CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_ASRD01000094	Pseudomonas aeruginosa str. C 1426 contig094, whole genome shotgun sequence	1 crisprs	NA	0	6	0	0
NZ_ASRD01000200	Pseudomonas aeruginosa str. C 1426 contig200, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000072	Pseudomonas aeruginosa str. C 1426 contig072, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_ASRD01000407	Pseudomonas aeruginosa str. C 1426 contig407, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000366	Pseudomonas aeruginosa str. C 1426 contig366, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000101	Pseudomonas aeruginosa str. C 1426 contig101, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000139	Pseudomonas aeruginosa str. C 1426 contig139, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000265	Pseudomonas aeruginosa str. C 1426 contig265, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000080	Pseudomonas aeruginosa str. C 1426 contig080, whole genome shotgun sequence	1 crisprs	NA	0	0	0	0
NZ_ASRD01000172	Pseudomonas aeruginosa str. C 1426 contig172, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000036	Pseudomonas aeruginosa str. C 1426 contig036, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000125	Pseudomonas aeruginosa str. C 1426 contig125, whole genome shotgun sequence	1 crisprs	NA	0	0	0	0
NZ_ASRD01000018	Pseudomonas aeruginosa str. C 1426 contig018, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000068	Pseudomonas aeruginosa str. C 1426 contig068, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000048	Pseudomonas aeruginosa str. C 1426 contig048, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000134	Pseudomonas aeruginosa str. C 1426 contig134, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000394	Pseudomonas aeruginosa str. C 1426 contig394, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000013	Pseudomonas aeruginosa str. C 1426 contig013, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000292	Pseudomonas aeruginosa str. C 1426 contig292, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000324	Pseudomonas aeruginosa str. C 1426 contig324, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000073	Pseudomonas aeruginosa str. C 1426 contig073, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000003	Pseudomonas aeruginosa str. C 1426 contig003, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000113	Pseudomonas aeruginosa str. C 1426 contig113, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000063	Pseudomonas aeruginosa str. C 1426 contig063, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000396	Pseudomonas aeruginosa str. C 1426 contig396, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000213	Pseudomonas aeruginosa str. C 1426 contig213, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000123	Pseudomonas aeruginosa str. C 1426 contig123, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000410	Pseudomonas aeruginosa str. C 1426 contig410, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000388	Pseudomonas aeruginosa str. C 1426 contig388, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000395	Pseudomonas aeruginosa str. C 1426 contig395, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000107	Pseudomonas aeruginosa str. C 1426 contig107, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000350	Pseudomonas aeruginosa str. C 1426 contig350, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000359	Pseudomonas aeruginosa str. C 1426 contig359, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000257	Pseudomonas aeruginosa str. C 1426 contig257, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000126	Pseudomonas aeruginosa str. C 1426 contig126, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000146	Pseudomonas aeruginosa str. C 1426 contig146, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000296	Pseudomonas aeruginosa str. C 1426 contig296, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000024	Pseudomonas aeruginosa str. C 1426 contig024, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_ASRD01000066	Pseudomonas aeruginosa str. C 1426 contig066, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_ASRD01000418	Pseudomonas aeruginosa str. C 1426 contig418, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000240	Pseudomonas aeruginosa str. C 1426 contig240, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000083	Pseudomonas aeruginosa str. C 1426 contig083, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_ASRD01000284	Pseudomonas aeruginosa str. C 1426 contig284, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000055	Pseudomonas aeruginosa str. C 1426 contig055, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000329	Pseudomonas aeruginosa str. C 1426 contig329, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000253	Pseudomonas aeruginosa str. C 1426 contig253, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000294	Pseudomonas aeruginosa str. C 1426 contig294, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000358	Pseudomonas aeruginosa str. C 1426 contig358, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000361	Pseudomonas aeruginosa str. C 1426 contig361, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000158	Pseudomonas aeruginosa str. C 1426 contig158, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000011	Pseudomonas aeruginosa str. C 1426 contig011, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000174	Pseudomonas aeruginosa str. C 1426 contig174, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000413	Pseudomonas aeruginosa str. C 1426 contig413, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000159	Pseudomonas aeruginosa str. C 1426 contig159, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000076	Pseudomonas aeruginosa str. C 1426 contig076, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000155	Pseudomonas aeruginosa str. C 1426 contig155, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000389	Pseudomonas aeruginosa str. C 1426 contig389, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000135	Pseudomonas aeruginosa str. C 1426 contig135, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000234	Pseudomonas aeruginosa str. C 1426 contig234, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000198	Pseudomonas aeruginosa str. C 1426 contig198, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000226	Pseudomonas aeruginosa str. C 1426 contig226, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000056	Pseudomonas aeruginosa str. C 1426 contig056, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000346	Pseudomonas aeruginosa str. C 1426 contig346, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000181	Pseudomonas aeruginosa str. C 1426 contig181, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000372	Pseudomonas aeruginosa str. C 1426 contig372, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000097	Pseudomonas aeruginosa str. C 1426 contig097, whole genome shotgun sequence	0 crisprs	cas3,DEDDh	0	0	0	0
NZ_ASRD01000417	Pseudomonas aeruginosa str. C 1426 contig417, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000319	Pseudomonas aeruginosa str. C 1426 contig319, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000385	Pseudomonas aeruginosa str. C 1426 contig385, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000037	Pseudomonas aeruginosa str. C 1426 contig037, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000316	Pseudomonas aeruginosa str. C 1426 contig316, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000377	Pseudomonas aeruginosa str. C 1426 contig377, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000295	Pseudomonas aeruginosa str. C 1426 contig295, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000029	Pseudomonas aeruginosa str. C 1426 contig029, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000054	Pseudomonas aeruginosa str. C 1426 contig054, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000173	Pseudomonas aeruginosa str. C 1426 contig173, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000022	Pseudomonas aeruginosa str. C 1426 contig022, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000332	Pseudomonas aeruginosa str. C 1426 contig332, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000364	Pseudomonas aeruginosa str. C 1426 contig364, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000027	Pseudomonas aeruginosa str. C 1426 contig027, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_ASRD01000379	Pseudomonas aeruginosa str. C 1426 contig379, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000176	Pseudomonas aeruginosa str. C 1426 contig176, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000178	Pseudomonas aeruginosa str. C 1426 contig178, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000343	Pseudomonas aeruginosa str. C 1426 contig343, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000315	Pseudomonas aeruginosa str. C 1426 contig315, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000010	Pseudomonas aeruginosa str. C 1426 contig010, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000102	Pseudomonas aeruginosa str. C 1426 contig102, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000042	Pseudomonas aeruginosa str. C 1426 contig042, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000045	Pseudomonas aeruginosa str. C 1426 contig045, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000355	Pseudomonas aeruginosa str. C 1426 contig355, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000419	Pseudomonas aeruginosa str. C 1426 contig419, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000099	Pseudomonas aeruginosa str. C 1426 contig099, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000170	Pseudomonas aeruginosa str. C 1426 contig170, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000321	Pseudomonas aeruginosa str. C 1426 contig321, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000374	Pseudomonas aeruginosa str. C 1426 contig374, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000262	Pseudomonas aeruginosa str. C 1426 contig262, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000229	Pseudomonas aeruginosa str. C 1426 contig229, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000232	Pseudomonas aeruginosa str. C 1426 contig232, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000052	Pseudomonas aeruginosa str. C 1426 contig052, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000137	Pseudomonas aeruginosa str. C 1426 contig137, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000007	Pseudomonas aeruginosa str. C 1426 contig007, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_ASRD01000218	Pseudomonas aeruginosa str. C 1426 contig218, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000300	Pseudomonas aeruginosa str. C 1426 contig300, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000077	Pseudomonas aeruginosa str. C 1426 contig077, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000224	Pseudomonas aeruginosa str. C 1426 contig224, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000252	Pseudomonas aeruginosa str. C 1426 contig252, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000209	Pseudomonas aeruginosa str. C 1426 contig209, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000086	Pseudomonas aeruginosa str. C 1426 contig086, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000392	Pseudomonas aeruginosa str. C 1426 contig392, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000411	Pseudomonas aeruginosa str. C 1426 contig411, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000297	Pseudomonas aeruginosa str. C 1426 contig297, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000095	Pseudomonas aeruginosa str. C 1426 contig095, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000408	Pseudomonas aeruginosa str. C 1426 contig408, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000238	Pseudomonas aeruginosa str. C 1426 contig238, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000375	Pseudomonas aeruginosa str. C 1426 contig375, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000196	Pseudomonas aeruginosa str. C 1426 contig196, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000193	Pseudomonas aeruginosa str. C 1426 contig193, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000270	Pseudomonas aeruginosa str. C 1426 contig270, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000308	Pseudomonas aeruginosa str. C 1426 contig308, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000351	Pseudomonas aeruginosa str. C 1426 contig351, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000298	Pseudomonas aeruginosa str. C 1426 contig298, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000121	Pseudomonas aeruginosa str. C 1426 contig121, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000122	Pseudomonas aeruginosa str. C 1426 contig122, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000335	Pseudomonas aeruginosa str. C 1426 contig335, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000078	Pseudomonas aeruginosa str. C 1426 contig078, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000285	Pseudomonas aeruginosa str. C 1426 contig285, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000217	Pseudomonas aeruginosa str. C 1426 contig217, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000279	Pseudomonas aeruginosa str. C 1426 contig279, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000049	Pseudomonas aeruginosa str. C 1426 contig049, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000210	Pseudomonas aeruginosa str. C 1426 contig210, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000354	Pseudomonas aeruginosa str. C 1426 contig354, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000104	Pseudomonas aeruginosa str. C 1426 contig104, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000152	Pseudomonas aeruginosa str. C 1426 contig152, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000301	Pseudomonas aeruginosa str. C 1426 contig301, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000140	Pseudomonas aeruginosa str. C 1426 contig140, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000103	Pseudomonas aeruginosa str. C 1426 contig103, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000344	Pseudomonas aeruginosa str. C 1426 contig344, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000212	Pseudomonas aeruginosa str. C 1426 contig212, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000383	Pseudomonas aeruginosa str. C 1426 contig383, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000305	Pseudomonas aeruginosa str. C 1426 contig305, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000183	Pseudomonas aeruginosa str. C 1426 contig183, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000263	Pseudomonas aeruginosa str. C 1426 contig263, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000248	Pseudomonas aeruginosa str. C 1426 contig248, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000334	Pseudomonas aeruginosa str. C 1426 contig334, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000215	Pseudomonas aeruginosa str. C 1426 contig215, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000406	Pseudomonas aeruginosa str. C 1426 contig406, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000303	Pseudomonas aeruginosa str. C 1426 contig303, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000019	Pseudomonas aeruginosa str. C 1426 contig019, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000136	Pseudomonas aeruginosa str. C 1426 contig136, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000235	Pseudomonas aeruginosa str. C 1426 contig235, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000220	Pseudomonas aeruginosa str. C 1426 contig220, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000096	Pseudomonas aeruginosa str. C 1426 contig096, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000371	Pseudomonas aeruginosa str. C 1426 contig371, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000287	Pseudomonas aeruginosa str. C 1426 contig287, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000360	Pseudomonas aeruginosa str. C 1426 contig360, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000409	Pseudomonas aeruginosa str. C 1426 contig409, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000278	Pseudomonas aeruginosa str. C 1426 contig278, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000002	Pseudomonas aeruginosa str. C 1426 contig002, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000216	Pseudomonas aeruginosa str. C 1426 contig216, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000368	Pseudomonas aeruginosa str. C 1426 contig368, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000384	Pseudomonas aeruginosa str. C 1426 contig384, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000065	Pseudomonas aeruginosa str. C 1426 contig065, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000271	Pseudomonas aeruginosa str. C 1426 contig271, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000098	Pseudomonas aeruginosa str. C 1426 contig098, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000390	Pseudomonas aeruginosa str. C 1426 contig390, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000169	Pseudomonas aeruginosa str. C 1426 contig169, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000231	Pseudomonas aeruginosa str. C 1426 contig231, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000017	Pseudomonas aeruginosa str. C 1426 contig017, whole genome shotgun sequence	1 crisprs	DEDDh	0	1	0	0
NZ_ASRD01000326	Pseudomonas aeruginosa str. C 1426 contig326, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000214	Pseudomonas aeruginosa str. C 1426 contig214, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000277	Pseudomonas aeruginosa str. C 1426 contig277, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000124	Pseudomonas aeruginosa str. C 1426 contig124, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000207	Pseudomonas aeruginosa str. C 1426 contig207, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000074	Pseudomonas aeruginosa str. C 1426 contig074, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000286	Pseudomonas aeruginosa str. C 1426 contig286, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000141	Pseudomonas aeruginosa str. C 1426 contig141, whole genome shotgun sequence	0 crisprs	RT	0	0	0	0
NZ_ASRD01000190	Pseudomonas aeruginosa str. C 1426 contig190, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000223	Pseudomonas aeruginosa str. C 1426 contig223, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000208	Pseudomonas aeruginosa str. C 1426 contig208, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000201	Pseudomonas aeruginosa str. C 1426 contig201, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000047	Pseudomonas aeruginosa str. C 1426 contig047, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000261	Pseudomonas aeruginosa str. C 1426 contig261, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000165	Pseudomonas aeruginosa str. C 1426 contig165, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000365	Pseudomonas aeruginosa str. C 1426 contig365, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000245	Pseudomonas aeruginosa str. C 1426 contig245, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000348	Pseudomonas aeruginosa str. C 1426 contig348, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000116	Pseudomonas aeruginosa str. C 1426 contig116, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_ASRD01000352	Pseudomonas aeruginosa str. C 1426 contig352, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000397	Pseudomonas aeruginosa str. C 1426 contig397, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000188	Pseudomonas aeruginosa str. C 1426 contig188, whole genome shotgun sequence	1 crisprs	cas1	3	24	0	0
NZ_ASRD01000250	Pseudomonas aeruginosa str. C 1426 contig250, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000032	Pseudomonas aeruginosa str. C 1426 contig032, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000304	Pseudomonas aeruginosa str. C 1426 contig304, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000222	Pseudomonas aeruginosa str. C 1426 contig222, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000092	Pseudomonas aeruginosa str. C 1426 contig092, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000059	Pseudomonas aeruginosa str. C 1426 contig059, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_ASRD01000067	Pseudomonas aeruginosa str. C 1426 contig067, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000290	Pseudomonas aeruginosa str. C 1426 contig290, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000156	Pseudomonas aeruginosa str. C 1426 contig156, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000185	Pseudomonas aeruginosa str. C 1426 contig185, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000194	Pseudomonas aeruginosa str. C 1426 contig194, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000117	Pseudomonas aeruginosa str. C 1426 contig117, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000021	Pseudomonas aeruginosa str. C 1426 contig021, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000227	Pseudomonas aeruginosa str. C 1426 contig227, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000404	Pseudomonas aeruginosa str. C 1426 contig404, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000312	Pseudomonas aeruginosa str. C 1426 contig312, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000184	Pseudomonas aeruginosa str. C 1426 contig184, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000089	Pseudomonas aeruginosa str. C 1426 contig089, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000211	Pseudomonas aeruginosa str. C 1426 contig211, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000161	Pseudomonas aeruginosa str. C 1426 contig161, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000114	Pseudomonas aeruginosa str. C 1426 contig114, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000356	Pseudomonas aeruginosa str. C 1426 contig356, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000093	Pseudomonas aeruginosa str. C 1426 contig093, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000399	Pseudomonas aeruginosa str. C 1426 contig399, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000401	Pseudomonas aeruginosa str. C 1426 contig401, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000400	Pseudomonas aeruginosa str. C 1426 contig400, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000393	Pseudomonas aeruginosa str. C 1426 contig393, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000323	Pseudomonas aeruginosa str. C 1426 contig323, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000291	Pseudomonas aeruginosa str. C 1426 contig291, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000046	Pseudomonas aeruginosa str. C 1426 contig046, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000040	Pseudomonas aeruginosa str. C 1426 contig040, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000288	Pseudomonas aeruginosa str. C 1426 contig288, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000151	Pseudomonas aeruginosa str. C 1426 contig151, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000230	Pseudomonas aeruginosa str. C 1426 contig230, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000251	Pseudomonas aeruginosa str. C 1426 contig251, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000062	Pseudomonas aeruginosa str. C 1426 contig062, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000087	Pseudomonas aeruginosa str. C 1426 contig087, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000363	Pseudomonas aeruginosa str. C 1426 contig363, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000378	Pseudomonas aeruginosa str. C 1426 contig378, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000171	Pseudomonas aeruginosa str. C 1426 contig171, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000336	Pseudomonas aeruginosa str. C 1426 contig336, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000016	Pseudomonas aeruginosa str. C 1426 contig016, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000061	Pseudomonas aeruginosa str. C 1426 contig061, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000202	Pseudomonas aeruginosa str. C 1426 contig202, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000163	Pseudomonas aeruginosa str. C 1426 contig163, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000313	Pseudomonas aeruginosa str. C 1426 contig313, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000131	Pseudomonas aeruginosa str. C 1426 contig131, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000382	Pseudomonas aeruginosa str. C 1426 contig382, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000225	Pseudomonas aeruginosa str. C 1426 contig225, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000100	Pseudomonas aeruginosa str. C 1426 contig100, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000420	Pseudomonas aeruginosa str. C 1426 contig420, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000154	Pseudomonas aeruginosa str. C 1426 contig154, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000191	Pseudomonas aeruginosa str. C 1426 contig191, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000143	Pseudomonas aeruginosa str. C 1426 contig143, whole genome shotgun sequence	0 crisprs	DinG	0	0	0	0
NZ_ASRD01000187	Pseudomonas aeruginosa str. C 1426 contig187, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000038	Pseudomonas aeruginosa str. C 1426 contig038, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000274	Pseudomonas aeruginosa str. C 1426 contig274, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000266	Pseudomonas aeruginosa str. C 1426 contig266, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000237	Pseudomonas aeruginosa str. C 1426 contig237, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000268	Pseudomonas aeruginosa str. C 1426 contig268, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000079	Pseudomonas aeruginosa str. C 1426 contig079, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000144	Pseudomonas aeruginosa str. C 1426 contig144, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_ASRD01000133	Pseudomonas aeruginosa str. C 1426 contig133, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000239	Pseudomonas aeruginosa str. C 1426 contig239, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000145	Pseudomonas aeruginosa str. C 1426 contig145, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000069	Pseudomonas aeruginosa str. C 1426 contig069, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000192	Pseudomonas aeruginosa str. C 1426 contig192, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000015	Pseudomonas aeruginosa str. C 1426 contig015, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000416	Pseudomonas aeruginosa str. C 1426 contig416, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000255	Pseudomonas aeruginosa str. C 1426 contig255, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000129	Pseudomonas aeruginosa str. C 1426 contig129, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000289	Pseudomonas aeruginosa str. C 1426 contig289, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000085	Pseudomonas aeruginosa str. C 1426 contig085, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000082	Pseudomonas aeruginosa str. C 1426 contig082, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000106	Pseudomonas aeruginosa str. C 1426 contig106, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000147	Pseudomonas aeruginosa str. C 1426 contig147, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000110	Pseudomonas aeruginosa str. C 1426 contig110, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000034	Pseudomonas aeruginosa str. C 1426 contig034, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000044	Pseudomonas aeruginosa str. C 1426 contig044, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000070	Pseudomonas aeruginosa str. C 1426 contig070, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000060	Pseudomonas aeruginosa str. C 1426 contig060, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000246	Pseudomonas aeruginosa str. C 1426 contig246, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000325	Pseudomonas aeruginosa str. C 1426 contig325, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000280	Pseudomonas aeruginosa str. C 1426 contig280, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000264	Pseudomonas aeruginosa str. C 1426 contig264, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000387	Pseudomonas aeruginosa str. C 1426 contig387, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000256	Pseudomonas aeruginosa str. C 1426 contig256, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000031	Pseudomonas aeruginosa str. C 1426 contig031, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_ASRD01000341	Pseudomonas aeruginosa str. C 1426 contig341, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000112	Pseudomonas aeruginosa str. C 1426 contig112, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000091	Pseudomonas aeruginosa str. C 1426 contig091, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000320	Pseudomonas aeruginosa str. C 1426 contig320, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000333	Pseudomonas aeruginosa str. C 1426 contig333, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000182	Pseudomonas aeruginosa str. C 1426 contig182, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000380	Pseudomonas aeruginosa str. C 1426 contig380, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000179	Pseudomonas aeruginosa str. C 1426 contig179, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000132	Pseudomonas aeruginosa str. C 1426 contig132, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000084	Pseudomonas aeruginosa str. C 1426 contig084, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_ASRD01000233	Pseudomonas aeruginosa str. C 1426 contig233, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000369	Pseudomonas aeruginosa str. C 1426 contig369, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000081	Pseudomonas aeruginosa str. C 1426 contig081, whole genome shotgun sequence	1 crisprs	NA	0	0	0	0
NZ_ASRD01000349	Pseudomonas aeruginosa str. C 1426 contig349, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000111	Pseudomonas aeruginosa str. C 1426 contig111, whole genome shotgun sequence	1 crisprs	NA	0	0	0	0
NZ_ASRD01000199	Pseudomonas aeruginosa str. C 1426 contig199, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000267	Pseudomonas aeruginosa str. C 1426 contig267, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000026	Pseudomonas aeruginosa str. C 1426 contig026, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000090	Pseudomonas aeruginosa str. C 1426 contig090, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000162	Pseudomonas aeruginosa str. C 1426 contig162, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000244	Pseudomonas aeruginosa str. C 1426 contig244, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000221	Pseudomonas aeruginosa str. C 1426 contig221, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000108	Pseudomonas aeruginosa str. C 1426 contig108, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000148	Pseudomonas aeruginosa str. C 1426 contig148, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000302	Pseudomonas aeruginosa str. C 1426 contig302, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000281	Pseudomonas aeruginosa str. C 1426 contig281, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000367	Pseudomonas aeruginosa str. C 1426 contig367, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000014	Pseudomonas aeruginosa str. C 1426 contig014, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000205	Pseudomonas aeruginosa str. C 1426 contig205, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000039	Pseudomonas aeruginosa str. C 1426 contig039, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000075	Pseudomonas aeruginosa str. C 1426 contig075, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000028	Pseudomonas aeruginosa str. C 1426 contig028, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000128	Pseudomonas aeruginosa str. C 1426 contig128, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000115	Pseudomonas aeruginosa str. C 1426 contig115, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000328	Pseudomonas aeruginosa str. C 1426 contig328, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000149	Pseudomonas aeruginosa str. C 1426 contig149, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000175	Pseudomonas aeruginosa str. C 1426 contig175, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000058	Pseudomonas aeruginosa str. C 1426 contig058, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000340	Pseudomonas aeruginosa str. C 1426 contig340, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000309	Pseudomonas aeruginosa str. C 1426 contig309, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000127	Pseudomonas aeruginosa str. C 1426 contig127, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000386	Pseudomonas aeruginosa str. C 1426 contig386, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000398	Pseudomonas aeruginosa str. C 1426 contig398, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000119	Pseudomonas aeruginosa str. C 1426 contig119, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000241	Pseudomonas aeruginosa str. C 1426 contig241, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000043	Pseudomonas aeruginosa str. C 1426 contig043, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000322	Pseudomonas aeruginosa str. C 1426 contig322, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000273	Pseudomonas aeruginosa str. C 1426 contig273, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000249	Pseudomonas aeruginosa str. C 1426 contig249, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000168	Pseudomonas aeruginosa str. C 1426 contig168, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000345	Pseudomonas aeruginosa str. C 1426 contig345, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000177	Pseudomonas aeruginosa str. C 1426 contig177, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000204	Pseudomonas aeruginosa str. C 1426 contig204, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000357	Pseudomonas aeruginosa str. C 1426 contig357, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000008	Pseudomonas aeruginosa str. C 1426 contig008, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000041	Pseudomonas aeruginosa str. C 1426 contig041, whole genome shotgun sequence	0 crisprs	NA	0	0	2	3
NZ_ASRD01000138	Pseudomonas aeruginosa str. C 1426 contig138, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000259	Pseudomonas aeruginosa str. C 1426 contig259, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000228	Pseudomonas aeruginosa str. C 1426 contig228, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000405	Pseudomonas aeruginosa str. C 1426 contig405, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000412	Pseudomonas aeruginosa str. C 1426 contig412, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000160	Pseudomonas aeruginosa str. C 1426 contig160, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000403	Pseudomonas aeruginosa str. C 1426 contig403, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000030	Pseudomonas aeruginosa str. C 1426 contig030, whole genome shotgun sequence	0 crisprs	DinG	0	0	0	0
NZ_ASRD01000331	Pseudomonas aeruginosa str. C 1426 contig331, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000203	Pseudomonas aeruginosa str. C 1426 contig203, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000180	Pseudomonas aeruginosa str. C 1426 contig180, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000402	Pseudomonas aeruginosa str. C 1426 contig402, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000247	Pseudomonas aeruginosa str. C 1426 contig247, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000197	Pseudomonas aeruginosa str. C 1426 contig197, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000071	Pseudomonas aeruginosa str. C 1426 contig071, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000150	Pseudomonas aeruginosa str. C 1426 contig150, whole genome shotgun sequence	0 crisprs	cas3	0	0	0	0
NZ_ASRD01000118	Pseudomonas aeruginosa str. C 1426 contig118, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_ASRD01000330	Pseudomonas aeruginosa str. C 1426 contig330, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000415	Pseudomonas aeruginosa str. C 1426 contig415, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000105	Pseudomonas aeruginosa str. C 1426 contig105, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000376	Pseudomonas aeruginosa str. C 1426 contig376, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000130	Pseudomonas aeruginosa str. C 1426 contig130, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000269	Pseudomonas aeruginosa str. C 1426 contig269, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000339	Pseudomonas aeruginosa str. C 1426 contig339, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000314	Pseudomonas aeruginosa str. C 1426 contig314, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000167	Pseudomonas aeruginosa str. C 1426 contig167, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000258	Pseudomonas aeruginosa str. C 1426 contig258, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000243	Pseudomonas aeruginosa str. C 1426 contig243, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000347	Pseudomonas aeruginosa str. C 1426 contig347, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000088	Pseudomonas aeruginosa str. C 1426 contig088, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000353	Pseudomonas aeruginosa str. C 1426 contig353, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000206	Pseudomonas aeruginosa str. C 1426 contig206, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000381	Pseudomonas aeruginosa str. C 1426 contig381, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000414	Pseudomonas aeruginosa str. C 1426 contig414, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000020	Pseudomonas aeruginosa str. C 1426 contig020, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000318	Pseudomonas aeruginosa str. C 1426 contig318, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000391	Pseudomonas aeruginosa str. C 1426 contig391, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000064	Pseudomonas aeruginosa str. C 1426 contig064, whole genome shotgun sequence	0 crisprs	NA	0	0	0	2
NZ_ASRD01000053	Pseudomonas aeruginosa str. C 1426 contig053, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000120	Pseudomonas aeruginosa str. C 1426 contig120, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000242	Pseudomonas aeruginosa str. C 1426 contig242, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000299	Pseudomonas aeruginosa str. C 1426 contig299, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000153	Pseudomonas aeruginosa str. C 1426 contig153, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000109	Pseudomonas aeruginosa str. C 1426 contig109, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000275	Pseudomonas aeruginosa str. C 1426 contig275, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000142	Pseudomonas aeruginosa str. C 1426 contig142, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000317	Pseudomonas aeruginosa str. C 1426 contig317, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000023	Pseudomonas aeruginosa str. C 1426 contig023, whole genome shotgun sequence	0 crisprs	WYL	0	0	0	0
NZ_ASRD01000186	Pseudomonas aeruginosa str. C 1426 contig186, whole genome shotgun sequence	1 crisprs	NA	0	0	0	0
NZ_ASRD01000189	Pseudomonas aeruginosa str. C 1426 contig189, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000338	Pseudomonas aeruginosa str. C 1426 contig338, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000307	Pseudomonas aeruginosa str. C 1426 contig307, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000219	Pseudomonas aeruginosa str. C 1426 contig219, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000254	Pseudomonas aeruginosa str. C 1426 contig254, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000373	Pseudomonas aeruginosa str. C 1426 contig373, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000342	Pseudomonas aeruginosa str. C 1426 contig342, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000283	Pseudomonas aeruginosa str. C 1426 contig283, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000164	Pseudomonas aeruginosa str. C 1426 contig164, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000057	Pseudomonas aeruginosa str. C 1426 contig057, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000272	Pseudomonas aeruginosa str. C 1426 contig272, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000166	Pseudomonas aeruginosa str. C 1426 contig166, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000035	Pseudomonas aeruginosa str. C 1426 contig035, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000006	Pseudomonas aeruginosa str. C 1426 contig006, whole genome shotgun sequence	0 crisprs	cas3	0	0	0	0
NZ_ASRD01000310	Pseudomonas aeruginosa str. C 1426 contig310, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000306	Pseudomonas aeruginosa str. C 1426 contig306, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000012	Pseudomonas aeruginosa str. C 1426 contig012, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000005	Pseudomonas aeruginosa str. C 1426 contig005, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000421	Pseudomonas aeruginosa str. C 1426 contig421, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000282	Pseudomonas aeruginosa str. C 1426 contig282, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000009	Pseudomonas aeruginosa str. C 1426 contig009, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000051	Pseudomonas aeruginosa str. C 1426 contig051, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000260	Pseudomonas aeruginosa str. C 1426 contig260, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000001	Pseudomonas aeruginosa str. C 1426 contig001, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000025	Pseudomonas aeruginosa str. C 1426 contig025, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000370	Pseudomonas aeruginosa str. C 1426 contig370, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000327	Pseudomonas aeruginosa str. C 1426 contig327, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000236	Pseudomonas aeruginosa str. C 1426 contig236, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000276	Pseudomonas aeruginosa str. C 1426 contig276, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000033	Pseudomonas aeruginosa str. C 1426 contig033, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000293	Pseudomonas aeruginosa str. C 1426 contig293, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000157	Pseudomonas aeruginosa str. C 1426 contig157, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000362	Pseudomonas aeruginosa str. C 1426 contig362, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000337	Pseudomonas aeruginosa str. C 1426 contig337, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000311	Pseudomonas aeruginosa str. C 1426 contig311, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000050	Pseudomonas aeruginosa str. C 1426 contig050, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000004	Pseudomonas aeruginosa str. C 1426 contig004, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_ASRD01000195	Pseudomonas aeruginosa str. C 1426 contig195, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000094_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000094_1

