFVDSVTLYKYEYRNVAQNAAVNQNIVFRVLTKDGRPIFEKAHNGNKTFAETLNKTLQLNLKYELKPHASSGNVEVFKIHDDWVHDTHGSALVSYVNNNDAVPNVVIPEQPTPPKPEKVTPEAEKPVPEKPVEPKLVTPVLKTYTPVKFIPREYKPVPSTPETFTPEKFTPAQPKVKPHVSVPEKINYKVAVHPVQIPKATPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNGTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHTPEKPKPVMPQKVTPKAPALPSTGEQGVSVLTVLGAALLSLLGLVGFKKRQQ
>NZ_ANDK01000027.1|WP_000447008.1|104386_104614_+|hypothetical-protein
METAVRVVTAMGAILAIVGLGWVLTGAFDYFAGRKNGSPQMMDQGFTSMISGGALAVIAAGVAAAIVAAMRAISF
>NZ_ANDK01000027.1|WP_017645959.1|104719_105205_+|hypothetical-protein
MSESFDYVAFARDFEKRHGRPPTAEELEKANVEGYKDKSSFGERLKTGLSFVIRNFFRVLLILIQTPVYLTLFFFNLIKSAFAVVIMCIITKAVFGVIIAEIFDSQNIDNLSQAPKLLGFFAQDFMTNNLEPIYFTEIDIIICIIFSVFLALVMTFSKSEV
>NZ_ANDK01000027.1|WP_000651825.1|105253_106006_+|membrane-protein
MKDILSELTKGLGSYNSSVNNSMTAVNKSLMAIGYILVSILFLLELLSWYRFIRNQGGEMTWKLFLEVAVKYFIAYFLVSQSGAILNAILWFTNTVTKLIGVDLSGSNLFEFKALKKGAYGIRTGLNFLAYLIGATAIVSIKVMVLLRFIELYFYKAIAPVIVAFWMGDDTRHIAKNFLKTFGAIALQSAVIIILLAIWQGFKVDTAMQLDKNSWLGTYAPAISYIGKCIIFLILLFGSQRKAKQLLQVS
>NZ_ANDK01000027.1|WP_000040950.1|106019_106517_+|hypothetical-protein
MSKLQQLIEKDFLRLTLENSPLHRSQTDCDYSDTCDRDVEQVYERLKGLIVLLLLKNQLKLSDMSRENRINCLETSGYFGIAAHRYASDSGDIAYLTEVLSIMYEDAAYGAMNGIINKNEFHALICQWLNYFDYDKIEFKGDKNFERYFQEQKEKHGELFEAFGL
>NZ_ANDK01000027.1|WP_000362731.1|106760_106988_+|hypothetical-protein
MDLEQLKQRRDELTRDNEWMDGLIKEKEEELWELKVRSIAASELARSAMQSAMRTAGIVDSFYGPSAQSSDNQTN
>NZ_ANDK01000027.1|WP_000609828.1|107048_107507_+|hypothetical-protein
MINQGQEYQYFKDKISHLEREVSRLSSYEYEHRLLKDVIADCLLQGQLTVSELPQAIRLIQGDDLFYTYAWRFVEATGDCQAGITILKILQDDLNYFFAIGKLSQKQYSQWLEKWLSFLERGRIAFKGEKDFERYFQDQTEANRSLFSDFNL
>NZ_ANDK01000027.1|WP_001037292.1|107568_107928_+|PrgI-family-protein
MNKLGSEFFKAIDQFERGIIGSFTWRQILMFFGIVLGVGLATVISLLQLPSILFYLSLVLTVPPAFIYGIKKDEHIKEVITFRLKVQERAYQTEYESEENYGAFIPQKGIQEWNDPNEN
>NZ_ANDK01000027.1|WP_000176428.1|107908_110260_+|DUF87-domain-containing-protein
MTLTKTEKERAKQLQRALKASTQNTIQYTSLFEDGLMHIVDESYSKTWQLGDTNYITGSEDEKLDIIEYYVDALNGLDSENTYQLTILNRPVPTTLLDQITYDLEGDERDVFRKEYNNIIRSRFAKDQNNFKVEKFVTVSTRAKDRKQAYRKLNDVDTHFTTQFQLVDVLLKSLDGTERLNIFADLLRGNPYLDVDYKDVRISGLSTKSFIAPGRLWFQPDQFMMDKKYCKILFPRTFPAFLNDRLIKSLTDIGIELAISIHAQPYDVAEAVKKVNTAEAGVKMDMVKSQVSAAQKGISSNLAVSSVAQDTADEAEKWKTEINDNDQKMFSGVFLVMVKADSAEELADYTSRIKQAGRKHVIEFEETYYHQEEALNSMLPIGKTYIDVKRRFMRDMTTTNIATQIPFTNTDLQSQSPLANYYGQNQISNNIISLDRQRDLYTSSGVILGSSGSGKSVFVKINEVIPAILRFPNDRVIIVDPEEEYVDIGHAFGAQVIDIYPGTKTHFNLMDIPDLNKLRDEDKDFVGQKASLIMGLFENILQEVTDDDVSLIDRVTHLCYEQITDRTPTLKDWHDILLEQPEEEAQSLALKSESYTKGSQDIFAYETNVDLNNQVVIFNLKKLSGKLKPFAMMVIQDYIWQHVVDHKDEFVTRVYFDEMQNQFETDDQAAFFSKMYARIRKYGSIPTGITQNVETLLSRKEGRNLLYNSEFLVLLKQKKTTIPYLLKTINLTDALVRYIEKPKAIGTGLIIAGTTTVPFENPIPEDTELFRLVATDAYRKMES
>NZ_ANDK01000027.1|WP_017645960.1|110264_110408_+|hypothetical-protein
MKKQTKKATLPYRGSLLSQSILSEQQKSRKTSIFIFLTVIGETLCFL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

136944 : 145935

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000998735.1\|136944_137541_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.1e-15	29.4
WP_000575545.1\|137632_138889_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	7.8e-93	51.7
WP_000968655.1\|138893_139871_+	nucleoid-associated protein	NA	NA	NA	NA
WP_000472259.1\|139872_140475_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.1e-20	40.1
WP_000826946.1\|140486_142208_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-40	26.7
WP_000647638.1\|142208_143942_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.1e-50	31.0
WP_000746859.1\|143955_144153_+	hypothetical protein	NA	NA	NA	NA
WP_000222544.1\|144216_145935_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.4e-278	84.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_ANDK01000019

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_ANDK01000019.1|WP_000384271.1|65592_65919_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_ANDK01000019.1|WP_000384271.1|65592_65919_+|hypothetical-protein

65592_65919_+

108 aa aa

AcrIIA21

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3639\|WP_000384271.1\|AcrIIA21\|II-A\|Verified\|Streptococcus	1.0	1	1.0