37490-37877

Orphan

I-F

Consensus_repeat	Method
GTTCACTGCCGTATAGGCAGCTAAGAAA	PILER-CR
GTTCACTGCCGTATAGGCAGCTAAGAAA	CRISPRCasFinder
GTTCACTGCCGTATAGGCAGCTAAGAAA	CRT

6 spacers

The CRISPR arrays of NZ_ASRD01000094_1

>merge|NZ_ASRD01000094|1|37490-37877|PILER-CR,CRISPRCasFinder,CRT
GTTCACTGCCGTATAGGCAGCTAAGAAAGCTGGCCGAGACCGACAAGTCGAAGCGCACGGGTTCACTGCCGTATAGGCAGCTAAGAAATGTTCGTAGCCGATATCGCTGCACGCGATGCAGTTCACTGCCGTATAGGCAGCTAAGAAAGAGGGGCCGTATCGACGGTGATTGATGCGACAGTTCACTGCCGTATAGGCAGCTAAGAAAAGCAAGGCATCCGGAAACGGGCCTTGGGTCACGTTCACTGCCGTATAGGCAGCTAAGAAAAAGGAGCACCACGACATGGTCAGAGCAAACCCGTTCACTGCCGTATAGGCAGCTAAGAAATCCTAGTTCTTCGCCAAGCCGGAAACCGAGGCGTTCACTGCCGTATAGGCAGCTAAGAAA

>NZ_ASRD01000094|1|1|37490-37877|PILER-CR
GTTCACTGCCGTATAGGCAGCTAAGAAA	GCTGGCCGAGACCGACAAGTCGAAGCGCACGG
GTTCACTGCCGTATAGGCAGCTAAGAAA	TGTTCGTAGCCGATATCGCTGCACGCGATGCA
GTTCACTGCCGTATAGGCAGCTAAGAAA	GAGGGGCCGTATCGACGGTGATTGATGCGACA
GTTCACTGCCGTATAGGCAGCTAAGAAA	AGCAAGGCATCCGGAAACGGGCCTTGGGTCAC
GTTCACTGCCGTATAGGCAGCTAAGAAA	AAGGAGCACCACGACATGGTCAGAGCAAACCC
GTTCACTGCCGTATAGGCAGCTAAGAAA	TCCTAGTTCTTCGCCAAGCCGGAAACCGAGGC
GTTCACTGCCGTATAGGCAGCTAAGAAA

>NZ_ASRD01000094|1|1|37490-37877|CRISPRCasFinder
GTTCACTGCCGTATAGGCAGCTAAGAAA	GCTGGCCGAGACCGACAAGTCGAAGCGCACGG
GTTCACTGCCGTATAGGCAGCTAAGAAA	TGTTCGTAGCCGATATCGCTGCACGCGATGCA
GTTCACTGCCGTATAGGCAGCTAAGAAA	GAGGGGCCGTATCGACGGTGATTGATGCGACA
GTTCACTGCCGTATAGGCAGCTAAGAAA	AGCAAGGCATCCGGAAACGGGCCTTGGGTCAC
GTTCACTGCCGTATAGGCAGCTAAGAAA	AAGGAGCACCACGACATGGTCAGAGCAAACCC
GTTCACTGCCGTATAGGCAGCTAAGAAA	TCCTAGTTCTTCGCCAAGCCGGAAACCGAGGC
GTTCACTGCCGTATAGGCAGCTAAGAAA

>NZ_ASRD01000094|1|1|37490-37877|CRT
GTTCACTGCCGTATAGGCAGCTAAGAAA	GCTGGCCGAGACCGACAAGTCGAAGCGCACGG
GTTCACTGCCGTATAGGCAGCTAAGAAA	TGTTCGTAGCCGATATCGCTGCACGCGATGCA
GTTCACTGCCGTATAGGCAGCTAAGAAA	GAGGGGCCGTATCGACGGTGATTGATGCGACA
GTTCACTGCCGTATAGGCAGCTAAGAAA	AGCAAGGCATCCGGAAACGGGCCTTGGGTCAC
GTTCACTGCCGTATAGGCAGCTAAGAAA	AAGGAGCACCACGACATGGTCAGAGCAAACCC
GTTCACTGCCGTATAGGCAGCTAAGAAA	TCCTAGTTCTTCGCCAAGCCGGAAACCGAGGC
GTTCACTGCCGTATAGGCAGCTAAGAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000094.1\|WP_003116902.1\|16978_17983_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_ASRD01000094.1\|WP_003116901.1\|16772_16982_+\|DUF1656-domain-containing-protein	unknown	unknown	gnl\|CDD\|377931
NZ_ASRD01000094.1\|WP_038820021.1\|22055_35084_+\|pyoverdine-non-ribosomal-peptide-synthase/polyketide-synthase-PvdL	unknown	unknown	gnl\|CDD\|235564
NZ_ASRD01000094.1\|WP_003089666.1\|18526_19441_+\|polyphosphate-kinase-2	unknown	unknown	gnl\|CDD\|213852
NZ_ASRD01000094.1\|WP_003102987.1\|35216_36014_-\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000094.1\|WP_003102990.1\|36582_37095_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226144
NZ_ASRD01000094.1\|WP_003102981.1\|21218_21983_+\|thioesterase	unknown	unknown	gnl\|CDD\|225749
NZ_ASRD01000094.1\|WP_003113070.1\|18019_18265_-\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000094.1\|WP_016253400.1\|19527_19995_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000094.1\|WP_003113068.1\|20011_20575_-\|RNA-polymerase-factor-sigma-70	unknown	unknown	gnl\|CDD\|180803

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000094.1\|WP_003116902.1\|16978_17983_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	8.35683e-93
NZ_ASRD01000094.1\|WP_038820021.1\|22055_35084_+\|pyoverdine-non-ribosomal-peptide-synthase/polyketide-synthase-PvdL	gnl\|CDD\|235564	PRK05691, PRK05691, peptide synthase; Validated.	0
NZ_ASRD01000094.1\|WP_003089666.1\|18526_19441_+\|polyphosphate-kinase-2	gnl\|CDD\|213852	TIGR03707, PPK2_P_aer, polyphosphate kinase 2, PA0141 family. Members of this protein family are designated polyphosphate kinase 2 (PPK2) after the characterized protein in Pseudomonas aeruginosa. This family comprises one of three well-separated clades in the larger family described by pfam03976. PA0141 from this family has been shown capable of operating in reverse, with GDP preferred (over ADP) as a substrate, producing GTP (or ATP) by transfer of a phosphate residue from polyphosphate. Most species with a member of this family also encode a polyphosphate kinase 1 (PPK1). [Central intermediary metabolism, Phosphorus compounds].	4.10802e-156
NZ_ASRD01000094.1\|WP_003102990.1\|36582_37095_-\|hypothetical-protein	gnl\|CDD\|226144	COG3617, COG3617, Prophage antirepressor [Transcription].	1.38491e-51
NZ_ASRD01000094.1\|WP_003102981.1\|21218_21983_+\|thioesterase	gnl\|CDD\|225749	COG3208, GrsT, Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	4.79789e-95
NZ_ASRD01000094.1\|WP_003116901.1\|16772_16982_+\|DUF1656-domain-containing-protein	gnl\|CDD\|377931	pfam07869, DUF1656, Protein of unknown function (DUF1656). This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.	6.04891e-08
NZ_ASRD01000094.1\|WP_003113068.1\|20011_20575_-\|RNA-polymerase-factor-sigma-70	gnl\|CDD\|180803	PRK07037, PRK07037, extracytoplasmic-function sigma-70 factor; Validated.	1.61354e-104

>NZ_ASRD01000094.1|WP_003102990.1|36582_37095_-|hypothetical-protein
MHGHTQLAPHYFFRQQRLLRALLIDDQAWFVLDDFARLIEHSQPEQMLARLDDDQARRESLRSERGEDQAQWLISESGAYAALIYQQRGDGSELRRWLSGEVVPELRSATDDSGMPRYVKLRWERQVVHMLDWQGKLWVNFSEMPDLLERQGEPMVQLGWRRWLRKLRPL
>NZ_ASRD01000094.1|WP_003102987.1|35216_36014_-|hypothetical-protein
MTARIYREVVNPGKLDETQRGNLASELYAIHARIFHGVQYESFAREVIHSTARLTRIAIYRNRQHEIVGYCAVHFHDSEVFQYSKACVIRAESGILPEYRGSNQSIPFLTRQVLRYKLLNPGKRLLFLDTLIHPSSYALVTKYVDDVWPCHCDLESHHVKFLEHLIAQFSFKRSSNDPLVVDTGWTTTEADHERARWATHSNPNVRFFLDRNPEYHKGNGLITVFPITLKNIFTATRRFKRSSSVKRKQHQRYNAASAKVGNIAL
>NZ_ASRD01000094.1|WP_038820021.1|22055_35084_+|pyoverdine-non-ribosomal-peptide-synthase/polyketide-synthase-PvdL
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAHAQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLVLTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTALPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALQRLDLSGWRVAFSGSEPIRQDSLERFAEKFAASRFDASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRIAEGEGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNLEASAKTFVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGRVAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGALPKTSSGKLQRSACRLRLEDGSLDSYALFPGLQALQEAQPPAGDDELLARIGEIWKARLGVAQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGLPAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQRLVERHEALRTRFLERDGAALQRIDERGEFAWQFVDLAALAEHERAAAAAQRREAEAQQPFDLEKGPLLRVSLVRLGEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAPLELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDTAPVLELATDHPRTARQASPAARYSLRVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLVGFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFNHQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIRRFAAQYLELLRQVAEDPQRCLGDIALVDAEQAAHLAEWGSAPCEPARAWLPELLERQLAQSAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVKAGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPSQAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPVSFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPGVAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERSPIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSADGERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREGVAGSQLVGYYTGAVGAEAEAEQNQRLRAALQAELPEYMVPAQLMRLAQMPLGPSGKLDTRALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTRQACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWFLWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGDGGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTLHHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLDYWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMTATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQVRQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIANDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIAELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDARSNRLARVLRSHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIEDSGVRLLLSHAALFEALGELPAGVARWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTSGSTGKPKGVAVSHGEIAMHCAAVIERFGMRAEDCELHFYSINFDAASERLLAPLLCGARVVLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTGEHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDADLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNGQVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAEQDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQAYEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDLFQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLARREHWNQSLLLQPRQALDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELFAKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLAVDGVSWRVLLEDLQQVYRQLDEGAEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQSAEWPCDRPQGDNREALAESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREALFDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVRQAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGELVLRWTYSRERYDAQTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDALAVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVARHEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLLEQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYGALGEGRPANLPTPPRYRDYIAWLQHQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLDAADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVGLFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAPTVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFEAQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMIVGSFKAGAGYLPLDPGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCVDRPRLLVWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLELDENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAIAHDPQGLLAHVGEQGITVLESVPSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAFFRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGDPLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEARLHERADVREAAVAVQEGANGKYLVGYLVPGETPRSSADSPAGLMVEQGAWFERIKQQLRADLPDYMVPLHWLVLDRMPLNANGKLDRKALPAPDIGQMQNQAYQAPRNELEETLARIWAEVLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLAPSEISEQKAERLNDLMSKLEML
>NZ_ASRD01000094.1|WP_003102981.1|21218_21983_+|thioesterase
MSPAVSLQLFCLPYSGASATLFRRWQPSLPGWIRLLPLELPGRGLRFGEALHTDAASLVAQLAGELHGTLDSASPYAFFGHSLGGLLAFELAHAMRRRGLEGPLALFLSGVSPPAENDVSGYRRAKADAELVAALRDYRGTPEAVLNDPSLMQMLLPVVRADFLVTGSYRYQAHGPLEAALHLFGGREDSLRSAELLGWLHEAGGDFTLDLLDGQHFFIREQQGQLLRLLRRYAGQHLLRWHKDKVRGSMRAAS
>NZ_ASRD01000094.1|WP_003113068.1|20011_20575_-|RNA-polymerase-factor-sigma-70
MSEQLSTRRCDTPLLQAFVDNRTILVKIAARITGCRSRAEDVVQDAFFRLQSAPQITSSFKAQLSYLFQIVRNLAIDHYRKQALEQKYSGPEEEGLNVVIQGASPETSHINYATLEHIADALTELPKRTRYAFEMYRLHGVPQKDIAKELGVSPTLVNFMIRDALVHCRKVTAERQGDNVTHLSARR
>NZ_ASRD01000094.1|WP_016253400.1|19527_19995_+|hypothetical-protein
MLPSPASSLSFPSPLERREADPYARCDRQRPACNESHEPAQERPEPVATCAFIEEERRRGDPTGLLYALGPRERGEPERVAEWLAALVHHFYLDGPVEPPRPTLGKARCETAPGLCRCCGQPFDFRHKRAALLLLGTHFAARAEAQAASVRRYRR
>NZ_ASRD01000094.1|WP_003089666.1|18526_19441_+|polyphosphate-kinase-2
MDSYGDTSGRIGRDWLDRHDEELEQELLDDELNLDELFGPEQEDAPGELSRRRYFRELFRLQRELVKLQNWVVHTGHKVVILFEGRDAAGKGGVIKRITQRLNPRVCRVAALPAPNDREQTQWYFQRYVSHLPAGGEIVLFDRSWYNRAGVERVMGFCNDEQYEEFFRSVPEFEKMLARSGIQLLKYWFSISDAEQHLRFLSRIHDPLKQWKLSPMDLESRRRWEAYTKAKETMLERTHIPEAPWWVVQADDKKRARLNCIHHLLQQMPYREVPQPPVHLPERLRHADYVRHPTPGEIIVPEVY
>NZ_ASRD01000094.1|WP_003113070.1|18019_18265_-|hypothetical-protein
MQAFSKQQLIDALNAQSSDLATLQSLVMGLYLWIRDSHGQASVDAAFQRAREEARQFRQQSGNQADERLILHLAEIVREQP
>NZ_ASRD01000094.1|WP_003116902.1|16978_17983_+|HlyD-family-secretion-protein
MNLLQGKWPRLATLLAVLVAAALVFLAWERYTRTPWTRDARVRADVVTLSADVSGLITRLPLSDNQPVEKGELLLSIDPARYELAVLRAERAVNVARAALGESRAAIEASQAQLRQRRSEAQRRSALQKRSMLSVEENEKAQTDVSLAQAELLRNQASLGLAQANVELAEAALQQARLDLERTQVRAPVSGYVTNLQTREGDYAHAGVPLLALVDRDSFYVSGYFEETKLPGIRVGSRARVELMSGERFDGRVQSIAHAITDRENAEGSRLLANINPSYTWVKLAQRIPVRIAIDPAYRQRNTLRAGVTATIRVLPAEDTAKVDSAAPGTALRP
>NZ_ASRD01000094.1|WP_003116901.1|16772_16982_+|DUF1656-domain-containing-protein
MPADVEVGGAYLPPIAQALLLAWLILLLLNPLLRRFGVLQRVWHEALFQGALYCAICAGLILWMGEMSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510971	Pseudomonas phage CF79, partial genome	37232-37263	0	1.0
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	KM389225	UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence	17170-17201	0	1.0
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510970	Pseudomonas phage CF67, partial genome	15734-15765	0	1.0
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510992	Pseudomonas phage BR144, partial genome	656-687	0	1.0
NZ_ASRD01000094_1	1.4\|37698\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37698-37729	32	MK511012	Pseudomonas phage BR153, partial genome	11530-11561	0	1.0
NZ_ASRD01000094_1	1.5\|37758\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37758-37789	32	NC_023575	Pseudomonas phage vB_PaeP_Tr60_Ab31	25549-25580	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	AY394005	Bacteriophage D3112, complete genome	35850-35881	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	35701-35732	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511036	Pseudomonas phage BR327, partial genome	35359-35390	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511031	Pseudomonas phage BR52, partial genome	29026-29057	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511034	Pseudomonas phage BR243, partial genome	35666-35697	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511033	Pseudomonas phage BR205, partial genome	35731-35762	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511017	Pseudomonas phage CF23, partial genome	35682-35713	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK144667	Pseudomonas phage Spike, complete genome	35728-35759	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511018	Pseudomonas phage CF28, partial genome	35391-35422	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511026	Pseudomonas phage CF121, partial genome	35634-35665	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	35364-35395	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NC_005178	Pseudomonas phage D3112, complete genome	35850-35881	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511022	Pseudomonas phage CF74, partial genome	38295-38326	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	DQ631426	Pseudomonas phage DMS3, complete genome	34625-34656	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511030	Pseudomonas phage CF213, partial genome	35632-35663	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511025	Pseudomonas phage CF118, partial genome	35661-35692	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511023	Pseudomonas phage CF77, partial genome	35632-35663	0	1.0
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK511029	Pseudomonas phage CF183, partial genome	36416-36447	0	1.0
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	NC_030931	Pseudomonas phage phi2, complete genome	37022-37053	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510993	Pseudomonas phage BR201, partial genome	37943-37974	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510984	Pseudomonas phage BR200, partial genome	3124-3155	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510971	Pseudomonas phage CF79, partial genome	40048-40079	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510970	Pseudomonas phage CF67, partial genome	18550-18581	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	KJ959591	Pseudomonas phage PAN70, partial genome	18505-18536	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	KY707339	Pseudomonas phage JBD68, complete genome	18403-18434	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510990	Pseudomonas phage BR133, partial genome	21832-21863	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510968	Pseudomonas phage CF55, partial genome	19899-19930	1	0.969
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	MK510969	Pseudomonas phage CF60, partial genome	4720-4751	1	0.969
NZ_ASRD01000094_1	1.5\|37758\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37758-37789	32	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	5446-5477	1	0.969
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MH719194	Pseudomonas phage Ps60, complete genome	37811-37842	1	0.969
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MH719192	Pseudomonas phage Ps56, complete genome	37951-37982	1	0.969
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	KU199708	Pseudomonas phage JBD69, complete genome	35074-35105	1	0.969
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510962	Pseudomonas phage CF3, partial genome	8064-8095	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510987	Pseudomonas phage BR233, partial genome	15677-15708	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510984	Pseudomonas phage BR200, partial genome	308-339	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510965	Pseudomonas phage CF34, partial genome	29704-29735	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510974	Pseudomonas phage CF140, partial genome	15647-15678	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	NC_007805	Pseudomonas phage F10, complete genome	15744-15775	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510978	Pseudomonas phage CF208, partial genome	15787-15818	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510988	Pseudomonas phage BR299, partial genome	15733-15764	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510976	Pseudomonas phage CF165, partial genome	36387-36418	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	KM389229	UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence	24665-24696	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	KJ959591	Pseudomonas phage PAN70, partial genome	15691-15722	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510990	Pseudomonas phage BR133, partial genome	19016-19047	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510975	Pseudomonas phage CF145, partial genome	15963-15994	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510969	Pseudomonas phage CF60, partial genome	1904-1935	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MK510986	Pseudomonas phage BR213, partial genome	15672-15703	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	DQ163912	Bacteriophage F10, complete genome	15744-15775	2	0.938
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	KM389225	UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence	14354-14385	2	0.938
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	JQ067085	Pseudomonas phage PaMx73, complete genome	34705-34736	2	0.938
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NC_030918	Pseudomonas phage JBD93, complete genome	34754-34785	2	0.938
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	JX434032	Pseudomonas phage JBD30, complete genome	35081-35112	2	0.938
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	MG707188	Pseudomonas phage TC7, partial genome	2295-2326	3	0.906
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	NC_008697	Nocardioides sp. JS614 plasmid pNOCA01, complete sequence	82072-82103	8	0.75
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	644014-644045	8	0.75
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	639916-639947	8	0.75
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	660499-660530	8	0.75
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	654338-654369	8	0.75
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	639916-639947	8	0.75
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	NZ_CP046256	Sphingobium sp. CAP-1 plasmid p3, complete sequence	202820-202851	9	0.719
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	NZ_CP022748	Sphingobium hydrophobicum strain C1 plasmid p2, complete sequence	33566-33597	9	0.719
NZ_ASRD01000094_1	1.2\|37578\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37578-37609	32	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	85015-85046	9	0.719
NZ_ASRD01000094_1	1.3\|37638\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37638-37669	32	NC_031059	Rhodovulum phage vB_RhkS_P1, complete genome	26274-26305	9	0.719
NZ_ASRD01000094_1	1.4\|37698\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37698-37729	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	72184-72215	9	0.719
NZ_ASRD01000094_1	1.4\|37698\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37698-37729	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1205187-1205218	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_KY362367	Pseudomonas coronafaciens pv. garcae strain 2708 plasmid pPg2708, complete sequence	16612-16643	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP026559	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence	44578-44609	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_LT963404	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP2, complete sequence	39923-39954	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	592410-592441	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	CP050261	Pseudomonas coronafaciens strain X-1 plasmid unnamed1	61609-61640	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP042805	Pseudomonas amygdali pv. tabaci str. ATCC 11528 plasmid pTab1, complete sequence	49464-49495	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_LT985190	Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence	42977-43008	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	CP046442	Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence	75632-75663	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_LT963413	Pseudomonas syringae isolate CFBP3840 plasmid PP4, complete sequence	44363-44394	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NC_005919	Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326B, complete sequence	11656-11687	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP047263	Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326B, complete sequence	11656-11687	9	0.719
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	NZ_CP026566	Pseudomonas avellanae strain R2leaf plasmid p4_tig8, complete sequence	13695-13726	9	0.719
NZ_ASRD01000094_1	1.1\|37518\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37518-37549	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	524033-524064	10	0.688
NZ_ASRD01000094_1	1.4\|37698\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37698-37729	32	NZ_CP014581	Burkholderia sp. OLGA172 plasmid pOLGA2, complete sequence	136423-136454	10	0.688
NZ_ASRD01000094_1	1.5\|37758\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37758-37789	32	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	118337-118368	10	0.688
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MF472892	Mycobacterium phage TreyKay, complete genome	13871-13902	10	0.688
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	KX641264	Mycobacterium phage LindNT, complete genome	13871-13902	10	0.688
NZ_ASRD01000094_1	1.6\|37818\|32\|NZ_ASRD01000094\|PILER-CR,CRISPRCasFinder,CRT	37818-37849	32	MK016503	Mycobacterium phage Prithvi, complete genome	13871-13902	10	0.688

1. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510971 (Pseudomonas phage CF79, partial genome) position: , mismatch: 0, identity: 1.0

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggccgagaccgacaagtcgaagcgcacgg	Protospacer
********************************

2. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KM389225 (UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggccgagaccgacaagtcgaagcgcacgg	Protospacer
********************************

3. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510970 (Pseudomonas phage CF67, partial genome) position: , mismatch: 0, identity: 1.0

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggccgagaccgacaagtcgaagcgcacgg	Protospacer
********************************

4. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510992 (Pseudomonas phage BR144, partial genome) position: , mismatch: 0, identity: 1.0

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggccgagaccgacaagtcgaagcgcacgg	Protospacer
********************************

5. spacer 1.4|37698|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511012 (Pseudomonas phage BR153, partial genome) position: , mismatch: 0, identity: 1.0

agcaaggcatccggaaacgggccttgggtcac	CRISPR spacer
agcaaggcatccggaaacgggccttgggtcac	Protospacer
********************************

6. spacer 1.5|37758|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_023575 (Pseudomonas phage vB_PaeP_Tr60_Ab31) position: , mismatch: 0, identity: 1.0

aaggagcaccacgacatggtcagagcaaaccc	CRISPR spacer
aaggagcaccacgacatggtcagagcaaaccc	Protospacer
********************************

7. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

8. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

9. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

10. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

11. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

12. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

13. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

14. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

15. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

16. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

17. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

18. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

19. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

20. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

21. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

22. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

23. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

24. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 0, identity: 1.0

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgccaagccggaaaccgaggc	Protospacer
********************************

25. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 1, identity: 0.969

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggcagagaccgacaagtcgaagcgcacgg	Protospacer
****** *************************

26. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510993 (Pseudomonas phage BR201, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

27. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510984 (Pseudomonas phage BR200, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

28. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510971 (Pseudomonas phage CF79, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

29. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510970 (Pseudomonas phage CF67, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

30. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KJ959591 (Pseudomonas phage PAN70, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

31. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KY707339 (Pseudomonas phage JBD68, complete genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

32. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510990 (Pseudomonas phage BR133, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

33. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510968 (Pseudomonas phage CF55, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

34. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510969 (Pseudomonas phage CF60, partial genome) position: , mismatch: 1, identity: 0.969

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgatgcc	Protospacer
*******************************

35. spacer 1.5|37758|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 1, identity: 0.969

aaggagcaccacgacatggtcagagcaaaccc	CRISPR spacer
aaggagcaccacgacatggtcagagcagaccc	Protospacer
***************************.****

36. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MH719194 (Pseudomonas phage Ps60, complete genome) position: , mismatch: 1, identity: 0.969

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgcccagccggaaaccgaggc	Protospacer
*************** ****************

37. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MH719192 (Pseudomonas phage Ps56, complete genome) position: , mismatch: 1, identity: 0.969

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcttcgcccagccggaaaccgaggc	Protospacer
*************** ****************

38. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 1, identity: 0.969

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagttcatcgccaagccggaaaccgaggc	Protospacer
********* **********************

39. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510962 (Pseudomonas phage CF3, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

40. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510987 (Pseudomonas phage BR233, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

41. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510984 (Pseudomonas phage BR200, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

42. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510965 (Pseudomonas phage CF34, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

43. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510974 (Pseudomonas phage CF140, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

44. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_007805 (Pseudomonas phage F10, complete genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

45. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510978 (Pseudomonas phage CF208, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

46. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510988 (Pseudomonas phage BR299, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

47. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510976 (Pseudomonas phage CF165, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

48. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KM389229 (UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

49. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KJ959591 (Pseudomonas phage PAN70, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

50. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510990 (Pseudomonas phage BR133, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

51. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510975 (Pseudomonas phage CF145, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

52. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510969 (Pseudomonas phage CF60, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

53. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK510986 (Pseudomonas phage BR213, partial genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

54. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to DQ163912 (Bacteriophage F10, complete genome) position: , mismatch: 2, identity: 0.938

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcacgg	Protospacer
*.*******.**********************

55. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KM389225 (UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
tgttcgtagccgatatcgctgcacgcgacgcc	Protospacer
****************************.**

56. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 2, identity: 0.938

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tcctagctcttcgcccagccggaaaccgaggc	Protospacer
******.******** ****************

57. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 2, identity: 0.938

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tccaagttcttcgcccagccggaaaccgaggc	Protospacer
*** *********** ****************

58. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 2, identity: 0.938

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tccaagttcttcgcccagccggaaaccgaggc	Protospacer
*** *********** ****************

59. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 3, identity: 0.906

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gttggccgaaaccgacaagtcgaagcgcactg	Protospacer
*.*******.******************** *

60. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_008697 (Nocardioides sp. JS614 plasmid pNOCA01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
gctggccgagaccgacgagtcgatgaagtcct	Protospacer
****************.****** * .  *

61. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 8, identity: 0.75

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccggt--ttcgaccagccggaaaccgaggc	Protospacer
    *..**  **** * ****************

62. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.75

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccggt--ttcgaccagccggaaaccgaggc	Protospacer
    *..**  **** * ****************

63. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 8, identity: 0.75

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccggt--ttcgaccagccggaaaccgaggc	Protospacer
    *..**  **** * ****************

64. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 8, identity: 0.75

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccggt--ttcgaccagccggaaaccgaggc	Protospacer
    *..**  **** * ****************

65. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccggt--ttcgaccagccggaaaccgaggc	Protospacer
    *..**  **** * ****************

66. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046256 (Sphingobium sp. CAP-1 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
acctccctgccgatatcgcggcacgcgacgcc	Protospacer
  .** . *********** ********.**

67. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022748 (Sphingobium hydrophobicum strain C1 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
acctccctgccgatatcgcggcacgcgacgcc	Protospacer
  .** . *********** ********.**

68. spacer 1.2|37578|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.719

tgttcgtagccgatatcgctgcacgcgatgca	CRISPR spacer
acctccctgccgatatcgcggcacgcgacgcc	Protospacer
  .** . *********** ********.**

69. spacer 1.3|37638|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_031059 (Rhodovulum phage vB_RhkS_P1, complete genome) position: , mismatch: 9, identity: 0.719

gaggggccgtatcgacggtgattgatgcgaca	CRISPR spacer
gtgctgccggatcgaaggtgattgatgctgag	Protospacer
* *  **** ***** ************ . .

70. spacer 1.4|37698|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

agcaaggcatccggaaacgggccttgggtcac	CRISPR spacer
agcaaggcctccggaaacgcgccgcaattgat	Protospacer
******** ********** *** ... * *.

71. spacer 1.4|37698|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 9, identity: 0.719

agcaaggcatccggaaacgggccttgggtcac	CRISPR spacer
cgcaaggcatcccgaaccgggcctacgatatt	Protospacer
 *********** *** *******  *.*  .

72. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KY362367 (Pseudomonas coronafaciens pv. garcae strain 2708 plasmid pPg2708, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

73. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026559 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

74. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT963404 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP2, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtaccacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

75. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

--tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
aaggccgg--cttcgaccagccggaaaccgaggg	Protospacer
    *..*  ***** * ***************

76. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to CP050261 (Pseudomonas coronafaciens strain X-1 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

77. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042805 (Pseudomonas amygdali pv. tabaci str. ATCC 11528 plasmid pTab1, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtaccacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

78. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT985190 (Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

79. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to CP046442 (Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

80. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT963413 (Pseudomonas syringae isolate CFBP3840 plasmid PP4, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

81. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_005919 (Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326B, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtaccacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

82. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047263 (Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326B, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtaccacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

83. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026566 (Pseudomonas avellanae strain R2leaf plasmid p4_tig8, complete sequence) position: , mismatch: 9, identity: 0.719

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
ctgtatcacttccacaagccggaaaccgaggt	Protospacer
.. ** . ****  *****************.

84. spacer 1.1|37518|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gctggccgagaccgacaagtcgaagcgcacgg	CRISPR spacer
atcggccgaggccgaccagtcgaagcagtccc	Protospacer
...*******.***** *********.  *

85. spacer 1.4|37698|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014581 (Burkholderia sp. OLGA172 plasmid pOLGA2, complete sequence) position: , mismatch: 10, identity: 0.688

agcaaggcatccggaaacgggccttgggtcac	CRISPR spacer
ccaaaggcatccggaaaggggacttgcaaccg	Protospacer
   ************** *** **** . *

86. spacer 1.5|37758|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 10, identity: 0.688

aaggagcaccacgacatggtcagagcaaaccc	CRISPR spacer
gccgtctacctcgacatcgtcagagcaaacag	Protospacer
.  *  .*** ****** ************

87. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MF472892 (Mycobacterium phage TreyKay, complete genome) position: , mismatch: 10, identity: 0.688

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tgggcgttcttcaccaagacggaaaccggccg	Protospacer
*    *******.***** *********.

88. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to KX641264 (Mycobacterium phage LindNT, complete genome) position: , mismatch: 10, identity: 0.688

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tgggcgttcttcaccaagacggaaaccggccg	Protospacer
*    *******.***** *********.

89. spacer 1.6|37818|32|NZ_ASRD01000094|PILER-CR,CRISPRCasFinder,CRT matches to MK016503 (Mycobacterium phage Prithvi, complete genome) position: , mismatch: 10, identity: 0.688

tcctagttcttcgccaagccggaaaccgaggc	CRISPR spacer
tgggcgttcttcaccaagacggaaaccggccg	Protospacer
*    *******.***** *********.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_ASRD01000188

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000188_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000188_1

1282-2570

Unclear

I-F

Consensus_repeat	Method
GTTCACTGCCGTGTAGGCAGCTAAGAAA	PILER-CR
TTTCTTAGCTGCCTACACGGCAGTGAAC	CRISPRCasFinder
TTTCTTAGCTGCCTACACGGCAGTGAAC	CRT
CGTTCACTGCCGTGTAGGCAGCTAAGAAA	PILER-CR

21 spacers

cas1

The CRISPR arrays of NZ_ASRD01000188_1

>merge|NZ_ASRD01000188|1|1282-2570|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
TTTCTTAGCTGCCTACACGGCAGTGAACGACAACCAGCTGGCTCAGCCGGTTGTGCTCAATTTCTTAGCTGCCTACACGGCAGTGAACTCGGACCAGCGGGTTGCAACGTCGCCACGGTATTTCTTAGCTGCCTACACGGCAGTGAACATGAGGGCGGTACGGGTGGACGCCATGCTGTTTTTCTTAGCTGCCTACACGGCAGTGAACGGCAGGACGCGCTGTCCTACGCCCAACGTGAATTTCTTAGCTGCCTACACGGCAGTGAACTTCCCGCCTGATATGTACCTAATGTTCATATTTTTCTTAGCTGCCTACACGGCAGTGAACTCGTCGATCAGGGTTGTTGTAGATTGCAAAGATTTCTTAGCTGCCTACACGGCAGTGAACGCGAACGACCAAGGGGTGTGCTGGCCGGCGGTTTTCTTAGCTGCCTACACGGCAGTGAACAGAGCATCAAGCGCGGCGTGGAAGTGCTTTATTTTCTTAGCTGCCTACACGGCAGTGAACCATGCCCTCCCCGGCAATAGCTGGGGCGGAGATTTCTTAGCTGCCTACACGGCAGTGAACGTCTGTAGCTTCTCCAACTCGCTCCAATCCGATTTCTTAGCTGCCTACACGGCAGTGAACACGCATGGTCAACTCCGACGAACGGCTGTTGTTTTCTTAGCTGCCTACACGGCAGTGAACACGGCTGATTCGCTTTGCAGGATATTTGTCGATTTCTTAGCTGCCTACACGGCAGTGAACTCTTTAGGGTCTGGTGCTCGTAGTCCAGGACGTTTCTTAGCTGCCTACACGGCAGTGAACGACTTTGCGCCGCCTGGTTCGGTCCTGGTGCTTTTCTTAGCTGCCTACACGGCAGTGAACGGCGTGTTGGCCGGGCGCCTGGCGTCCGCAGATTTCTTAGCTGCCTACACGGCAGTGAACCCGCCAGCGGTTCCTGGAGCAGCTGGATATCATTTCTTAGCTGCCTACACGGCAGTGAACCATCGAGGCGGAGCGTATGCACCAGGTCGATCTTTCTTAGCTGCCTACACGGCAGTGAACGCATCAAAGATATTGAAAAGCATCAACGACGATTTCTTAGCTGCCTACACGGCAGTGAACGCGGCCCAGCAGCTTGGCAAGCTCTGGGACATTTTCTTAGCTGCCTACACGGCAGTGAACGTACGGATACTGCGACGGCGGACAGGGTGGCATTTCTTAGCTGCCTACACGGCAGTGAACGCTCAACGGCACGCTGGATCGGATCGACTGATTTTCTTAGCTGCCTACACGGCAGTGAACT

>NZ_ASRD01000188|1|1|1282-2569|PILER-CR
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACAACCAGCTGGCTCAGCCGGTTGTGCTCAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGGACCAGCGGGTTGCAACGTCGCCACGGTA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ATGAGGGCGGTACGGGTGGACGCCATGCTGTT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCAGGACGCGCTGTCCTACGCCCAACGTGAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TTCCCGCCTGATATGTACCTAATGTTCATATT
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGTCGATCAGGGTTGTTGTAGATTGCAAAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGAACGACCAAGGGGTGTGCTGGCCGGCGGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	AGAGCATCAAGCGCGGCGTGGAAGTGCTTTAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATGCCCTCCCCGGCAATAGCTGGGGCGGAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTCTGTAGCTTCTCCAACTCGCTCCAATCCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGCATGGTCAACTCCGACGAACGGCTGTTGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGGCTGATTCGCTTTGCAGGATATTTGTCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCTTTAGGGTCTGGTGCTCGTAGTCCAGGACG
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACTTTGCGCCGCCTGGTTCGGTCCTGGTGCT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCGTGTTGGCCGGGCGCCTGGCGTCCGCAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CCGCCAGCGGTTCCTGGAGCAGCTGGATATCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATCGAGGCGGAGCGTATGCACCAGGTCGATC
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCATCAAAGATATTGAAAAGCATCAACGACGATTTCTTAGCTGCCTACACGGCAGTGAACGCGGCCCAGCAGCTTGGCAAGCTCTGGGACATTTTCTTAGCTGCCTACACGGCAGTGAACGTACGGATACTGCGACGGCGGACAGGGTGGCATTTCTTAGCTGCCTACACGGCAGTGAACGCTCAACGGCACGCTGGATCGGATCGACTGAT
	CGGCCCAGCAGCTTGGCAAGCTCTGGGACAT
TTTCTTAGCTGCCTACACGGCAGTGAACG	TACGGATACTGCGACGGCGGACAGGGTGGCA
TTTCTTAGCTGCCTACACGGCAGTGAACG	CTCAACGGCACGCTGGATCGGATCGACTGAT
TTTCTTAGCTGCCTACACGGCAGTGAAC

>NZ_ASRD01000188|1|1|1282-2569|CRISPRCasFinder
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACAACCAGCTGGCTCAGCCGGTTGTGCTCAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGGACCAGCGGGTTGCAACGTCGCCACGGTA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ATGAGGGCGGTACGGGTGGACGCCATGCTGTT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCAGGACGCGCTGTCCTACGCCCAACGTGAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TTCCCGCCTGATATGTACCTAATGTTCATATT
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGTCGATCAGGGTTGTTGTAGATTGCAAAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGAACGACCAAGGGGTGTGCTGGCCGGCGGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	AGAGCATCAAGCGCGGCGTGGAAGTGCTTTAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATGCCCTCCCCGGCAATAGCTGGGGCGGAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTCTGTAGCTTCTCCAACTCGCTCCAATCCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGCATGGTCAACTCCGACGAACGGCTGTTGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGGCTGATTCGCTTTGCAGGATATTTGTCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCTTTAGGGTCTGGTGCTCGTAGTCCAGGACG
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACTTTGCGCCGCCTGGTTCGGTCCTGGTGCT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCGTGTTGGCCGGGCGCCTGGCGTCCGCAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CCGCCAGCGGTTCCTGGAGCAGCTGGATATCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATCGAGGCGGAGCGTATGCACCAGGTCGATC
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCATCAAAGATATTGAAAAGCATCAACGACGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGGCCCAGCAGCTTGGCAAGCTCTGGGACAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTACGGATACTGCGACGGCGGACAGGGTGGCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCTCAACGGCACGCTGGATCGGATCGACTGAT
TTTCTTAGCTGCCTACACGGCAGTGAAC

>NZ_ASRD01000188|1|1|1282-2569|CRT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACAACCAGCTGGCTCAGCCGGTTGTGCTCAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGGACCAGCGGGTTGCAACGTCGCCACGGTA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ATGAGGGCGGTACGGGTGGACGCCATGCTGTT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCAGGACGCGCTGTCCTACGCCCAACGTGAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TTCCCGCCTGATATGTACCTAATGTTCATATT
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGTCGATCAGGGTTGTTGTAGATTGCAAAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGAACGACCAAGGGGTGTGCTGGCCGGCGGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	AGAGCATCAAGCGCGGCGTGGAAGTGCTTTAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATGCCCTCCCCGGCAATAGCTGGGGCGGAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTCTGTAGCTTCTCCAACTCGCTCCAATCCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGCATGGTCAACTCCGACGAACGGCTGTTGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGGCTGATTCGCTTTGCAGGATATTTGTCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCTTTAGGGTCTGGTGCTCGTAGTCCAGGACG
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACTTTGCGCCGCCTGGTTCGGTCCTGGTGCT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCGTGTTGGCCGGGCGCCTGGCGTCCGCAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CCGCCAGCGGTTCCTGGAGCAGCTGGATATCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATCGAGGCGGAGCGTATGCACCAGGTCGATC
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCATCAAAGATATTGAAAAGCATCAACGACGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGGCCCAGCAGCTTGGCAAGCTCTGGGACAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTACGGATACTGCGACGGCGGACAGGGTGGCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCTCAACGGCACGCTGGATCGGATCGACTGAT
TTTCTTAGCTGCCTACACGGCAGTGAAC

>NZ_ASRD01000188|1|2|2362-2570|PILER-CR
	GACAACCAGCTGGCTCAGCCGGTTGTGCTCAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGGACCAGCGGGTTGCAACGTCGCCACGGTA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ATGAGGGCGGTACGGGTGGACGCCATGCTGTT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCAGGACGCGCTGTCCTACGCCCAACGTGAA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TTCCCGCCTGATATGTACCTAATGTTCATATT
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCGTCGATCAGGGTTGTTGTAGATTGCAAAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCGAACGACCAAGGGGTGTGCTGGCCGGCGGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	AGAGCATCAAGCGCGGCGTGGAAGTGCTTTAT
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATGCCCTCCCCGGCAATAGCTGGGGCGGAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	GTCTGTAGCTTCTCCAACTCGCTCCAATCCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGCATGGTCAACTCCGACGAACGGCTGTTGT
TTTCTTAGCTGCCTACACGGCAGTGAAC	ACGGCTGATTCGCTTTGCAGGATATTTGTCGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	TCTTTAGGGTCTGGTGCTCGTAGTCCAGGACG
TTTCTTAGCTGCCTACACGGCAGTGAAC	GACTTTGCGCCGCCTGGTTCGGTCCTGGTGCT
TTTCTTAGCTGCCTACACGGCAGTGAAC	GGCGTGTTGGCCGGGCGCCTGGCGTCCGCAGA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CCGCCAGCGGTTCCTGGAGCAGCTGGATATCA
TTTCTTAGCTGCCTACACGGCAGTGAAC	CATCGAGGCGGAGCGTATGCACCAGGTCGATC
TTTCTTAGCTGCCTACACGGCAGTGAAC	GCATCAAAGATATTGAAAAGCATCAACGACGATTTCTTAGCTGCCTACACGGCAGTGAACGCGGCCCAGCAGCTTGGCAAGCTCTGGGACATTTTCTTAGCTGCCTACACGGCAGTGAACGTACGGATACTGCGACGGCGGACAGGGTGGCATTTCTTAGCTGCCTACACGGCAGTGAACGCTCAACGGCACGCTGGATCGGATCGACTGAT
	CGGCCCAGCAGCTTGGCAAGCTCTGGGACAT
TTTCTTAGCTGCCTACACGGCAGTGAACG	TACGGATACTGCGACGGCGGACAGGGTGGCA
TTTCTTAGCTGCCTACACGGCAGTGAACG	CTCAACGGCACGCTGGATCGGATCGACTGAT
TTTCTTAGCTGCCTACACGGCAGTGAACT

>NZ_ASRD01000188.1|WP_003139228.1|55_1030_-|type-I-F-CRISPR-associated-endonuclease-Cas1
MDDISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTVSA
>NZ_ASRD01000188.1|WP_023084221.1|2839_3154_-|hypothetical-protein
MAKPNDTSNPELTESSPRFVPLLPTSQADMCPRSATLYVDTHALPTHLFDNAKVRLRSAINILAMTRLLDEKEEPGGTLAYINGALLSLLSDALSEIEAGHPSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_ASRD01000188_1	1.5\|1550\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1550-1581	32	NZ_ASRD01000041.1	5622-5653	2	0.938
NZ_ASRD01000188_1	1.7\|1670\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1670-1701	32	NZ_ASRD01000041.1	6919-6950	2	0.938
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_ASRD01000041.1	26349-26380	2	0.938

1. spacer 1.5|1550|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to position: 5622-5653, mismatch: 2, identity: 0.938

ttcccgcctgatatgtacctaatgttcatatt	CRISPR spacer
ttcctgcctaatatgtacctaatgttcatatt	Protospacer
****.****.**********************

2. spacer 1.7|1670|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to position: 6919-6950, mismatch: 2, identity: 0.938

gcgaacgaccaaggggtgtgctggccggcggt	CRISPR spacer
gcgaacgaccaaggcgtgtgctggccggctgt	Protospacer
************** ************** **

3. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to position: 26349-26380, mismatch: 2, identity: 0.938

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	JN811560	Pseudomonas phage JBD26, complete genome	29468-29499	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	NC_006548	Pseudomonas phage B3, complete genome	30706-30737	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	KM389245	UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00004 genomic sequence	2995-3026	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	AF232233	Bacteriophage B3, complete genome	30706-30737	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511057	Pseudomonas phage CF5, partial genome	27936-27967	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MH719189	Pseudomonas phage Fc02, complete genome	29827-29858	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	KM389336	UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence	10111-10142	0	1.0
NZ_ASRD01000188_1	1.7\|1670\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1670-1701	32	NC_030931	Pseudomonas phage phi2, complete genome	15925-15956	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	1414-1445	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	JX403939	Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome	44107-44138	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	KM389212	UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence	989-1020	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	KM389210	UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence	48111-48142	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	KM389463	UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence	47547-47578	0	1.0
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	NC_030929	Pseudomonas phage JBD44, complete genome	33296-33327	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	2583-2614	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	KM389212	UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence	2158-2189	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK511008	Pseudomonas phage CF124, partial genome	24696-24727	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK511013	Pseudomonas phage BR161, partial genome	37401-37432	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK511002	Pseudomonas phage CF57, partial genome	37300-37331	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK511003	Pseudomonas phage CF65, partial genome	37287-37318	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	KM389210	UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence	46942-46973	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	KM389463	UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence	46378-46409	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK511005	Pseudomonas phage CF81, partial genome	37392-37423	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	NC_023575	Pseudomonas phage vB_PaeP_Tr60_Ab31	22870-22901	0	1.0
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	NC_030929	Pseudomonas phage JBD44, complete genome	34465-34496	0	1.0
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	1231-1262	0	1.0
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	KM389212	UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence	806-837	0	1.0
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	KM389210	UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence	48294-48325	0	1.0
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	KM389463	UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence	47730-47761	0	1.0
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	NC_030929	Pseudomonas phage JBD44, complete genome	33113-33144	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389234	UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00002 genomic sequence	4285-4316	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	AY394005	Bacteriophage D3112, complete genome	31301-31332	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MH719194	Pseudomonas phage Ps60, complete genome	33262-33293	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JN811560	Pseudomonas phage JBD26, complete genome	31415-31446	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511031	Pseudomonas phage BR52, partial genome	24477-24508	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511034	Pseudomonas phage BR243, partial genome	31117-31148	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389262	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence	3354-3385	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511033	Pseudomonas phage BR205, partial genome	31182-31213	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_027298	Pseudomonas phage LPB1, complate genome	30394-30425	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JQ762257	Pseudomonas phage MP42, complete genome	30503-30534	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511017	Pseudomonas phage CF23, partial genome	31133-31164	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_027992	Pseudomonas phage JBD25, complete genome	33418-33449	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	7482-7513	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK144667	Pseudomonas phage Spike, complete genome	31179-31210	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	6386-6417	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511026	Pseudomonas phage CF121, partial genome	31085-31116	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_005178	Pseudomonas phage D3112, complete genome	31301-31332	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MH719192	Pseudomonas phage Ps56, complete genome	33402-33433	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	30987-31018	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511022	Pseudomonas phage CF74, partial genome	33746-33777	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM233689	Pseudomonas phage H70, complete genome	30950-30981	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	DQ631426	Pseudomonas phage DMS3, complete genome	30076-30107	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389336	UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence	12058-12089	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511030	Pseudomonas phage CF213, partial genome	31083-31114	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511025	Pseudomonas phage CF118, partial genome	31112-31143	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511023	Pseudomonas phage CF77, partial genome	31083-31114	0	1.0
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511029	Pseudomonas phage CF183, partial genome	31867-31898	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	19362-19393	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	AY394005	Bacteriophage D3112, complete genome	19998-20029	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	19677-19708	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JN811560	Pseudomonas phage JBD26, complete genome	20116-20147	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	19015-19046	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511031	Pseudomonas phage BR52, partial genome	13171-13202	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511034	Pseudomonas phage BR243, partial genome	19811-19842	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511033	Pseudomonas phage BR205, partial genome	19876-19907	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_027298	Pseudomonas phage LPB1, complate genome	19089-19120	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511017	Pseudomonas phage CF23, partial genome	19827-19858	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389264	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000634 genomic sequence	3657-3688	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	18939-18970	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	17860-17891	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	19475-19506	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	17699-17730	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JQ067085	Pseudomonas phage PaMx73, complete genome	18851-18882	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	19574-19605	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511026	Pseudomonas phage CF121, partial genome	19779-19810	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JX434030	Pseudomonas phage JBD5, complete genome	20020-20051	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_005178	Pseudomonas phage D3112, complete genome	19998-20029	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	17707-17738	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	19513-19544	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	16825-16856	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511022	Pseudomonas phage CF74, partial genome	22440-22471	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389336	UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence	759-790	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511030	Pseudomonas phage CF213, partial genome	19777-19808	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511025	Pseudomonas phage CF118, partial genome	19806-19837	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511023	Pseudomonas phage CF77, partial genome	19777-19808	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511029	Pseudomonas phage CF183, partial genome	20561-20592	0	1.0
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	EU272036	Pseudomonas phage MP29, complete genome	18908-18939	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	AY394005	Bacteriophage D3112, complete genome	31471-31502	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	JN811560	Pseudomonas phage JBD26, complete genome	31585-31616	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_027298	Pseudomonas phage LPB1, complate genome	30564-30595	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	JQ762257	Pseudomonas phage MP42, complete genome	30673-30704	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_027992	Pseudomonas phage JBD25, complete genome	33588-33619	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	7312-7343	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	6216-6247	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	JQ067085	Pseudomonas phage PaMx73, complete genome	30326-30357	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_005178	Pseudomonas phage D3112, complete genome	31471-31502	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	31157-31188	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM233689	Pseudomonas phage H70, complete genome	31120-31151	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM389336	UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence	12228-12259	0	1.0
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_024782	Pseudomonas phage MP48, complete genome	30586-30617	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510993	Pseudomonas phage BR201, partial genome	33469-33500	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510962	Pseudomonas phage CF3, partial genome	6406-6437	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510987	Pseudomonas phage BR233, partial genome	14019-14050	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510971	Pseudomonas phage CF79, partial genome	35574-35605	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510965	Pseudomonas phage CF34, partial genome	28046-28077	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510974	Pseudomonas phage CF140, partial genome	13989-14020	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510978	Pseudomonas phage CF208, partial genome	14129-14160	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510988	Pseudomonas phage BR299, partial genome	14075-14106	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510976	Pseudomonas phage CF165, partial genome	34729-34760	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510970	Pseudomonas phage CF67, partial genome	14072-14103	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	KY707339	Pseudomonas phage JBD68, complete genome	14089-14120	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510990	Pseudomonas phage BR133, partial genome	17358-17389	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510975	Pseudomonas phage CF145, partial genome	14305-14336	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510968	Pseudomonas phage CF55, partial genome	15430-15461	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510969	Pseudomonas phage CF60, partial genome	246-277	0	1.0
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MK510986	Pseudomonas phage BR213, partial genome	14020-14051	0	1.0
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	MN096267	Pseudomonas phage vB_PaS_IME307, complete genome	45511-45542	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_009818	Pseudomonas phage MP22, complete genome	27990-28021	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511059	Pseudomonas phage CF78, partial genome	31252-31283	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511036	Pseudomonas phage BR327, partial genome	28810-28841	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511031	Pseudomonas phage BR52, partial genome	22474-22505	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511034	Pseudomonas phage BR243, partial genome	29114-29145	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389262	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence	1357-1388	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	9484-9515	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511033	Pseudomonas phage BR205, partial genome	29179-29210	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_027298	Pseudomonas phage LPB1, complate genome	28394-28425	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JQ762257	Pseudomonas phage MP42, complete genome	28503-28534	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511017	Pseudomonas phage CF23, partial genome	29130-29161	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JX434033	Pseudomonas phage JBD88a, complete genome	28008-28039	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511061	Pseudomonas phage CF125, partial genome	31251-31282	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_027992	Pseudomonas phage JBD25, complete genome	31418-31449	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	9482-9513	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	20196-20227	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK144667	Pseudomonas phage Spike, complete genome	29176-29207	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	8389-8420	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511018	Pseudomonas phage CF28, partial genome	28842-28873	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KU199707	Pseudomonas phage JBD16C, partial genome	28000-28031	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JQ067085	Pseudomonas phage PaMx73, complete genome	28156-28187	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511026	Pseudomonas phage CF121, partial genome	29082-29113	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_041851	Pseudomonas phage F_HA0480sp/Pa1651, complete genome	28900-28931	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KJ477077	Pseudomonas phage JD024, complete genome	27879-27910	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511063	Pseudomonas phage CF177, partial genome	30566-30597	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	LT608331	Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A	28616-28647	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	28815-28846	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JX434030	Pseudomonas phage JBD5, complete genome	29321-29352	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_030918	Pseudomonas phage JBD93, complete genome	28205-28236	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MH719192	Pseudomonas phage Ps56, complete genome	31402-31433	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	EU272037	Pseudomonas phage MP38, complete genome	28472-28503	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	28984-29015	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JX434032	Pseudomonas phage JBD30, complete genome	28542-28573	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511022	Pseudomonas phage CF74, partial genome	31743-31774	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KU199708	Pseudomonas phage JBD69, complete genome	28525-28556	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	DQ631426	Pseudomonas phage DMS3, complete genome	28076-28107	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511030	Pseudomonas phage CF213, partial genome	29080-29111	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511025	Pseudomonas phage CF118, partial genome	29109-29140	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JX434031	Pseudomonas phage JBD24, complete genome	28660-28691	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	DQ873690	Phage MP22, complete genome	27990-28021	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511023	Pseudomonas phage CF77, partial genome	29080-29111	0	1.0
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511029	Pseudomonas phage CF183, partial genome	29864-29895	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	AY394005	Bacteriophage D3112, complete genome	17013-17044	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	JN811560	Pseudomonas phage JBD26, complete genome	17087-17118	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389337	UNVERIFIED: Pseudomonas phage JBD58a clone contig00002 genomic sequence	14770-14801	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NC_027298	Pseudomonas phage LPB1, complate genome	16354-16385	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	21925-21956	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	JQ067085	Pseudomonas phage PaMx73, complete genome	15822-15853	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NC_005178	Pseudomonas phage D3112, complete genome	17013-17044	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389261	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000621 genomic sequence	1565-1596	0	1.0
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM233689	Pseudomonas phage H70, complete genome	16908-16939	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_009818	Pseudomonas phage MP22, complete genome	27990-28020	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511059	Pseudomonas phage CF78, partial genome	31252-31282	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511036	Pseudomonas phage BR327, partial genome	28810-28840	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511031	Pseudomonas phage BR52, partial genome	22474-22504	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511034	Pseudomonas phage BR243, partial genome	29114-29144	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389262	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence	1357-1387	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	9485-9515	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511033	Pseudomonas phage BR205, partial genome	29179-29209	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_027298	Pseudomonas phage LPB1, complate genome	28394-28424	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JQ762257	Pseudomonas phage MP42, complete genome	28503-28533	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511017	Pseudomonas phage CF23, partial genome	29130-29160	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JX434033	Pseudomonas phage JBD88a, complete genome	28008-28038	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511061	Pseudomonas phage CF125, partial genome	31251-31281	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_027992	Pseudomonas phage JBD25, complete genome	31418-31448	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	9483-9513	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	20196-20226	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK144667	Pseudomonas phage Spike, complete genome	29176-29206	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	8390-8420	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511018	Pseudomonas phage CF28, partial genome	28842-28872	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KU199707	Pseudomonas phage JBD16C, partial genome	28000-28030	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JQ067085	Pseudomonas phage PaMx73, complete genome	28156-28186	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511026	Pseudomonas phage CF121, partial genome	29082-29112	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_041851	Pseudomonas phage F_HA0480sp/Pa1651, complete genome	28900-28930	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KJ477077	Pseudomonas phage JD024, complete genome	27879-27909	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511063	Pseudomonas phage CF177, partial genome	30566-30596	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	LT608331	Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A	28616-28646	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	28815-28845	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JX434030	Pseudomonas phage JBD5, complete genome	29321-29351	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_030918	Pseudomonas phage JBD93, complete genome	28205-28235	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MH719192	Pseudomonas phage Ps56, complete genome	31402-31432	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	EU272037	Pseudomonas phage MP38, complete genome	28472-28502	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	28984-29014	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JX434032	Pseudomonas phage JBD30, complete genome	28542-28572	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511022	Pseudomonas phage CF74, partial genome	31743-31773	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KU199708	Pseudomonas phage JBD69, complete genome	28525-28555	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	DQ631426	Pseudomonas phage DMS3, complete genome	28076-28106	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511030	Pseudomonas phage CF213, partial genome	29080-29110	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511025	Pseudomonas phage CF118, partial genome	29109-29139	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JX434031	Pseudomonas phage JBD24, complete genome	28660-28690	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	DQ873690	Phage MP22, complete genome	27990-28020	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511023	Pseudomonas phage CF77, partial genome	29080-29110	0	1.0
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511029	Pseudomonas phage CF183, partial genome	29864-29894	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	AY394005	Bacteriophage D3112, complete genome	17014-17044	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	JN811560	Pseudomonas phage JBD26, complete genome	17088-17118	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389337	UNVERIFIED: Pseudomonas phage JBD58a clone contig00002 genomic sequence	14771-14801	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NC_027298	Pseudomonas phage LPB1, complate genome	16355-16385	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389326	UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence	21925-21955	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	JQ067085	Pseudomonas phage PaMx73, complete genome	15823-15853	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NC_005178	Pseudomonas phage D3112, complete genome	17014-17044	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389261	UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000621 genomic sequence	1566-1596	0	1.0
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM233689	Pseudomonas phage H70, complete genome	16909-16939	0	1.0
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK934841	Pseudomonas phage UMP151, complete genome	30365-30396	1	0.969
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	KM389238	UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence	9126-9157	1	0.969
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	MN096267	Pseudomonas phage vB_PaS_IME307, complete genome	42124-42155	1	0.969
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	KT887557	Pseudomonas phage phi1, complete genome	56921-56952	1	0.969
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MN096267	Pseudomonas phage vB_PaS_IME307, complete genome	43293-43324	1	0.969
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	NC_011373	Pseudomonas phage PAJU2, complete genome	27755-27786	1	0.969
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	JX403939	Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome	42938-42969	1	0.969
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	AP009624	Pseudomonas phage PAJU2 DNA, complete genome	27755-27786	1	0.969
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	MN096267	Pseudomonas phage vB_PaS_IME307, complete genome	41941-41972	1	0.969
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	JX403939	Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome	44290-44321	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	30664-30695	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	31152-31183	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_009818	Pseudomonas phage MP22, complete genome	29990-30021	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511036	Pseudomonas phage BR327, partial genome	30810-30841	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	30316-30347	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	7484-7515	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JX434033	Pseudomonas phage JBD88a, complete genome	30008-30039	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	22196-22227	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	30777-30808	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	6397-6428	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	MK511018	Pseudomonas phage CF28, partial genome	30842-30873	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KU199707	Pseudomonas phage JBD16C, partial genome	30000-30031	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JQ067085	Pseudomonas phage PaMx73, complete genome	30156-30187	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	30876-30907	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_041851	Pseudomonas phage F_HA0480sp/Pa1651, complete genome	30900-30931	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KJ477077	Pseudomonas phage JD024, complete genome	29879-29910	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	LT608331	Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A	30616-30647	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	30815-30846	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JX434030	Pseudomonas phage JBD5, complete genome	31321-31352	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_030918	Pseudomonas phage JBD93, complete genome	30205-30236	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	6406-6437	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	28127-28158	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JX434032	Pseudomonas phage JBD30, complete genome	30542-30573	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	KU199708	Pseudomonas phage JBD69, complete genome	30525-30556	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	NC_024782	Pseudomonas phage MP48, complete genome	30416-30447	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	DQ873690	Phage MP22, complete genome	29990-30021	1	0.969
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	EU272036	Pseudomonas phage MP29, complete genome	30209-30240	1	0.969
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	18799-18830	1	0.969
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	10899-10930	1	0.969
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK144667	Pseudomonas phage Spike, complete genome	19876-19907	1	0.969
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KJ477077	Pseudomonas phage JD024, complete genome	18564-18595	1	0.969
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM233689	Pseudomonas phage H70, complete genome	19652-19683	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KM389234	UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00002 genomic sequence	4455-4486	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MH719194	Pseudomonas phage Ps60, complete genome	33432-33463	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511036	Pseudomonas phage BR327, partial genome	30980-31011	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511031	Pseudomonas phage BR52, partial genome	24647-24678	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511034	Pseudomonas phage BR243, partial genome	31287-31318	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511033	Pseudomonas phage BR205, partial genome	31352-31383	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511017	Pseudomonas phage CF23, partial genome	31303-31334	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK144667	Pseudomonas phage Spike, complete genome	31349-31380	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511018	Pseudomonas phage CF28, partial genome	31012-31043	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511026	Pseudomonas phage CF121, partial genome	31255-31286	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	30985-31016	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511022	Pseudomonas phage CF74, partial genome	33916-33947	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511030	Pseudomonas phage CF213, partial genome	31253-31284	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511025	Pseudomonas phage CF118, partial genome	31282-31313	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511023	Pseudomonas phage CF77, partial genome	31253-31284	1	0.969
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	MK511029	Pseudomonas phage CF183, partial genome	32037-32068	1	0.969
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	KJ959591	Pseudomonas phage PAN70, partial genome	14032-14063	1	0.969
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NC_031091	Pseudomonas phage MD8, complete genome	15891-15922	1	0.969
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	KC862296	Pseudomonas phage P3_CHA, complete genome	71817-71848	1	0.969
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	MT118295	Pseudomonas phage Epa18, complete genome	6788-6819	1	0.969
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	KC862299	Pseudomonas phage PAK_P3, complete genome	71817-71848	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511008	Pseudomonas phage CF124, partial genome	24635-24666	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511013	Pseudomonas phage BR161, partial genome	37340-37371	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511002	Pseudomonas phage CF57, partial genome	37239-37270	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511009	Pseudomonas phage CF136, partial genome	37195-37226	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511003	Pseudomonas phage CF65, partial genome	37226-37257	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK819239	Pseudomonas phage vB_PaeP_YA3, complete genome	23534-23565	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MK511005	Pseudomonas phage CF81, partial genome	37331-37362	1	0.969
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NC_023575	Pseudomonas phage vB_PaeP_Tr60_Ab31	22809-22840	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	16189-16220	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511031	Pseudomonas phage BR52, partial genome	10163-10194	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511034	Pseudomonas phage BR243, partial genome	16803-16834	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511033	Pseudomonas phage BR205, partial genome	16868-16899	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511017	Pseudomonas phage CF23, partial genome	16819-16850	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK144667	Pseudomonas phage Spike, complete genome	16868-16899	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	21216-21247	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511026	Pseudomonas phage CF121, partial genome	16771-16802	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	JX434030	Pseudomonas phage JBD5, complete genome	16500-16531	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	20533-20564	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	16157-16188	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511022	Pseudomonas phage CF74, partial genome	19432-19463	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511030	Pseudomonas phage CF213, partial genome	16769-16800	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511025	Pseudomonas phage CF118, partial genome	16798-16829	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511023	Pseudomonas phage CF77, partial genome	16769-16800	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MK511029	Pseudomonas phage CF183, partial genome	17553-17584	1	0.969
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	EU272036	Pseudomonas phage MP29, complete genome	16082-16113	1	0.969
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511008	Pseudomonas phage CF124, partial genome	24636-24666	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511013	Pseudomonas phage BR161, partial genome	37341-37371	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511002	Pseudomonas phage CF57, partial genome	37240-37270	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511009	Pseudomonas phage CF136, partial genome	37196-37226	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511003	Pseudomonas phage CF65, partial genome	37227-37257	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK819239	Pseudomonas phage vB_PaeP_YA3, complete genome	23535-23565	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MK511005	Pseudomonas phage CF81, partial genome	37332-37362	1	0.968
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NC_023575	Pseudomonas phage vB_PaeP_Tr60_Ab31	22810-22840	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	16190-16220	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511031	Pseudomonas phage BR52, partial genome	10164-10194	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511034	Pseudomonas phage BR243, partial genome	16804-16834	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511033	Pseudomonas phage BR205, partial genome	16869-16899	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511017	Pseudomonas phage CF23, partial genome	16820-16850	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK144667	Pseudomonas phage Spike, complete genome	16869-16899	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389461	UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence	21216-21246	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511026	Pseudomonas phage CF121, partial genome	16772-16802	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	JX434030	Pseudomonas phage JBD5, complete genome	16501-16531	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	20533-20563	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389459	UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence	16158-16188	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511022	Pseudomonas phage CF74, partial genome	19433-19463	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511030	Pseudomonas phage CF213, partial genome	16770-16800	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511025	Pseudomonas phage CF118, partial genome	16799-16829	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511023	Pseudomonas phage CF77, partial genome	16770-16800	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MK511029	Pseudomonas phage CF183, partial genome	17554-17584	1	0.968
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	EU272036	Pseudomonas phage MP29, complete genome	16083-16113	1	0.968
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MH719194	Pseudomonas phage Ps60, complete genome	31315-31346	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	29202-29233	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511031	Pseudomonas phage BR52, partial genome	22527-22558	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511034	Pseudomonas phage BR243, partial genome	29167-29198	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511033	Pseudomonas phage BR205, partial genome	29232-29263	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511017	Pseudomonas phage CF23, partial genome	29183-29214	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK144667	Pseudomonas phage Spike, complete genome	29229-29260	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511026	Pseudomonas phage CF121, partial genome	29135-29166	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511022	Pseudomonas phage CF74, partial genome	31796-31827	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511030	Pseudomonas phage CF213, partial genome	29133-29164	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511025	Pseudomonas phage CF118, partial genome	29162-29193	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511023	Pseudomonas phage CF77, partial genome	29133-29164	2	0.938
NZ_ASRD01000188_1	1.2\|1370\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1370-1401	32	MK511029	Pseudomonas phage CF183, partial genome	29917-29948	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	123799-123830	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_KU130294	Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence	113804-113835	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	148602-148633	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	119419-119450	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	112951-112982	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	113104-113135	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	165303-165334	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	150729-150760	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	440044-440075	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	116452-116483	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	398781-398812	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	116234-116265	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	118914-118945	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	115504-115535	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	117232-117263	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP039294	Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence	360806-360837	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	190944-190975	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	398692-398723	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	116429-116460	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	46122-46153	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	188852-188883	2	0.938
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	119882-119913	2	0.938
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	KT887557	Pseudomonas phage phi1, complete genome	57104-57135	2	0.938
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	EU272037	Pseudomonas phage MP38, complete genome	30472-30503	2	0.938
NZ_ASRD01000188_1	1.12\|1970\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1970-2001	32	JX434031	Pseudomonas phage JBD24, complete genome	30660-30691	2	0.938
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NC_030918	Pseudomonas phage JBD93, complete genome	30375-30406	2	0.938
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	DQ631426	Pseudomonas phage DMS3, complete genome	30246-30277	2	0.938
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	JX434031	Pseudomonas phage JBD24, complete genome	30830-30861	2	0.938
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	KM389225	UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence	18827-18858	2	0.938
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MG707188	Pseudomonas phage TC7, partial genome	636-667	2	0.938
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	KM389229	UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence	26335-26366	2	0.938
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NC_030931	Pseudomonas phage phi2, complete genome	35361-35392	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	28664-28695	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	29149-29180	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	28316-28347	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	28777-28808	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	8397-8428	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	28876-28907	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	8406-8437	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	26127-26158	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM233689	Pseudomonas phage H70, complete genome	28950-28981	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_024782	Pseudomonas phage MP48, complete genome	28416-28447	2	0.938
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	EU272036	Pseudomonas phage MP29, complete genome	28209-28240	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	16006-16037	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	16157-16188	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	21785-21816	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	8074-8105	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	16119-16150	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	21055-21086	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	16218-16249	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	KJ477077	Pseudomonas phage JD024, complete genome	15578-15609	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	13469-13500	2	0.938
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NC_024782	Pseudomonas phage MP48, complete genome	16082-16113	2	0.938
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	28664-28694	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MH719191	Pseudomonas phage Fc22, complete genome	29837-29867	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	29149-29179	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_006548	Pseudomonas phage B3, complete genome	30653-30683	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MH643777	Pseudomonas phage YMC12/01/R960, complete genome	28316-28346	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	AF232233	Bacteriophage B3, complete genome	30653-30683	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	28777-28807	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	8398-8428	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511057	Pseudomonas phage CF5, partial genome	27883-27913	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	28876-28906	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389464	UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence	8407-8437	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	26127-26157	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MH719189	Pseudomonas phage Fc02, complete genome	29774-29804	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM233689	Pseudomonas phage H70, complete genome	28950-28980	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK934841	Pseudomonas phage UMP151, complete genome	30312-30342	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	KM389238	UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence	9180-9210	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_024782	Pseudomonas phage MP48, complete genome	28416-28446	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	JX495041	Pseudomonas phage JBD18, complete genome	30586-30616	2	0.935
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	EU272036	Pseudomonas phage MP29, complete genome	28209-28239	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	LN907801	unidentified phage genome assembly 2P1, chromosome : 2P1	16007-16037	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	LT999987	Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite	16158-16188	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389460	UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence	21785-21815	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389278	UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence	8075-8105	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	MH643778	Pseudomonas phage YMC12/01/R24, complete genome	16120-16150	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KM389462	UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence	21055-21085	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KT968832	Pseudomonas phage YMC11/11/R1836, complete genome	16219-16249	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	KJ477077	Pseudomonas phage JD024, complete genome	15579-15609	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NC_023700	Pseudomonas phage PA1/KOR/2010, complete genome	13470-13500	2	0.935
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NC_024782	Pseudomonas phage MP48, complete genome	16083-16113	2	0.935
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_009818	Pseudomonas phage MP22, complete genome	18858-18889	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511036	Pseudomonas phage BR327, partial genome	19977-20008	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JQ762257	Pseudomonas phage MP42, complete genome	19675-19706	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JX434033	Pseudomonas phage JBD88a, complete genome	18847-18878	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389243	UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00002 genomic sequence	5942-5973	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511018	Pseudomonas phage CF28, partial genome	20009-20040	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KU199707	Pseudomonas phage JBD16C, partial genome	18824-18855	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_041851	Pseudomonas phage F_HA0480sp/Pa1651, complete genome	19768-19799	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	LT608331	Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A	19484-19515	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	19982-20013	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	EU272037	Pseudomonas phage MP38, complete genome	19320-19351	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JX434032	Pseudomonas phage JBD30, complete genome	19714-19745	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KU199708	Pseudomonas phage JBD69, complete genome	19697-19728	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	DQ631426	Pseudomonas phage DMS3, complete genome	19243-19274	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_024782	Pseudomonas phage MP48, complete genome	19432-19463	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JX434031	Pseudomonas phage JBD24, complete genome	19827-19858	3	0.906
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	DQ873690	Phage MP22, complete genome	18858-18889	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MH719191	Pseudomonas phage Fc22, complete genome	29837-29868	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NC_006548	Pseudomonas phage B3, complete genome	30653-30684	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	AF232233	Bacteriophage B3, complete genome	30653-30684	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511057	Pseudomonas phage CF5, partial genome	27883-27914	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MH719189	Pseudomonas phage Fc02, complete genome	29774-29805	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK934841	Pseudomonas phage UMP151, complete genome	30312-30343	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	KM389238	UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence	9179-9210	3	0.906
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	JX495041	Pseudomonas phage JBD18, complete genome	30586-30617	3	0.906
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	242353-242384	5	0.844
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	242353-242383	5	0.839
NZ_ASRD01000188_1	1.3\|1430\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1430-1461	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	930539-930570	6	0.812
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	MK819239	Pseudomonas phage vB_PaeP_YA3, complete genome	23593-23624	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389237	UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00001 genomic sequence	10768-10799	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719191	Pseudomonas phage Fc22, complete genome	20431-20462	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719195	Pseudomonas phage Ps59, complete genome	21199-21230	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_027992	Pseudomonas phage JBD25, complete genome	22007-22038	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK511057	Pseudomonas phage CF5, partial genome	18476-18507	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719192	Pseudomonas phage Ps56, complete genome	21996-22027	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719190	Pseudomonas phage H71, complete genome	20402-20433	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719189	Pseudomonas phage Fc02, complete genome	20367-20398	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MK934841	Pseudomonas phage UMP151, complete genome	20896-20927	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	KM389233	UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00001 genomic sequence	6522-6553	6	0.812
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	MH719193	Pseudomonas phage H72, complete genome	20825-20856	6	0.812
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	KT887557	Pseudomonas phage phi1, complete genome	55753-55784	7	0.781
NZ_ASRD01000188_1	1.9\|1790\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1790-1821	32	NZ_CP013052	Sinorhizobium americanum CCGM7 plasmid A, complete sequence	378775-378806	7	0.781
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	MK524530	Mycobacterium phage Pharaoh, complete genome	12291-12322	7	0.781
NZ_ASRD01000188_1	1.11\|1910\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1910-1941	32	NZ_CP017242	Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence	279343-279374	7	0.781
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	JQ680365	Unidentified phage clone 2200_scaffold2278 genomic sequence	18085-18116	7	0.781
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	445768-445799	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	87828-87859	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	618101-618132	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	76852-76883	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	237642-237673	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	83284-83315	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	2395-2426	7	0.781
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	810968-810999	7	0.781
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	247715-247746	7	0.781
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	445769-445799	7	0.774
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP012699	Microbacterium sp. No. 7 plasmid B, complete sequence	1323-1353	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	87829-87859	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	618101-618131	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	76852-76882	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	237643-237673	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	83284-83314	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	2395-2425	7	0.774
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	810968-810998	7	0.774
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	247716-247746	7	0.774
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NZ_CP021745	Agarilytica rhodophyticola strain 017 plasmid pSU1, complete sequence	36269-36300	8	0.75
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NZ_CP045721	Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence	443806-443837	8	0.75
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NZ_CP038854	Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence	242440-242471	8	0.75
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NZ_CP022517	Pantoea vagans strain FBS135 plasmid pPant1, complete sequence	490127-490158	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	86157-86188	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	299763-299794	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	372136-372167	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	746196-746227	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	877822-877853	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	877822-877853	8	0.75
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP017242	Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence	239013-239044	8	0.75
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP012699	Microbacterium sp. No. 7 plasmid B, complete sequence	1323-1354	8	0.75
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1326053-1326084	8	0.75
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	847177-847208	8	0.75
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	MN536027	Pseudomonas phage vB_Pae-SS2019XII, complete genome	12415-12445	8	0.742
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	99552-99582	8	0.742
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1326053-1326083	8	0.742
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	847178-847208	8	0.742
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	745685-745715	8	0.742
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1290739-1290769	8	0.742
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	472862-472892	8	0.742
NZ_ASRD01000188_1	1.1\|1310\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1310-1341	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	683346-683377	9	0.719
NZ_ASRD01000188_1	1.3\|1430\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1430-1461	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	391449-391480	9	0.719
NZ_ASRD01000188_1	1.13\|2030\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2030-2061	32	NC_024123	Pseudomonas phage KPP25 DNA, complete sequence	18719-18750	9	0.719
NZ_ASRD01000188_1	1.15\|2150\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2150-2181	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	948697-948728	9	0.719
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	NZ_CP044991	Deinococcus sp. AJ005 plasmid p115k, complete sequence	55938-55969	9	0.719
NZ_ASRD01000188_1	1.16\|2210\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2210-2241	32	KT001914	Caulobacter phage Seuss, complete genome	19069-19100	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1816193-1816224	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	784036-784067	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	119173-119204	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	166509-166540	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	408348-408379	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	263438-263469	9	0.719
NZ_ASRD01000188_1	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	MN693917	Marine virus AFVG_250M787, complete genome	39672-39703	9	0.719
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	MN693532	Marine virus AFVG_25M340, complete genome	2896-2927	9	0.719
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	MN536027	Pseudomonas phage vB_Pae-SS2019XII, complete genome	12415-12446	9	0.719
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	99552-99583	9	0.719
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_AP018668	Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence	8013-8044	9	0.719
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	745685-745716	9	0.719
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1290739-1290770	9	0.719
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	472862-472893	9	0.719
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	354673-354703	9	0.71
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	946718-946748	9	0.71
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	147022-147052	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	9205-9235	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511042	Pseudomonas phage CF126, partial genome	10702-10732	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511040	Pseudomonas phage CF63, partial genome	57193-57223	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511051	Pseudomonas phage BR181, partial genome	56270-56300	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511041	Pseudomonas phage CF69, partial genome	10730-10760	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511049	Pseudomonas phage BR326, partial genome	56270-56300	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511045	Pseudomonas phage BR208, partial genome	56270-56300	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511044	Pseudomonas phage BR197, partial genome	10730-10760	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511050	Pseudomonas phage BR150, partial genome	10658-10688	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511048	Pseudomonas phage BR320, partial genome	10658-10688	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511046	Pseudomonas phage BR313, partial genome	56270-56300	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511047	Pseudomonas phage BR319, partial genome	10834-10864	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511043	Pseudomonas phage BR228, partial genome	6779-6809	9	0.71
NZ_ASRD01000188_1	1.24\|2451\|31\|NZ_ASRD01000188\|PILER-CR	2451-2481	31	MK511039	Pseudomonas phage CF24, partial genome	10730-10760	9	0.71
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	13096-13126	9	0.71
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_AP018668	Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence	8014-8044	9	0.71
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	353802-353832	9	0.71
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	403805-403835	9	0.71
NZ_ASRD01000188_1	1.25\|2511\|31\|NZ_ASRD01000188\|PILER-CR	2511-2541	31	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	587526-587556	9	0.71
NZ_ASRD01000188_1	1.4\|1490\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1490-1521	32	NZ_CP028970	Aminobacter sp. MSH1 plasmid pUSP2, complete sequence	193294-193325	10	0.688
NZ_ASRD01000188_1	1.5\|1550\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1550-1581	32	MN783747	Klebsiella oxytoca plasmid pIron_OXY, complete sequence	8391-8422	10	0.688
NZ_ASRD01000188_1	1.6\|1610\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1610-1641	32	NZ_AP018284	Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome	31677-31708	10	0.688
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	412494-412525	10	0.688
NZ_ASRD01000188_1	1.8\|1730\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1730-1761	32	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	56719-56750	10	0.688
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	235448-235479	10	0.688
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	58313-58344	10	0.688
NZ_ASRD01000188_1	1.10\|1850\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1850-1881	32	NZ_CP018821	Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence	114009-114040	10	0.688
NZ_ASRD01000188_1	1.14\|2090\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2090-2121	32	NZ_CP016890	Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence	92525-92556	10	0.688
NZ_ASRD01000188_1	1.14\|2090\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2090-2121	32	NZ_CP045721	Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence	349542-349573	10	0.688
NZ_ASRD01000188_1	1.14\|2090\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2090-2121	32	NZ_CP034149	Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence	138317-138348	10	0.688
NZ_ASRD01000188_1	1.14\|2090\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2090-2121	32	NZ_CP031650	Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence	356729-356760	10	0.688
NZ_ASRD01000188_1	1.14\|2090\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2090-2121	32	NZ_CP022517	Pantoea vagans strain FBS135 plasmid pPant1, complete sequence	57580-57611	10	0.688
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	MN694153	Marine virus AFVG_250M457, complete genome	33929-33960	10	0.688
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	NZ_CP032528	Bacillus megaterium NCT-2 plasmid pNCT2_1, complete sequence	78653-78684	10	0.688
NZ_ASRD01000188_1	1.19\|2330\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2330-2361	32	MN693930	Marine virus AFVG_250M489, complete genome	32736-32767	10	0.688
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	354672-354703	10	0.688
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP011506	Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence	53663-53694	10	0.688
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	946717-946748	10	0.688
NZ_ASRD01000188_1	1.20\|2390\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2390-2421	32	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	147021-147052	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511042	Pseudomonas phage CF126, partial genome	10702-10733	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511040	Pseudomonas phage CF63, partial genome	57193-57224	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511051	Pseudomonas phage BR181, partial genome	56270-56301	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511041	Pseudomonas phage CF69, partial genome	10730-10761	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511049	Pseudomonas phage BR326, partial genome	56270-56301	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511045	Pseudomonas phage BR208, partial genome	56270-56301	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511044	Pseudomonas phage BR197, partial genome	10730-10761	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511050	Pseudomonas phage BR150, partial genome	10658-10689	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511048	Pseudomonas phage BR320, partial genome	10658-10689	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511046	Pseudomonas phage BR313, partial genome	56270-56301	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511047	Pseudomonas phage BR319, partial genome	10834-10865	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511043	Pseudomonas phage BR228, partial genome	6779-6810	10	0.688
NZ_ASRD01000188_1	1.21\|2450\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2450-2481	32	MK511039	Pseudomonas phage CF24, partial genome	10730-10761	10	0.688
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	13096-13127	10	0.688
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	353802-353833	10	0.688
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	403805-403836	10	0.688
NZ_ASRD01000188_1	1.22\|2510\|32\|NZ_ASRD01000188\|CRISPRCasFinder,CRT	2510-2541	32	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	587525-587556	10	0.688
NZ_ASRD01000188_1	1.23\|2391\|31\|NZ_ASRD01000188\|PILER-CR	2391-2421	31	NZ_CP011506	Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence	53664-53694	10	0.677

1. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

2. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_006548 (Pseudomonas phage B3, complete genome) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

3. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389245 (UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00004 genomic sequence) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

4. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to AF232233 (Bacteriophage B3, complete genome) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

5. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511057 (Pseudomonas phage CF5, partial genome) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

6. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719189 (Pseudomonas phage Fc02, complete genome) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

7. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389336 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggttgcaacgtcgccacggta	Protospacer
********************************

8. spacer 1.7|1670|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 0, identity: 1.0

gcgaacgaccaaggggtgtgctggccggcggt	CRISPR spacer
gcgaacgaccaaggggtgtgctggccggcggt	Protospacer
********************************

9. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

10. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX403939 (Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

11. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389212 (UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

12. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389210 (UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

13. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389463 (UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

14. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030929 (Pseudomonas phage JBD44, complete genome) position: , mismatch: 0, identity: 1.0

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatcaagcgcggcgtggaagtgctttat	Protospacer
********************************

15. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

16. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389212 (UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

17. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511008 (Pseudomonas phage CF124, partial genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

18. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511013 (Pseudomonas phage BR161, partial genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

19. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511002 (Pseudomonas phage CF57, partial genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

20. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511003 (Pseudomonas phage CF65, partial genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

21. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389210 (UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

22. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389463 (UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

23. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511005 (Pseudomonas phage CF81, partial genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

24. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_023575 (Pseudomonas phage vB_PaeP_Tr60_Ab31) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

25. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030929 (Pseudomonas phage JBD44, complete genome) position: , mismatch: 0, identity: 1.0

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggcggaga	Protospacer
********************************

26. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 0, identity: 1.0

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccaactcgctccaatccga	Protospacer
********************************

27. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389212 (UNVERIFIED: Pseudomonas phage JBD88b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccaactcgctccaatccga	Protospacer
********************************

28. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389210 (UNVERIFIED: Pseudomonas phage DO4 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccaactcgctccaatccga	Protospacer
********************************

29. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389463 (UNVERIFIED: Pseudomonas phage JBD94b clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccaactcgctccaatccga	Protospacer
********************************

30. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030929 (Pseudomonas phage JBD44, complete genome) position: , mismatch: 0, identity: 1.0

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccaactcgctccaatccga	Protospacer
********************************

31. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389234 (UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00002 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

32. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

33. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719194 (Pseudomonas phage Ps60, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

34. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

35. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

36. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

37. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389262 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

38. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

39. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

40. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

41. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

42. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027992 (Pseudomonas phage JBD25, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

43. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

44. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

45. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

46. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

47. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

48. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719192 (Pseudomonas phage Ps56, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

49. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

50. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

51. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

52. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

53. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389336 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

54. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

55. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

56. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

57. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 0, identity: 1.0

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcaggatatttgtcga	Protospacer
********************************

58. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

59. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

60. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

61. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

62. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

63. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

64. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

65. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

66. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

67. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

68. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389264 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000634 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

69. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

70. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

71. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

72. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

73. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

74. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

75. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

76. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

77. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

78. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

79. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

80. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

81. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

82. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389336 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

83. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

84. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

85. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

86. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

87. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 0, identity: 1.0

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tctttagggtctggtgctcgtagtccaggacg	Protospacer
********************************

88. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

89. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

90. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

91. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

92. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027992 (Pseudomonas phage JBD25, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

93. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

94. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

95. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

96. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

97. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

98. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

99. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389336 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

100. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 0, identity: 1.0

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagctggatatca	Protospacer
********************************

101. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510993 (Pseudomonas phage BR201, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

102. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510962 (Pseudomonas phage CF3, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

103. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510987 (Pseudomonas phage BR233, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

104. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510971 (Pseudomonas phage CF79, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

105. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510965 (Pseudomonas phage CF34, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

106. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510974 (Pseudomonas phage CF140, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

107. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510978 (Pseudomonas phage CF208, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

108. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510988 (Pseudomonas phage BR299, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

109. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510976 (Pseudomonas phage CF165, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

110. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510970 (Pseudomonas phage CF67, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

111. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KY707339 (Pseudomonas phage JBD68, complete genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

112. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510990 (Pseudomonas phage BR133, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

113. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510975 (Pseudomonas phage CF145, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

114. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510968 (Pseudomonas phage CF55, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

115. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510969 (Pseudomonas phage CF60, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

116. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK510986 (Pseudomonas phage BR213, partial genome) position: , mismatch: 0, identity: 1.0

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccaggtcgatc	Protospacer
********************************

117. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MN096267 (Pseudomonas phage vB_PaS_IME307, complete genome) position: , mismatch: 0, identity: 1.0

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
gcatcaaagatattgaaaagcatcaacgacga	Protospacer
********************************

118. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_009818 (Pseudomonas phage MP22, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

119. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511059 (Pseudomonas phage CF78, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

120. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

121. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

122. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

123. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389262 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

124. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

125. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

126. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

127. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

128. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

129. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX434033 (Pseudomonas phage JBD88a, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

130. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511061 (Pseudomonas phage CF125, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

131. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_027992 (Pseudomonas phage JBD25, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

132. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

133. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

134. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

135. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

136. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

137. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KU199707 (Pseudomonas phage JBD16C, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

138. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

139. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

140. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_041851 (Pseudomonas phage F_HA0480sp/Pa1651, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

141. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

142. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511063 (Pseudomonas phage CF177, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

143. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to LT608331 (Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

144. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

145. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

146. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

147. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH719192 (Pseudomonas phage Ps56, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

148. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to EU272037 (Pseudomonas phage MP38, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

149. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

150. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

151. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

152. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

153. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

154. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

155. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

156. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

157. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to DQ873690 (Phage MP22, complete genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

158. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

159. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 0, identity: 1.0

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacagggtggca	Protospacer
********************************

160. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

161. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

162. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389337 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00002 genomic sequence) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

163. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

164. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

165. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

166. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

167. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389261 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000621 genomic sequence) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

168. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 0, identity: 1.0

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcacgctggatcggatcgactgat	Protospacer
********************************

169. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_009818 (Pseudomonas phage MP22, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

170. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511059 (Pseudomonas phage CF78, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

171. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

172. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

173. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

174. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389262 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000624 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

175. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

176. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

177. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

178. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

179. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

180. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JX434033 (Pseudomonas phage JBD88a, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

181. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511061 (Pseudomonas phage CF125, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

182. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_027992 (Pseudomonas phage JBD25, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

183. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

184. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

185. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

186. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

187. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

188. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KU199707 (Pseudomonas phage JBD16C, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

189. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

190. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

191. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_041851 (Pseudomonas phage F_HA0480sp/Pa1651, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

192. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

193. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511063 (Pseudomonas phage CF177, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

194. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to LT608331 (Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

195. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

196. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

197. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

198. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MH719192 (Pseudomonas phage Ps56, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

199. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to EU272037 (Pseudomonas phage MP38, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

200. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

201. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

202. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

203. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

204. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

205. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

206. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

207. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

208. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to DQ873690 (Phage MP22, complete genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

209. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

210. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 0, identity: 1.0

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacagggtggca	Protospacer
*******************************

211. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to AY394005 (Bacteriophage D3112, complete genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

212. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to JN811560 (Pseudomonas phage JBD26, complete genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

213. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389337 (UNVERIFIED: Pseudomonas phage JBD58a clone contig00002 genomic sequence) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

214. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NC_027298 (Pseudomonas phage LPB1, complate genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

215. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389326 (UNVERIFIED: Pseudomonas phage F_KK2074sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

216. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

217. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NC_005178 (Pseudomonas phage D3112, complete genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

218. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389261 (UNVERIFIED: Pseudomonas phage F_ET2439sp/Pa1651 clone ctg7180000000621 genomic sequence) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

219. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 0, identity: 1.0

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcacgctggatcggatcgactgat	Protospacer
*******************************

220. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK934841 (Pseudomonas phage UMP151, complete genome) position: , mismatch: 1, identity: 0.969

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccatcgggttgcaacgtcgccacggta	Protospacer
******** ***********************

221. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389238 (UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence) position: , mismatch: 1, identity: 0.969

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccatcgggttgcaacgtcgccacggta	Protospacer
******** ***********************

222. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MN096267 (Pseudomonas phage vB_PaS_IME307, complete genome) position: , mismatch: 1, identity: 0.969

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
aaagcatcaagcgcggcgtggaagtgctttat	Protospacer
*.******************************

223. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT887557 (Pseudomonas phage phi1, complete genome) position: , mismatch: 1, identity: 0.969

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
agagcatccagcgcggcgtggaagtgctttat	Protospacer
******** ***********************

224. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MN096267 (Pseudomonas phage vB_PaS_IME307, complete genome) position: , mismatch: 1, identity: 0.969

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggtggaga	Protospacer
**************************.*****

225. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_011373 (Pseudomonas phage PAJU2, complete genome) position: , mismatch: 1, identity: 0.969

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggtggaga	Protospacer
**************************.*****

226. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX403939 (Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome) position: , mismatch: 1, identity: 0.969

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggtggaga	Protospacer
**************************.*****

227. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to AP009624 (Pseudomonas phage PAJU2 DNA, complete genome) position: , mismatch: 1, identity: 0.969

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctccccggcaatagctggggtggaga	Protospacer
**************************.*****

228. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MN096267 (Pseudomonas phage vB_PaS_IME307, complete genome) position: , mismatch: 1, identity: 0.969

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccagctcgctccaatccga	Protospacer
****************.***************

229. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX403939 (Pseudomonas phage YMC/01/01/P52_PAE_BP, complete genome) position: , mismatch: 1, identity: 0.969

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctgtagcttctccagctcgctccaatccga	Protospacer
****************.***************

230. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

231. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

232. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_009818 (Pseudomonas phage MP22, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

233. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acgactgattcgctttgcaggatatttgtcga	Protospacer
***.****************************

234. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

235. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

236. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434033 (Pseudomonas phage JBD88a, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

237. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

238. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

239. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

240. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acgactgattcgctttgcaggatatttgtcga	Protospacer
***.****************************

241. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KU199707 (Pseudomonas phage JBD16C, partial genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

242. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ067085 (Pseudomonas phage PaMx73, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggctgattcgctttgcagaatatttgtcga	Protospacer
********************.***********

243. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

244. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_041851 (Pseudomonas phage F_HA0480sp/Pa1651, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

245. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

246. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LT608331 (Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

247. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acgactgattcgctttgcaggatatttgtcga	Protospacer
***.****************************

248. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

249. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

250. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

251. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

252. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

253. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

254. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

255. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to DQ873690 (Phage MP22, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

256. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 1, identity: 0.969

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcaggatatttgtcga	Protospacer
*****.**************************

257. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcgtagtccaggacg	Protospacer
**** ***************************

258. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 1, identity: 0.969

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcgtagtccaggacg	Protospacer
**** ***************************

259. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 1, identity: 0.969

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcgtagtccaggacg	Protospacer
**** ***************************

260. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 1, identity: 0.969

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcgtagtccaggacg	Protospacer
**** ***************************

261. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 1, identity: 0.969

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcgtagtccaggacg	Protospacer
**** ***************************

262. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389234 (UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00002 genomic sequence) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

263. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719194 (Pseudomonas phage Ps60, complete genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

264. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

265. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

266. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

267. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

268. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

269. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

270. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

271. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

272. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

273. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

274. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

275. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

276. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

277. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 1, identity: 0.969

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcctggagcagttggatatca	Protospacer
**********************.*********

278. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KJ959591 (Pseudomonas phage PAN70, partial genome) position: , mismatch: 1, identity: 0.969

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccagatcgatc	Protospacer
*************************.******

279. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_031091 (Pseudomonas phage MD8, complete genome) position: , mismatch: 1, identity: 0.969

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcactaggtcgatc	Protospacer
**********************.*********

280. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KC862296 (Pseudomonas phage P3_CHA, complete genome) position: , mismatch: 1, identity: 0.969

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
gcatcaaagatattgaaaagcatcaacgacgg	Protospacer
*******************************.

281. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MT118295 (Pseudomonas phage Epa18, complete genome) position: , mismatch: 1, identity: 0.969

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
gcatcaaagatattgaaaagcatcaacgacgg	Protospacer
*******************************.

282. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KC862299 (Pseudomonas phage PAK_P3, complete genome) position: , mismatch: 1, identity: 0.969

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
gcatcaaagatattgaaaagcatcaacgacgg	Protospacer
*******************************.

283. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511008 (Pseudomonas phage CF124, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

284. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511013 (Pseudomonas phage BR161, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

285. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511002 (Pseudomonas phage CF57, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

286. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511009 (Pseudomonas phage CF136, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

287. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511003 (Pseudomonas phage CF65, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

288. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK819239 (Pseudomonas phage vB_PaeP_YA3, complete genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

289. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511005 (Pseudomonas phage CF81, partial genome) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

290. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_023575 (Pseudomonas phage vB_PaeP_Tr60_Ab31) position: , mismatch: 1, identity: 0.969

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgccccagcagcttggcaagctctgggacat	Protospacer
*** ****************************

291. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcactctggatcggatcgactgat	Protospacer
************ *******************

292. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

293. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

294. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

295. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

296. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

297. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggaacgctggatcggatcgactgat	Protospacer
********* **********************

298. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

299. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggaacgctggatcggatcgactgat	Protospacer
********* **********************

300. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcactctggatcggatcgactgat	Protospacer
************ *******************

301. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggaacgctggatcggatcgactgat	Protospacer
********* **********************

302. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

303. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

304. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

305. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

306. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgctggatcggatcgactgat	Protospacer
******.*************************

307. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 1, identity: 0.969

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcactctggatcggatcgactgat	Protospacer
************ *******************

308. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511008 (Pseudomonas phage CF124, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

309. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511013 (Pseudomonas phage BR161, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

310. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511002 (Pseudomonas phage CF57, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

311. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511009 (Pseudomonas phage CF136, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

312. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511003 (Pseudomonas phage CF65, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

313. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK819239 (Pseudomonas phage vB_PaeP_YA3, complete genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

314. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MK511005 (Pseudomonas phage CF81, partial genome) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

315. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NC_023575 (Pseudomonas phage vB_PaeP_Tr60_Ab31) position: , mismatch: 1, identity: 0.968

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cgccccagcagcttggcaagctctgggacat	Protospacer
** ****************************

316. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcactctggatcggatcgactgat	Protospacer
*********** *******************

317. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

318. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

319. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

320. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

321. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

322. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389461 (UNVERIFIED: Pseudomonas phage F_TK432sp/Pa1651 clone ctg7180000000005 genomic sequence) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggaacgctggatcggatcgactgat	Protospacer
******** **********************

323. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

324. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to JX434030 (Pseudomonas phage JBD5, complete genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggaacgctggatcggatcgactgat	Protospacer
******** **********************

325. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcactctggatcggatcgactgat	Protospacer
*********** *******************

326. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389459 (UNVERIFIED: Pseudomonas phage F_ET309sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggaacgctggatcggatcgactgat	Protospacer
******** **********************

327. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

328. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

329. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

330. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

331. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgctggatcggatcgactgat	Protospacer
*****.*************************

332. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 1, identity: 0.968

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcactctggatcggatcgactgat	Protospacer
*********** *******************

333. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719194 (Pseudomonas phage Ps60, complete genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

334. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgaattgcaacgtcgccacggta	Protospacer
***********..*******************

335. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511031 (Pseudomonas phage BR52, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

336. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511034 (Pseudomonas phage BR243, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

337. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511033 (Pseudomonas phage BR205, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

338. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511017 (Pseudomonas phage CF23, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

339. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK144667 (Pseudomonas phage Spike, complete genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

340. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511026 (Pseudomonas phage CF121, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

341. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511022 (Pseudomonas phage CF74, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

342. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511030 (Pseudomonas phage CF213, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

343. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511025 (Pseudomonas phage CF118, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

344. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511023 (Pseudomonas phage CF77, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

345. spacer 1.2|1370|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511029 (Pseudomonas phage CF183, partial genome) position: , mismatch: 2, identity: 0.938

tcggaccagcgggttgcaacgtcgccacggta	CRISPR spacer
tcggaccagcgggtggcgacgtcgccacggta	Protospacer
************** **.**************

346. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

347. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KU130294 (Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

348. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

349. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

350. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

351. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

352. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

353. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

354. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

355. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

356. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

357. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

358. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

359. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

360. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

361. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039294 (Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

362. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

363. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

364. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

365. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

366. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

367. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 2, identity: 0.938

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcctcgatcagggttgttgtggattgcaaaga	Protospacer
** *****************.***********

368. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT887557 (Pseudomonas phage phi1, complete genome) position: , mismatch: 2, identity: 0.938

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtcggtagcttctccagctcgctccaatccga	Protospacer
*** ************.***************

369. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to EU272037 (Pseudomonas phage MP38, complete genome) position: , mismatch: 2, identity: 0.938

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
accgccgattcgctttgcaggatatttgtcga	Protospacer
** **.**************************

370. spacer 1.12|1970|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 2, identity: 0.938

acggctgattcgctttgcaggatatttgtcga	CRISPR spacer
acggccgattcgctttgcagaatatttgtcga	Protospacer
*****.**************.***********

371. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 2, identity: 0.938

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggctgctggagcagctggatatca	Protospacer
**********.* *******************

372. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 2, identity: 0.938

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttcttggagcagttggatatca	Protospacer
*************.********.*********

373. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 2, identity: 0.938

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggctgctggagcagctggatatca	Protospacer
**********.* *******************

374. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389225 (UNVERIFIED: Pseudomonas phage F_MX1987sp/MX560 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcaccagatcgata	Protospacer
*************************.*****

375. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 2, identity: 0.938

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

376. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389229 (UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcaaggcggatcgtatgcaccaggtcgatc	Protospacer
****.******* *******************

377. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 2, identity: 0.938

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

378. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

379. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacggatactgcgacggcggacacggcggca	Protospacer
************************ **.****

380. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

381. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

382. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

383. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

384. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

385. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

386. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggaactgcgacggcggacagggtggca	Protospacer
******. ************************

387. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

388. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 2, identity: 0.938

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
gtacgggtactgcgacggtggacagggtggca	Protospacer
******.***********.*************

389. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

390. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

391. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

392. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

393. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

394. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

395. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

396. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

397. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

398. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 2, identity: 0.938

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaatggcacgttggatcggatcgactgat	Protospacer
******.******.******************

399. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

400. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MH719191 (Pseudomonas phage Fc22, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

401. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacggatactgcgacggcggacacggcggca	Protospacer
*********************** **.****

402. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_006548 (Pseudomonas phage B3, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

403. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MH643777 (Pseudomonas phage YMC12/01/R960, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

404. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to AF232233 (Bacteriophage B3, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

405. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

406. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

407. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511057 (Pseudomonas phage CF5, partial genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

408. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

409. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389464 (UNVERIFIED: Pseudomonas phage JBDs5 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

410. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

411. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MH719189 (Pseudomonas phage Fc02, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

412. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM233689 (Pseudomonas phage H70, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

413. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK934841 (Pseudomonas phage UMP151, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

414. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to KM389238 (UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

415. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

416. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to JX495041 (Pseudomonas phage JBD18, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggaactgcgacggcggacagggtggca	Protospacer
*****. ************************

417. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to EU272036 (Pseudomonas phage MP29, complete genome) position: , mismatch: 2, identity: 0.935

tacggatactgcgacggcggacagggtggca	CRISPR spacer
tacgggtactgcgacggtggacagggtggca	Protospacer
*****.***********.*************

418. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to LN907801 (unidentified phage genome assembly 2P1, chromosome : 2P1) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

419. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to LT999987 (Pseudomonas phage vB_PaeS_PAO1_HW12 genome assembly, complete genome: monopartite) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

420. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389460 (UNVERIFIED: Pseudomonas phage F_MX560sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

421. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389278 (UNVERIFIED: Pseudomonas phage Phi05_1400 B clone contig00006 genomic sequence) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

422. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to MH643778 (Pseudomonas phage YMC12/01/R24, complete genome) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

423. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KM389462 (UNVERIFIED: Pseudomonas phage JBD23 clone contig00001 genomic sequence) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

424. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KT968832 (Pseudomonas phage YMC11/11/R1836, complete genome) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

425. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to KJ477077 (Pseudomonas phage JD024, complete genome) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

426. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NC_023700 (Pseudomonas phage PA1/KOR/2010, complete genome) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

427. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 2, identity: 0.935

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaatggcacgttggatcggatcgactgat	Protospacer
*****.******.******************

428. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_009818 (Pseudomonas phage MP22, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

429. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

430. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

431. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434033 (Pseudomonas phage JBD88a, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

432. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389243 (UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00002 genomic sequence) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

433. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

434. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KU199707 (Pseudomonas phage JBD16C, partial genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

435. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_041851 (Pseudomonas phage F_HA0480sp/Pa1651, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

436. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to LT608331 (Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

437. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

438. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to EU272037 (Pseudomonas phage MP38, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

439. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

440. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

441. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

442. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_024782 (Pseudomonas phage MP48, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

443. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

444. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to DQ873690 (Phage MP22, complete genome) position: , mismatch: 3, identity: 0.906

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tcttgagggtctggtgctcatagtccaggaca	Protospacer
**** **************.***********.

445. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH719191 (Pseudomonas phage Fc22, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

446. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_006548 (Pseudomonas phage B3, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

447. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to AF232233 (Bacteriophage B3, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

448. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511057 (Pseudomonas phage CF5, partial genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

449. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MH719189 (Pseudomonas phage Fc02, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

450. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK934841 (Pseudomonas phage UMP151, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

451. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to KM389238 (UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00002 genomic sequence) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

452. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to JX495041 (Pseudomonas phage JBD18, complete genome) position: , mismatch: 3, identity: 0.906

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
atacgggaactgcgacggcggacagggtggca	Protospacer
.*****. ************************

453. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 5, identity: 0.844

gctcaacggcacgctggatcggatcga--ctgat	CRISPR spacer
gctcaacggcatgctggaccggatcgaggccg--	Protospacer
***********.******.********  *.*

454. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 5, identity: 0.839

ctcaacggcacgctggatcggatcga--ctgat	CRISPR spacer
ctcaacggcatgctggaccggatcgaggccg--	Protospacer
**********.******.********  *.*

455. spacer 1.3|1430|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.812

atgagggcggtacgggtggacgccatgctgtt	CRISPR spacer
agcggggcgggacgggtggacgccatcctgat	Protospacer
*  .****** *************** *** *

456. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK819239 (Pseudomonas phage vB_PaeP_YA3, complete genome) position: , mismatch: 6, identity: 0.812

catgccctccccggcaatagctggggcggaga	CRISPR spacer
cctctcctccccggcaatagctggggagggca	Protospacer
* * .********************* **. *

457. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389237 (UNVERIFIED: Pseudomonas phage F_HA1208sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

458. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719191 (Pseudomonas phage Fc22, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

459. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719195 (Pseudomonas phage Ps59, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

460. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_027992 (Pseudomonas phage JBD25, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

461. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK511057 (Pseudomonas phage CF5, partial genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

462. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719192 (Pseudomonas phage Ps56, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

463. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719190 (Pseudomonas phage H71, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

464. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719189 (Pseudomonas phage Fc02, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

465. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK934841 (Pseudomonas phage UMP151, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

466. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KM389233 (UNVERIFIED: Pseudomonas phage F_TK1727sp/MX560 clone contig00001 genomic sequence) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

467. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MH719193 (Pseudomonas phage H72, complete genome) position: , mismatch: 6, identity: 0.812

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
tccacagggtctggtgctcgtagtcgagcacc	Protospacer
**. .******************** ** **

468. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT887557 (Pseudomonas phage phi1, complete genome) position: , mismatch: 7, identity: 0.781

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccatccccggcaatagctgggtggagag	Protospacer
****** ******************  *....

469. spacer 1.9|1790|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013052 (Sinorhizobium americanum CCGM7 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.781

catgccctccccggcaatagctggggcggaga	CRISPR spacer
catgccctcccctgcaatagatgggacaaatg	Protospacer
************ ******* ****.*..* .

470. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MK524530 (Mycobacterium phage Pharaoh, complete genome) position: , mismatch: 7, identity: 0.781

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
gtctggagcttctccaactcgatccaggcttt	Protospacer
***** *************** ****. *.

471. spacer 1.11|1910|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017242 (Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence) position: , mismatch: 7, identity: 0.781

acgcatggtcaactccgacgaacggctgttgt	CRISPR spacer
agccagtggcaactccgacgaacgcctgtggt	Protospacer
*  **  * *************** **** **

472. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to JQ680365 (Unidentified phage clone 2200_scaffold2278 genomic sequence) position: , mismatch: 7, identity: 0.781

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
ctgtgagggtctggtgctcgtagtcgacgaca	Protospacer
.. * ******************** * ***.

473. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcggcccagcagctcggccagctccgccgcgt	Protospacer
**************.*** *****.*  .*.*

474. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

475. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcacggcgtcggcggacagggtggcg	Protospacer
   ****   .** *** ****************.

476. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

477. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

478. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

479. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

480. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.781

gtacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---cggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ****   .**.*** ****************.

481. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gctcaacggcatgctggaccggatcgaggcgg	Protospacer
***********.******.********   .

482. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.774

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cggcccagcagctcggccagctccgccgcgt	Protospacer
*************.*** *****.*  .*.*

483. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP012699 (Microbacterium sp. No. 7 plasmid B, complete sequence) position: , mismatch: 7, identity: 0.774

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
cggcccagcagctcggccagctcgcgcagct	Protospacer
*************.*** *****  * *  *

484. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

485. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcacggcgtcggcggacagggtggcg	Protospacer
   ***   .** *** ****************.

486. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

487. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

488. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

489. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

490. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.774

tacgga---tactgcgacggcggacagggtggca	CRISPR spacer
---ggacttcaccgcgtcggcggacagggtggcg	Protospacer
   ***   .**.*** ****************.

491. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctcaacggcatgctggaccggatcgaggcgg	Protospacer
**********.******.********   .

492. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021745 (Agarilytica rhodophyticola strain 017 plasmid pSU1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
gtgccagccgttcctgaagcagctgagtttga	Protospacer
 .****** *******.********..* * *

493. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045721 (Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggtttctggaccagcaaggtgata	Protospacer
************.***** **** .*.*. .*

494. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP038854 (Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggtttctggaccagcaaggtgata	Protospacer
************.***** **** .*.*. .*

495. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022517 (Pantoea vagans strain FBS135 plasmid pPant1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggtttctggaccagcaaggtgata	Protospacer
************.***** **** .*.*. .*

496. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

497. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

498. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

499. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

500. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

501. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

502. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017242 (Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence) position: , mismatch: 8, identity: 0.75

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gatcgaggcggagcgaatgcatcaggaacgac	Protospacer
 ************** *****.****   . *

503. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP012699 (Microbacterium sp. No. 7 plasmid B, complete sequence) position: , mismatch: 8, identity: 0.75

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
ccggcccagcagctcggccagctcgcgcagct	Protospacer
 *************.*** *****  * *  *

504. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 8, identity: 0.75

gtacggatactgcgacggcggacagggtggca-	CRISPR spacer
gcacgggtcctgcgacggcggaca-gccgctat	Protospacer
*.****.* *************** * .* .*

505. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 8, identity: 0.75

gtacggatactgcgacggcggacagggtggca-	CRISPR spacer
gcacgggtcctgcgacggcggaca-gccgctat	Protospacer
*.****.* *************** * .* .*

506. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to MN536027 (Pseudomonas phage vB_Pae-SS2019XII, complete genome) position: , mismatch: 8, identity: 0.742

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
gcgcccagcagcttggccagctctgcctgct	Protospacer
  *************** *******     *

507. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.742

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
tcgcacagcaccttggcaagctctggctcga	Protospacer
. ** ***** ***************  *.

508. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 8, identity: 0.742

tacggatactgcgacggcggacagggtggca-	CRISPR spacer
cacgggtcctgcgacggcggaca-gccgctat	Protospacer
.****.* *************** * .* .*

509. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 8, identity: 0.742

tacggatactgcgacggcggacagggtggca-	CRISPR spacer
cacgggtcctgcgacggcggaca-gccgctat	Protospacer
.****.* *************** * .* .*

510. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.742

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ggcaacggcacgctggcgcggatcgtgtgga	Protospacer
  **************  *******  **.

511. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ggcaacggcacgctggcgcggatcgtgtggc	Protospacer
  **************  *******  **..

512. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 8, identity: 0.742

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gtcaacggcacgctggacctgatcatgtact	Protospacer
 ****************.* ****.  *. *

513. spacer 1.1|1310|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

gacaaccagctggctcagccggttgtgctcaa	CRISPR spacer
cagcgccagctggcgcagccggtcgtgcccgg	Protospacer
 *  .********* ********.****.*..

514. spacer 1.3|1430|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

atgagggcggtacgggtggacgccatgctgtt	CRISPR spacer
cgggatacggtacggttggacgccaagctgct	Protospacer
  *.. .******** ********* ****.*

515. spacer 1.13|2030|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NC_024123 (Pseudomonas phage KPP25 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

tctttagggtctggtgctcgtagtccaggacg	CRISPR spacer
cgagacaggtctggtgctcgaagtcgaggacg	Protospacer
.     .************* **** ******

516. spacer 1.15|2150|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgtgttggccgggcgcctggcgtccgcaga	CRISPR spacer
ggcgtggtggccgggcggctggcgcagttggg	Protospacer
****** ********** ******.   ..*.

517. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044991 (Deinococcus sp. AJ005 plasmid p115k, complete sequence) position: , mismatch: 9, identity: 0.719

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
ccgccagcggttccggcagcagcgagaagggg	Protospacer
************** * ****** .** .  .

518. spacer 1.16|2210|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to KT001914 (Caulobacter phage Seuss, complete genome) position: , mismatch: 9, identity: 0.719

ccgccagcggttcctggagcagctggatatca	CRISPR spacer
gagccagaagttcctggagcagctgacggcca	Protospacer
  ***** .****************.  ..**

519. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
tctgctggcggagcgtctgcatcaggtcgagg	Protospacer
. *   ********** ****.********

520. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gttcgaggcggagcggatgcaccgggaacgac	Protospacer
  ************* *******.**   . *

521. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gttcgaggcggagcgaatgcaccgggaacgac	Protospacer
  ************* *******.**   . *

522. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gttcgaggcggagcgaatgcaccgggaacgac	Protospacer
  ************* *******.**   . *

523. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gttcgaggcggagcgaatgcaccgggaacgac	Protospacer
  ************* *******.**   . *

524. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gttcgaggcggagcgaatgcaccgggaacgac	Protospacer
  ************* *******.**   . *

525. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MN693917 (Marine virus AFVG_250M787, complete genome) position: , mismatch: 9, identity: 0.719

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
gcacacgccggagcgtgtgcaccagttcgatt	Protospacer
   *. * ********.******** *****.

526. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MN693532 (Marine virus AFVG_25M340, complete genome) position: , mismatch: 9, identity: 0.719

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
tattccaagatatttaaaagcatcaacagaaa	Protospacer
   ** ******** ************.. .*

527. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MN536027 (Pseudomonas phage vB_Pae-SS2019XII, complete genome) position: , mismatch: 9, identity: 0.719

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
tgcgcccagcagcttggccagctctgcctgct	Protospacer
   *************** *******     *

528. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 9, identity: 0.719

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
ctcgcacagcaccttggcaagctctggctcga	Protospacer
 . ** ***** ***************  *.

529. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_AP018668 (Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence) position: , mismatch: 9, identity: 0.719

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gaagaacggcacgctggggcggatcgagcgcg	Protospacer
*   *************. ******** .*

530. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
cggcaacggcacgctggcgcggatcgtgtgga	Protospacer
   **************  *******  **.

531. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
cggcaacggcacgctggcgcggatcgtgtggc	Protospacer
   **************  *******  **..

532. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 9, identity: 0.719

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
cgtcaacggcacgctggacctgatcatgtact	Protospacer
  ****************.* ****.  *. *

533. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 9, identity: 0.71

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
aatcccagctgcttcgcaagctctggaatcg	Protospacer
 . ****** **** ***********.*.

534. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
aatcccagctgcttcgcaagctctggaatcg	Protospacer
 . ****** **** ***********.*.

535. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
aatcccagctgcttcgcaagctctggaatcg	Protospacer
 . ****** **** ***********.*.

536. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggccgataccgcgacggcggacagggccaag	Protospacer
 .* *****.****************. . .

537. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511042 (Pseudomonas phage CF126, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

538. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

539. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511051 (Pseudomonas phage BR181, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

540. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511041 (Pseudomonas phage CF69, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

541. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511049 (Pseudomonas phage BR326, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

542. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511045 (Pseudomonas phage BR208, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

543. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511044 (Pseudomonas phage BR197, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

544. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511050 (Pseudomonas phage BR150, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

545. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511048 (Pseudomonas phage BR320, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

546. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511046 (Pseudomonas phage BR313, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

547. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511047 (Pseudomonas phage BR319, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

548. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511043 (Pseudomonas phage BR228, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

549. spacer 1.24|2451|31|NZ_ASRD01000188|PILER-CR matches to MK511039 (Pseudomonas phage CF24, partial genome) position: , mismatch: 9, identity: 0.71

tacggatactgcgacggcggacagggtggca	CRISPR spacer
ggcggatactgcgccggcggactggtcgaac	Protospacer
 .*********** ******** ** .*.

550. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 9, identity: 0.71

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
gacaacggcacgctggagcagatcgaggacg	Protospacer
  *************** *.******  .

551. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_AP018668 (Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence) position: , mismatch: 9, identity: 0.71

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
aagaacggcacgctggggcggatcgagcgcg	Protospacer
   *************. ******** .*

552. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 9, identity: 0.71

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
tggaacggcacgccggttcggatcgatcctt	Protospacer
.  **********.** *********..  *

553. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 9, identity: 0.71

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
tggaacggcacgccggttcggatcgatcctt	Protospacer
.  **********.** *********..  *

554. spacer 1.25|2511|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 9, identity: 0.71

ctcaacggcacgctggatcggatcgactgat	CRISPR spacer
atggacggcacagtggatcggatcgacgtcg	Protospacer
 * .*******. **************

555. spacer 1.4|1490|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028970 (Aminobacter sp. MSH1 plasmid pUSP2, complete sequence) position: , mismatch: 10, identity: 0.688

ggcaggacgcgctgtcctacgcccaacgtgaa	CRISPR spacer
tgcagcacgcgctgtccgacgcccgcatcgtc	Protospacer
 **** *********** ******.   .*

556. spacer 1.5|1550|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to MN783747 (Klebsiella oxytoca plasmid pIron_OXY, complete sequence) position: , mismatch: 10, identity: 0.688

ttcccgcctgatatgtacctaatgttcatatt	CRISPR spacer
tatccgcctgaaatgttcctaatgttttcccg	Protospacer
* .******** **** *********. . .

557. spacer 1.6|1610|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP018284 (Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome) position: , mismatch: 10, identity: 0.688

tcgtcgatcagggttgttgtagattgcaaaga	CRISPR spacer
tcgtctatcagagttgttgtagaacatcccaa	Protospacer
***** *****.*********** ...   .*

558. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
gcgccatcaagcgcgacgtggaagcgctgatg	Protospacer
. . ***********.********.***

559. spacer 1.8|1730|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 10, identity: 0.688

agagcatcaagcgcggcgtggaagtgctttat	CRISPR spacer
aatacatcgagcgcggcgtggaggtgccggcg	Protospacer
*. .****.*************.****.

560. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 10, identity: 0.688

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
acgtcgcgcttctcgaactcgctccattcctg	Protospacer
.. *   ******* *********** *** .

561. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 10, identity: 0.688

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
acgtcgcgcttctcgaactcgctccattcctg	Protospacer
.. *   ******* *********** *** .

562. spacer 1.10|1850|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018821 (Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence) position: , mismatch: 10, identity: 0.688

gtctgtagcttctccaactcgctccaatccga	CRISPR spacer
acgtcgcgcttctcgaactcgctccattcctg	Protospacer
.. *   ******* *********** *** .

563. spacer 1.14|2090|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016890 (Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gactttgcgccgcctggttcggtcctggtgct	CRISPR spacer
tcaatgaaaccgcctggtttggtgctggtgct	Protospacer
    * . .**********.*** ********

564. spacer 1.14|2090|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045721 (Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gactttgcgccgcctggttcggtcctggtgct	CRISPR spacer
tcaatgaaaccgcctggtttggtgctggtgct	Protospacer
    * . .**********.*** ********

565. spacer 1.14|2090|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034149 (Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence) position: , mismatch: 10, identity: 0.688

gactttgcgccgcctggttcggtcctggtgct	CRISPR spacer
tcaatgaaaccgcctggtttggtgctggtgct	Protospacer
    * . .**********.*** ********

566. spacer 1.14|2090|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031650 (Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gactttgcgccgcctggttcggtcctggtgct	CRISPR spacer
tcaatgaaaccgcctggtttggtgctggtgct	Protospacer
    * . .**********.*** ********

567. spacer 1.14|2090|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022517 (Pantoea vagans strain FBS135 plasmid pPant1, complete sequence) position: , mismatch: 10, identity: 0.688

gactttgcgccgcctggttcggtcctggtgct	CRISPR spacer
tcaatgaaaccgcctggtttggtgctggtgct	Protospacer
    * . .**********.*** ********

568. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MN694153 (Marine virus AFVG_250M457, complete genome) position: , mismatch: 10, identity: 0.688

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
agttccaagatatttaaaagcatcaacagaac	Protospacer
.  ** ******** ************.. .

569. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP032528 (Bacillus megaterium NCT-2 plasmid pNCT2_1, complete sequence) position: , mismatch: 10, identity: 0.688

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
gtcaaaaatatattgaaaagcatcatcgcaat	Protospacer
*.   *** **************** **  .

570. spacer 1.19|2330|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MN693930 (Marine virus AFVG_250M489, complete genome) position: , mismatch: 10, identity: 0.688

gcatcaaagatattgaaaagcatcaacgacga	CRISPR spacer
agttccaagatatttaaaagcatcaaatgaaa	Protospacer
.  ** ******** ***********  . .*

571. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 10, identity: 0.688

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
caatcccagctgcttcgcaagctctggaatcg	Protospacer
  . ****** **** ***********.*.

572. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP011506 (Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence) position: , mismatch: 10, identity: 0.688

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
gtcaagcagcagtatggcaagctctgggaagc	Protospacer
*. .  ******. *************** ..

573. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
caatcccagctgcttcgcaagctctggaatcg	Protospacer
  . ****** **** ***********.*.

574. spacer 1.20|2390|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gcggcccagcagcttggcaagctctgggacat	CRISPR spacer
caatcccagctgcttcgcaagctctggaatcg	Protospacer
  . ****** **** ***********.*.

575. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511042 (Pseudomonas phage CF126, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

576. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

577. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511051 (Pseudomonas phage BR181, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

578. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511041 (Pseudomonas phage CF69, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

579. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511049 (Pseudomonas phage BR326, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

580. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511045 (Pseudomonas phage BR208, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

581. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511044 (Pseudomonas phage BR197, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

582. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511050 (Pseudomonas phage BR150, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

583. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511048 (Pseudomonas phage BR320, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

584. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511046 (Pseudomonas phage BR313, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

585. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511047 (Pseudomonas phage BR319, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

586. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511043 (Pseudomonas phage BR228, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

587. spacer 1.21|2450|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to MK511039 (Pseudomonas phage CF24, partial genome) position: , mismatch: 10, identity: 0.688

gtacggatactgcgacggcggacagggtggca	CRISPR spacer
tggcggatactgcgccggcggactggtcgaac	Protospacer
  .*********** ******** ** .*.

588. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 10, identity: 0.688

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
cgacaacggcacgctggagcagatcgaggacg	Protospacer
   *************** *.******  .

589. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 10, identity: 0.688

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctggaacggcacgccggttcggatcgatcctt	Protospacer
 .  **********.** *********..  *

590. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 10, identity: 0.688

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
ctggaacggcacgccggttcggatcgatcctt	Protospacer
 .  **********.** *********..  *

591. spacer 1.22|2510|32|NZ_ASRD01000188|CRISPRCasFinder,CRT matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 10, identity: 0.688

gctcaacggcacgctggatcggatcgactgat	CRISPR spacer
catggacggcacagtggatcggatcgacgtcg	Protospacer
  * .*******. **************

592. spacer 1.23|2391|31|NZ_ASRD01000188|PILER-CR matches to NZ_CP011506 (Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence) position: , mismatch: 10, identity: 0.677

cggcccagcagcttggcaagctctgggacat	CRISPR spacer
tcaagcagcagtatggcaagctctgggaagc	Protospacer
. .  ******. *************** ..

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_ASRD01000017

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000017_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000017_1

41462-41564

Orphan

Consensus_repeat	Method
GGCGTTATCCGCCGATACCCCGCCGC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_ASRD01000017_1

>merge|NZ_ASRD01000017|1|41462-41564|CRISPRCasFinder
GGCGTTATCCGCCGATACCCCGCCGCAACGGCGGAGCGAAAGCTGGGAACCCTCCGCGTAGGGCGAATAACGCCGGAGGCGTTATCCGCCGATACCCGCCGCG

>NZ_ASRD01000017|1|1|41462-41564|CRISPRCasFinder
GGCGTTATCCGCCGATACCCCGCCGC	AACGGCGGAGCGAAAGCTGGGAACCCTCCGCGTAGGGCGAATAACGCCGGA
GGCGTTATCCGCCGATACCCGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000017.1\|WP_003109184.1\|37787_39620_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_ASRD01000017.1\|WP_003452840.1\|46544_47402_-\|glycine-betaine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270357
NZ_ASRD01000017.1\|WP_003091540.1\|39901_40168_+\|DUF2790-domain-containing-protein	unknown	unknown	gnl\|CDD\|371321
NZ_ASRD01000017.1\|WP_003119696.1\|42474_44274_-\|cyclic-nucleotide-binding/CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_ASRD01000017.1\|WP_003114812.1\|37161_37725_+\|peptidylprolyl-isomerase-A	unknown	unknown	gnl\|CDD\|182824
NZ_ASRD01000017.1\|WP_003109191.1\|32762_33098_+\|tRNA-binding-protein	unknown	unknown	gnl\|CDD\|182232
NZ_ASRD01000017.1\|WP_003091546.1\|44363_46019_-\|cation-acetate-symporter	unknown	unknown	gnl\|CDD\|236495
NZ_ASRD01000017.1\|WP_023117706.1\|40200_41325_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225688
NZ_ASRD01000017.1\|WP_003091534.1\|35416_36346_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_ASRD01000017.1\|WP_003109182.1\|41584_41743_-\|DUF3309-domain-containing-protein	unknown	unknown	gnl\|CDD\|378708
NZ_ASRD01000017.1\|WP_003162234.1\|33107_34007_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|307170
NZ_ASRD01000017.1\|WP_003091533.1\|34899_35217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000017.1\|WP_003114814.1\|34111_34753_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|224103
NZ_ASRD01000017.1\|WP_003114806.1\|49424_50228_+\|VacJ-family-lipoprotein	unknown	unknown	gnl\|CDD\|225409
NZ_ASRD01000017.1\|WP_003114807.1\|48059_49421_+\|alpha/beta-fold-hydrolase	unknown	unknown	unknown
NZ_ASRD01000017.1\|WP_017002559.1\|41851_42478_-\|3'-5'-exonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236391
NZ_ASRD01000017.1\|WP_003091551.1\|47695_47917_+\|DUF2061-domain-containing-protein	unknown	unknown	gnl\|CDD\|225746
NZ_ASRD01000017.1\|WP_003116397.1\|50368_51226_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_ASRD01000017.1\|WP_003114813.1\|36352_37180_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_ASRD01000017.1\|WP_003091547.1\|46015_46327_-\|DUF485-domain-containing-protein	unknown	unknown	gnl\|CDD\|225704

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000017.1\|WP_003109184.1\|37787_39620_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.066e-156
NZ_ASRD01000017.1\|WP_003452840.1\|46544_47402_-\|glycine-betaine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270357	cd13639, PBP2_OpuAC_like, Substrate binding domain of Lactococcus lactis ABC-type transporter OpuA and related proteins; the type 2 periplasmic binding protein fold. This subfamily is part of a high affinity multicomponent binding-protein-dependent transport system specific to betaine compounds for osmoregulation. The periplasmic substrate-binding domain, which is often fused to the permease component of the ATP-binding cassette transporter complex, is involved in uptake of osmoprotectants (also termed compatible solutes) such as glycine betaine and proline betaine. Many microorganisms accumulate these compatible solutes in response to high osmolarity to offset the loss of cell water. This domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.55277e-117
NZ_ASRD01000017.1\|WP_003091540.1\|39901_40168_+\|DUF2790-domain-containing-protein	gnl\|CDD\|371321	pfam10976, DUF2790, Protein of unknown function (DUF2790). This family of proteins with unknown function appear to be restricted to Pseudomonadaceae.	1.53651e-35
NZ_ASRD01000017.1\|WP_003119696.1\|42474_44274_-\|cyclic-nucleotide-binding/CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	0
NZ_ASRD01000017.1\|WP_003114812.1\|37161_37725_+\|peptidylprolyl-isomerase-A	gnl\|CDD\|182824	PRK10903, PRK10903, peptidylprolyl isomerase A.	5.29669e-93
NZ_ASRD01000017.1\|WP_003109191.1\|32762_33098_+\|tRNA-binding-protein	gnl\|CDD\|182232	PRK10089, PRK10089, chaperone CsaA.	1.70058e-64
NZ_ASRD01000017.1\|WP_003091546.1\|44363_46019_-\|cation-acetate-symporter	gnl\|CDD\|236495	PRK09395, actP, cation/acetate symporter ActP.	0
NZ_ASRD01000017.1\|WP_023117706.1\|40200_41325_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225688	COG3146, COG3146, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_ASRD01000017.1\|WP_003091534.1\|35416_36346_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.24343e-39
NZ_ASRD01000017.1\|WP_003109182.1\|41584_41743_-\|DUF3309-domain-containing-protein	gnl\|CDD\|378708	pfam11752, DUF3309, Protein of unknown function (DUF3309). This family is conserved in bacteria but its function is not known.	2.8739e-06
NZ_ASRD01000017.1\|WP_003162234.1\|33107_34007_+\|DMT-family-transporter	gnl\|CDD\|307170	pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Members of this family usually carry 5+5 transmembrane domains, and this domain attempts to model five of these.	1.35929e-12
NZ_ASRD01000017.1\|WP_003114814.1\|34111_34753_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|224103	COG1182, AcpD, Acyl carrier protein phosphodiesterase [Lipid metabolism].	1.18979e-103
NZ_ASRD01000017.1\|WP_003114806.1\|49424_50228_+\|VacJ-family-lipoprotein	gnl\|CDD\|225409	COG2853, VacJ, Surface lipoprotein [Cell envelope biogenesis, outer membrane].	6.05055e-101
NZ_ASRD01000017.1\|WP_017002559.1\|41851_42478_-\|3'-5'-exonuclease	gnl\|CDD\|236391	PRK09145, PRK09145, 3'-5' exonuclease.	1.27163e-93
NZ_ASRD01000017.1\|WP_003091551.1\|47695_47917_+\|DUF2061-domain-containing-protein	gnl\|CDD\|225746	COG3205, COG3205, Predicted membrane protein [Function unknown].	8.76037e-33
NZ_ASRD01000017.1\|WP_003116397.1\|50368_51226_+\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	1.4231e-96
NZ_ASRD01000017.1\|WP_003114813.1\|36352_37180_+\|alpha/beta-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	9.99012e-42
NZ_ASRD01000017.1\|WP_003091547.1\|46015_46327_-\|DUF485-domain-containing-protein	gnl\|CDD\|225704	COG3162, COG3162, Predicted membrane protein [Function unknown].	2.28294e-48

>NZ_ASRD01000017.1|WP_023117706.1|40200_41325_-|GNAT-family-N-acetyltransferase
MPIQTLATLADIDAAEWDALLPPAQPFLRHAFLSALEDSHSVTPATGWRPAHRVLRDPQGRLCAALPAYVKAHSYGEYVFDWSWADACQRAGIRYYPKLLVGVPFTPVAGARLLGEDEGLQGLLASLGEEAEASGLSSIHVNFTDARADTLLAARDGWLERLGCQYHWHNRGYRDFQDFLEALSSRKRKQLRKEREQVGGQGIEFEWREGGQLSELEWDFVYLCYANTYLVRDRDPYLSREFFGLLAERMPEAIRVVFAHQRGKPVAMAFSLVAGDTLYGRYWGCLAEFDRLHFETCFYQGLEFAIGAGLVRFDAGAQGEHKLIRGFEPVLTRSWHYLAHPGLRDAVAQFLEQERAGVRAYAEEAHGLLPYRQA
>NZ_ASRD01000017.1|WP_003091540.1|39901_40168_+|DUF2790-domain-containing-protein
MKLASVVSAVITSLAPMAFAQDVDKDPGRGLPVEEYHYGMQLDVKNVLHRTDNSTRTGVVPVTVVYEDHSGELHKIRFLEWGGSTSNG
>NZ_ASRD01000017.1|WP_003109184.1|37787_39620_+|ABC-transporter-ATP-binding-protein
MLYRRFERLIDPFRSASERMPPSEVLRFYVYFLRQVWPVFLALLVVGLIVALIEVALFSYLGRIVDLAQSTPSAEFFRVHANELIWMAVVALVLRPLFNALHDMLVHQSINPSMTNLIRWQNHRYVLKQSLGFFQNDFAGRIAQRIMQTGNSLRDSAVQVVDALWHVLIYTVSALVLFAEADWRLMIPLVLWVFAYVGALAYFVPQVKRRSVEASDSRSKLMGRIVDGYTNITTLKLFAHTRQEEDYAREAIGDQTLKSQRAGRVVTSMDVTITVMNGVLITGTTGLALWLWSQELISVGAIALATGLVIRINNMSGWIMWVVGGIFENIGQVQDGMQTIALPRKVVDREDAQPLRVERGEVEFEHIAFHYGKGSGVIQGLDLKVRPGEKIGLVGPSGAGKSTLVNLLLRLYDLESGRILVDGQDIAGVTQESLRAQIGMVTQDTSLLHRSIRDNLLYGRPGASDAELMEAVRKARADEFIPLLSDAEGRRGFDAHVGERGVKLSGGQRQRIAIARVLLKDAPILILDEATSALDSEVESAIQESLETLMQGKTVIAIAHRLSTIARMDRLVVLDKGHIAESGTHAELLAHGGLYARLWQHQTGGFVGVD
>NZ_ASRD01000017.1|WP_003114812.1|37161_37725_+|peptidylprolyl-isomerase-A
MLKRLLIAACTLLFAGSLLAATPAAKPHVLIATSLGEIEVELDPAKAPISVKNFLEYVDSGYYDGTLFHRVIPGFMVQTGGFSAGMQEKKTRAPIKNEADNGLLNERGTLAMARTGVVDSATSQFFINLTDNDFLNHGARDFGYAVFGKVVRGMGVVDQIAKVPTTRRNGFADVPSDDVVILSAKRL
>NZ_ASRD01000017.1|WP_003114813.1|36352_37180_+|alpha/beta-hydrolase
MPDFQHRDCTLVYDDHPGPTERAPVLLLHGLGSSARDWEYQLPALLGRYRLLVPDLRGHGRSGKPRGGYSMAGFAEDCAALLDRLGCGPVHLVGISMGGMIGFQLACDRPDLLRSLTIVNSTPEVIPRKPREHLEVAKRKLLSRLLSLRTIGRALGRLLFPKAEQAGLREKIEARWAENDKRAYLASLDAIIGWGVQERLAEIACPTLVISADRDYTPVSLKQAYCERIADARLVVVEDSRHATPMDQPEIFNTTLLGFLADIDKTKEQPCSNVS
>NZ_ASRD01000017.1|WP_003091534.1|35416_36346_+|LysR-family-transcriptional-regulator
MKAPRVTLDQWRTLQAVVDHGGFAQAAEALHRSQSSISYTVARMQEQLGVPLLRIDGRKAVLTEAGEVLLRRSRQLVKQAGQLEELAHHMEQGWEPEVRLVVDAAYPTARIVRSLSAFMPQSRGCRVLLREEVLSGVEEALIQGAADLAISGLIIPGHLGADLSVVEFVAVAHPDHPLHRLQRELTHQDLETQMQVVIRDSGRLQPRDHGWLGAEQRWTVGSLATAATFVGNGLGFAWLPRHIIERELQSGQLKPLPLSQGGVRQSRFYLYTNKEKPLGPASQILMEMLKSFANVPLNAPFAAPEPAAE
>NZ_ASRD01000017.1|WP_003091533.1|34899_35217_-|hypothetical-protein
MKRLCCFALSLLPLSAFAYPIEVDPQLNGTEVSYSTQDIGRDMGAILLTNLGGQAAECTAVFRNGPETPKVRKGVIQPGQNSNFTAQFGRDIIKLRIKLTCKIAK
>NZ_ASRD01000017.1|WP_003114814.1|34111_34753_-|FMN-dependent-NADH-azoreductase
MSRVLVIESSARQRGSVSRLLTAEFISHWKIAHPADRFQVRDLAREPLPHLDELLLGAWTTPCDGHSAAERRALERSNRLTEELRMADVLVLAAPMYNFAIPSSLKSWFDHVLRAGLTFRYAEQGPEGLLQGKRAFVLTARGGIYAGGGLDHQEPYLRQVLGFVGIHDVTFIHAEGMNMGPEFREKGLARARERMRQALETDTSLCVPLPTLR
>NZ_ASRD01000017.1|WP_003162234.1|33107_34007_+|DMT-family-transporter
MNRRSALAALHGGALLFGLTGVFGKLASASPGVIVFGRALFAVLALGLFARLAGQAWRALGPAQWLRLALCGLLLAGHWVSFFIAVKTAGVAIATLGFASFPAFTVILEGLLFRERIHLAEGLLVVLVSLGLVLVTPNFDLASSATLGLLWAILSGLLFALLSLANRSNSGQVGPVQAALWQNLVVALCLLPFAVGELPALPALDWLWLALLGVFCTGLAHSLFVASLAVVKARTAALVFALEPVYGIAFAWLLFHETPGPRMFLGGALIILAIVLSARLGARGRKTAVGDERGDPERA
>NZ_ASRD01000017.1|WP_003109191.1|32762_33098_+|tRNA-binding-protein
MDIIEWQDFERVELRVGTILSAAPNPKARKPAYVLEVDLGPLGLRTSSAQLTAHYQAEQLVGRQVLCVCNFAPKQIAGVRSEVLVTGVYDSEDKVVLAGFDKPLPNGARLA
>NZ_ASRD01000017.1|WP_003109182.1|41584_41743_-|DUF3309-domain-containing-protein
MSLGTILLIILILLLIGGLPVFPHSRNWGYGPSGIIGALLVVLLVLLLLGMI
>NZ_ASRD01000017.1|WP_017002559.1|41851_42478_-|3'-5'-exonuclease
MNTMVKLPDSRWPGWRRRLYWWMHEAVEAEEVISLDLETTSLDPRRADILSIGAVLVRRGKLVMGERLELYVEPPPSLDAESIRIHKLRRADLEGQLQLEQALRLVLAFIGDRPLLGYYLSFDVAVLNRHLRQLLDRQLHNPSIEISSLYHRKVSRHFPDAHIDLRFDTLARALDVPVSGRHTALGDAQAVALMFMRLLKGPAPKVIH
>NZ_ASRD01000017.1|WP_003119696.1|42474_44274_-|cyclic-nucleotide-binding/CBS-domain-containing-protein
MPDSFNFASPPFDQLRPHQRETLKQALSVGYYAPGETLLEAGSAVPGLFVLLKGVVEERGDDGRVFAQYAADDLFDVRGLFSGSSKHRYLAIEESIVYELPASCFHQLCGENPGFARFFQADLAAKRQLAQRDGQNLAEFILTRIAREHLLPALEVEASLSLGDAARLQLSHGADALLVRLERDGPELGIVTRTDLMSAHFRDGRSELEAIGPLAHGPLASVELGDFLFDAMILMTRQRIERVAVTEDGQVIGLLHLTQVLSLFSTHSHVLALRIARADDLGDLRRCAETLDTLIATLAGNGIRLRFIMQLVSALNEQLLERLFELLLPPTLRGRCCLLVMGSEGRGEQLLKTDQDNALVLADDLPQEQALAMMQRFSAALLEFGYPPCPGGVMASRPEWCKPLVAWQAELRGTLLEGKPEQLLRLSILADAWPVAGNLQLFEPLRRQLRGFADGGERWLADIAAAALQFDTPLTFLGQLKTQDARLDLKRGGIFPIVHGIRTLALREGLETRGTLARIEALKRHKVLEARLADDLSESFELFLQLRLTRQLAGQRDGRQQGLDVSGMSRHDRDMLRYGLHVVKKFKQSVARQFHLETR
>NZ_ASRD01000017.1|WP_003091546.1|44363_46019_-|cation-acetate-symporter
MIARLLAALGLAAFAPALWADALTGDVQRQPLNVSAIVMFVAFVGATLCITYWASKRNRSAADYYAAGGRITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIILFLIAERLRNLGKYTFADVASYRLKQKQIRTLSACGSLVVVAFYLIAQMVGAGKLIELLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVLLLSGASFMAIMVLKHVNFDVSTLFSEAIKVHPKGEAIMSPGGLVKDPISAFSLGFALMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSTNPDFKDATGALIGGNNMAAVHLADAVGGSLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVFKGGKANEKDELRVSKMTTVALGVVAIVLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMIGGWMGLITAVGLMVLGPTIWVQILGHEKAIYPYEYPALFSMIVAFVGIWFFSITDKSAAADEERARFFPQFIRSQTGLGASGAVAH
>NZ_ASRD01000017.1|WP_003091547.1|46015_46327_-|DUF485-domain-containing-protein
MNDSIYQRIDTNPRFKELVAKRERFAWILSSIMLGLYVIFILLIAFQPQLLGARISPDSSVTWGIPMGVGLILAAFILTGLYVRRANGEFDSLNQEILKEAQQ
>NZ_ASRD01000017.1|WP_003452840.1|46544_47402_-|glycine-betaine-ABC-transporter-substrate-binding-protein
MRMMRRLLCWSAGLAMSAAVGMAAAADKPVITIGYVDGWSDSVATTHVAAEVIREKLGYEVKLMPVAAGIMWQGVARGKLDAMLSAWLPGTHGAYYEKMKDKVVNLAINYPDARIGLIVPEYVSANSIADLQAQKDAFGGRVVGIDAGAGVMIKTDEAIKQYGLDYKLVASSGSGMIAELTRAENEKKPVVVTGWIPHWMFAKWKLKFLDDPKKVYGDTEHVDTVANPALEAKAKPVWEFLKKFGWRDGNEVGQVMLAIQEGAKPEDAAKQWVAANPGRVKDWVQ
>NZ_ASRD01000017.1|WP_003091551.1|47695_47917_+|DUF2061-domain-containing-protein
MLKTLTFTVMHFIIAFSVAYALTGSIAVGGLVAAVEPLCNSVGFYFHEKIWKRFEKDGAPRPASAHGWLHRHA
>NZ_ASRD01000017.1|WP_003114807.1|48059_49421_+|alpha/beta-fold-hydrolase
MPHFLRFAALLGGLALGCANLAQARDVDAASYGYPLTNPFEATIATTPPELRPELPHSEDIDQKDYSLKLRPEREFALPDNFWPVKKLRYRLARQDHAAPLIFIIAGTGAHYASSFPEYLKKLFYQAGYHVVQLSSPTSWDFMASASRFATPGFSSDDADDLYRVMQAVRAQQRDLPVTDYYLTGYSLGALNAAFVSHLDESRRSFNFKKVLLLNPPVNLYTSVSNLDKLVETQVKGITDSRTFYEVVLSKLTRYFRQKGYVDINDAMLYDFQQSKQRLSNEEMAMLIGTSFRFSAADIAFTSDLVNRRGLITPPNYPINEGTSLEPFFKRALQCDFECYMTEQLIPMWRARYDGGSLTQLVNQVSLYKLQDYLHDSPKIAVMHNADDVILGPGDLGFLRRTFGERLTVYPYGGHCGNLNYKVNAQDMLDFFATPAAGQTQVASAALTQQAGN
>NZ_ASRD01000017.1|WP_003114806.1|49424_50228_+|VacJ-family-lipoprotein
MSRTAHWMFALLLSAAASAQADEAAAPAELPPRQLDGDGFSRPLDQLKFNPGLDQREFERATLDALNMYDPWESWNRRVYHFNYRFDEWVFLPVVRGYEYVTPHFVRSGVSNFFDNLGDVPNLLNNLAQLKGKAAMETTARLLFNTTFGVLGLWDPATRMGLHKRSEDFGQTLGFYGVGSGPYLVLPILGPSNLRDTGGLVVDYVGEYQVNYLNVPQASGDHPEITALRVVDKRYNTSFRYGQMNSPFEYEKLRYIYTEARKLQIAE
>NZ_ASRD01000017.1|WP_003116397.1|50368_51226_+|pirin-family-protein
MTRYRDVLELHTGHPASDGAGVRLTRVIGGPSPERFDPFLMLDQFDTQNPDDYVAGFPSHPHRGFETVTYMLEGRMRHEDHLGNRGLLKPGGVQWMTAAHGIIHSEMPEQVEGAMRGFQLWVNLPAKNKLAPAGYRDIEPEDVPRLETAGGVKVTVIAGRFDDGQAQQIGAVERPDTEPHYYDLQLPAGGRIAPRLPDGHRVLLYVYEGSLTVEGERPVEIATNRLARLSEEGELSLRSEAGARVLVLAGKPLREPIVQYGPFVMNSREEIEQALRDYRDGVLAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_ASRD01000017_1	1.1\|41488\|51\|NZ_ASRD01000017\|CRISPRCasFinder	41488-41538	51	NZ_CP042268	Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence	63791-63841	0	1.0

1. spacer 1.1|41488|51|NZ_ASRD01000017|CRISPRCasFinder matches to NZ_CP042268 (Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence) position: , mismatch: 0, identity: 1.0

aacggcggagcgaaagctgggaaccctccgcgtagggcgaataacgccgga	CRISPR spacer
aacggcggagcgaaagctgggaaccctccgcgtagggcgaataacgccgga	Protospacer
***************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_ASRD01000072

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21992 : 56991

Pseudomonas_phage(60.0%)

capsid,integrase,tRNA,coat

attL 18272:18331|attR 29955:30036

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
18272:18331	attL	NA	NA	NA	NA
WP_033992920.1\|21992_22283_+	DUF5447 family protein	Q56VP7	Pseudomonas_phage	8.7e-56	97.9
WP_038819936.1\|22286_22619_+	hypothetical protein	Q56VP6	Pseudomonas_phage	4.7e-37	95.5
WP_038819937.1\|22820_23255_+	hypothetical protein	Q56VP5	Pseudomonas_phage	3.5e-61	97.9
WP_003115130.1\|23271_23364_+	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
WP_038819938.1\|23376_23628_+	hypothetical protein	NA	NA	NA	NA
WP_034008539.1\|23640_23889_+\|capsid	phage capsid protein	Q56VP2	Pseudomonas_phage	5.7e-32	90.2
WP_079276264.1\|24024_25278_+	attachment protein	Q56VP1	Pseudomonas_phage	8.7e-60	57.8
WP_038819941.1\|25282_25639_+	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	3.0e-58	99.2
WP_038819942.1\|25642_26917_+	hypothetical protein	Q56VN9	Pseudomonas_phage	3.9e-201	88.2
WP_004352686.1\|27146_28439_+	hypothetical protein	Q56VN8	Pseudomonas_phage	1.8e-241	92.3
WP_023116767.1\|28435_29443_+\|integrase	tyrosine-type recombinase/integrase	F1BUS9	Erwinia_phage	4.8e-77	47.1
WP_023116766.1\|29489_29927_+	hypothetical protein	NA	NA	NA	NA
WP_003099270.1\|30246_31347_-	redox-regulated ATPase YchF	NA	NA	NA	NA
29955:30036	attR	NA	NA	NA	NA
WP_003099278.1\|31387_31972_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_003099279.1\|32013_32628_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_003099281.1\|32744_33686_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	4.5e-45	37.6
WP_003099284.1\|33852_34701_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003095005.1\|34702_35320_-	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_004347799.1\|35324_37097_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003095001.1\|37240_38509_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003099290.1\|38526_39609_+	peptide chain release factor 1	B5LLF2	Mycobacterium_phage	3.3e-07	49.2
WP_003121049.1\|39610_40441_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003099296.1\|40434_41193_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_003117431.1\|41182_41980_+	glutamate racemase	NA	NA	NA	NA
WP_003099307.1\|42113_42635_+	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	1.4e-59	69.8
WP_003121048.1\|42760_44206_-	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	1.8e-45	27.8
WP_003094990.1\|44202_45102_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	8.5e-17	39.1
WP_003099314.1\|45111_46068_-	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_003094987.1\|46220_47204_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023111870.1\|47617_48535_+	TIGR01777 family protein	NA	NA	NA	NA
WP_034020402.1\|48531_49554_+	ferrochelatase	NA	NA	NA	NA
WP_003099328.1\|49833_51207_+	MFS transporter	NA	NA	NA	NA
WP_003099330.1\|51208_52156_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_034020400.1\|52152_54525_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_003114703.1\|54541_55330_-	molecular chaperone	NA	NA	NA	NA
WP_004355220.1\|55348_55891_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_033940940.1\|55890_56424_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003117437.1\|56442_56991_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_ASRD01000186

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000186_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000186_1

5244-5357

Orphan

Consensus_repeat	Method
CCGCTGCGCCGGCGTTTCATGGCGGATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ASRD01000186_1

>merge|NZ_ASRD01000186|1|5244-5357|CRISPRCasFinder
CCGCTGCGCCGGCGTTTCATGGCGGATATGCGTCCCGCGGCCCCGTAGTCGGGCCGTAGGGCGAATAACGCCACCGGCGTTATCCGCCGCTGCGCCGACGTTTCATGGCGGATA

>NZ_ASRD01000186|1|1|5244-5357|CRISPRCasFinder
CCGCTGCGCCGGCGTTTCATGGCGGATA	TGCGTCCCGCGGCCCCGTAGTCGGGCCGTAGGGCGAATAACGCCACCGGCGTTATCCG
CCGCTGCGCCGACGTTTCATGGCGGATA

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000186.1\|WP_003118953.1\|4590_5238_+\|pyridoxamine-5'-phosphate-oxidase	gnl\|CDD\|223337	COG0259, PdxH, Pyridoxamine-phosphate oxidase [Coenzyme metabolism].	2.00814e-99
NZ_ASRD01000186.1\|WP_003118954.1\|1834_3718_+\|phenazine-specific-anthranilate-synthase-component-I	gnl\|CDD\|223225	COG0147, TrpE, Anthranilate/para-aminobenzoate synthases component I [Amino acid transport and metabolism / Coenzyme metabolism].	2.4585e-82
NZ_ASRD01000186.1\|WP_038820267.1\|3731_4568_+\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|334973	pfam02567, PhzC-PhzF, Phenazine biosynthesis-like protein. PhzC/PhzF is involved in dimerization of two 2,3-dihydro-3-oxo-anthranilic acid molecules to create PCA by P. fluorescens. This family also contains uncharacterized Mycobacterial proteins, though there is no significant sequence similarity to pfam00303 members. This family appears to be distantly related to pfam01678, including containing a weak internal duplication. However members of this family do not contain the conserved cysteines that are hypothesized to be active site residues (Bateman A pers obs).	9.13576e-111
NZ_ASRD01000186.1\|WP_003093625.1\|1214_1838_+\|isochorismatase-family-protein	gnl\|CDD\|238495	cd01013, isochorismatase, Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase, catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of a vinyl ether, an uncommon reaction in biological systems. Isochorismatase is part of the phenazine biosynthesis pathway. Phenazines are antimicrobial compounds that provide the competitive advantage for certain bacteria.	8.51915e-130
NZ_ASRD01000186.1\|WP_003093621.1\|0_1218_+\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|225741	COG3200, AroG, 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism].	0

>NZ_ASRD01000186.1|WP_003118953.1|4590_5238_+|pyridoxamine-5'-phosphate-oxidase
MMGVNANISESLTGTIEAPFPEFEAPPANPMEVLRNWLERARRYGVREPRALALATVDGQGRPSTRIVVIAELGERGVVFATHADSQKGRELAQNPWASGVLYWRESSQQIILNGRAERLPDERADAQWLSRPYQTHPMSIASRQSETLADIHALRAEARRLAETDGPLPRPPGYCLFELCLESVEFWGNGTERLHERLRYDRDEGGWKHRYLQP
>NZ_ASRD01000186.1|WP_038820267.1|3731_4568_+|PhzF-family-phenazine-biosynthesis-protein
MHRYVVIDAFASEPLQGNPVAVFFDCDDLSGERMQRMAREMNLSESTFVLRPQQDGDARIRIFTPVNELPFAGHPLLGTAIALGAETDKDRLFLETRMGTVPFALERQDGKVVACSMQQPIPTWEHFSRPAELLAALGLKGSTFPIEVYRNGPRHVFVGLESVAALSALHPDHRALCDFPDLAVNCFAGAGRHWRNRMFSPAYGVVEDAATGSAAGPLAIHLARHRQIPYGQQIEILQGVEIGRPSRMYARAEGAGERVSTVEVSGNGAAFAEGRAYL
>NZ_ASRD01000186.1|WP_003118954.1|1834_3718_+|phenazine-specific-anthranilate-synthase-component-I
MNALPTSLLQRLLERPAPFALLYRPESNGPGLLDVIRGEALELHGLADLPLDEPGPGLPRHDLLALIPYRQIAERGFEALDDGTPLLALKVLEQELLPLEQALALLPNQALELSEEGFDLDDEAYAEVVGRVIADEIGRGEGANFVIKRRFQARIDGYATASALSFFRQLLLREKGAYWTFIVHTGERTLVGASPERHISVRDGLAVMNPISGTYRYPPAGPNLAEVMEFLDNRKEADELYMVVDEELKMMARICEDGGRVLGPYLKEMAHLAHTEYFIEGQTSRDVREVLRETLFAPTVTGSPLESACRVIRRYEPQGRGYYSGVAALIGGDGQGGRTLDSAILIRTAEIEGDGRLRIGVGSTIVRHSDPLGEAAESRAKASGLIAALKSQAPQRLGSHPHVVAALASRNAPIADFWLRGASERQQLQADLSGREVLIVDAEDTFTSMIAKQLKSLGLTVTVRGFQEPYSFDGYDLVIMGPGPGNPTEIGQPKIGHLHLAIRSLLSERRPFLAVCLSHQVLSLCLGLDLQRRQEPNQGVQKQIDLFGAAERVGFYNTFAARALQDRIEIPEVGPIEISRDRETGEVHALRGPRFASMQFHPESVLTREGPRIIADLLRHALVERRP
>NZ_ASRD01000186.1|WP_003093625.1|1214_1838_+|isochorismatase-family-protein
MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHDMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE
>NZ_ASRD01000186.1|WP_003093621.1|0_1218_+|3-deoxy-7-phosphoheptulonate-synthase
MDDLLQRVRRCEALQQPEWGDPSRLRDVQAYLRGSPALIRAGDILALRATLARVARGEALVVQCGDCAEDMDDHHAENVARKAAVLELLAGALRLAGRRPVIRVGRIAGQYAKPRSKPHEQVGEQTLPVYRGDMVNGREAHAEQRRADPQRILKGYAAARNIMRHLGWDAASGQEANASPVWTSHEMLLLDYELSMLREDEQRRVYLGSTHWPWIGERTRQVDGAHVALLAEVLNPVACKVGPEIGRDQLLALCERLDPRREPGRLTLIARMGAQKVGERLPPLVEAVRAAGHPVIWLSDPMHGNTIVAPCGNKTRLVRSIAEEVAAFRLAVSGSGGVAAGLHLETTPDDVTECVADSSGLHQVSRHYTSLCDPRLNPWQALSAVMAWSGAEAIPSATFPLETVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_ASRD01000125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000125_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000125_1

8669-8782

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ASRD01000125_1

>merge|NZ_ASRD01000125|1|8669-8782|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>NZ_ASRD01000125|1|1|8669-8782|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000125.1\|WP_017148544.1\|9825_12213_-\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|225241
NZ_ASRD01000125.1\|WP_003084297.1\|2473_3844_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
NZ_ASRD01000125.1\|WP_003084290.1\|1049_2408_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_ASRD01000125.1\|WP_003084301.1\|5481_6579_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_ASRD01000125.1\|WP_003118143.1\|12323_13376_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_ASRD01000125.1\|WP_038820142.1\|13962_14404_-\|thiol-disulfide-isomerase	unknown	unknown	gnl\|CDD\|239267
NZ_ASRD01000125.1\|WP_003112942.1\|13354_13858_-\|transcriptional-regulator	unknown	unknown	unknown
NZ_ASRD01000125.1\|WP_003112938.1\|256_1009_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_ASRD01000125.1\|WP_003084303.1\|6633_7788_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_ASRD01000125.1\|WP_003084299.1\|3959_5063_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000125.1\|WP_017148544.1\|9825_12213_-\|penicillin-acylase-family-protein	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
NZ_ASRD01000125.1\|WP_003084297.1\|2473_3844_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
NZ_ASRD01000125.1\|WP_003084290.1\|1049_2408_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
NZ_ASRD01000125.1\|WP_003084301.1\|5481_6579_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_ASRD01000125.1\|WP_003118143.1\|12323_13376_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	7.29342e-32
NZ_ASRD01000125.1\|WP_038820142.1\|13962_14404_-\|thiol-disulfide-isomerase	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.00241998
NZ_ASRD01000125.1\|WP_003112938.1\|256_1009_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
NZ_ASRD01000125.1\|WP_003084303.1\|6633_7788_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
NZ_ASRD01000125.1\|WP_003084299.1\|3959_5063_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0

>NZ_ASRD01000125.1|WP_003084303.1|6633_7788_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>NZ_ASRD01000125.1|WP_003084301.1|5481_6579_+|polyamine-ABC-transporter-substrate-binding-protein
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>NZ_ASRD01000125.1|WP_003084299.1|3959_5063_+|polyamine-ABC-transporter-substrate-binding-protein
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>NZ_ASRD01000125.1|WP_003084297.1|2473_3844_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>NZ_ASRD01000125.1|WP_003084290.1|1049_2408_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>NZ_ASRD01000125.1|WP_003112938.1|256_1009_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>NZ_ASRD01000125.1|WP_017148544.1|9825_12213_-|penicillin-acylase-family-protein
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQGEWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWNGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAADADSPWWDDRRTERRETRADIVRAAWNASLAHLRRTLGNDPSGWLWGKAHTLTHEHALGQQALLRRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>NZ_ASRD01000125.1|WP_003118143.1|12323_13376_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAECIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDVLTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>NZ_ASRD01000125.1|WP_003112942.1|13354_13858_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>NZ_ASRD01000125.1|WP_038820142.1|13962_14404_-|thiol-disulfide-isomerase
DSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_ASRD01000041

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

797 : 34835

Pseudomonas_phage(91.84%)

capsid,tail,portal,terminase,holin,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038819778.1\|797_1100_-	hypothetical protein	A0A0U4ISH7	Pseudomonas_phage	4.8e-41	97.0
WP_038819779.1\|1099_1771_-	hypothetical protein	Q8HAP4	Burkholderia_phage	6.0e-07	29.2
WP_038819780.1\|1984_2233_-	hypothetical protein	A0A0U3TGX2	Pseudomonas_phage	2.7e-34	89.0
WP_038819781.1\|2243_2627_-	LuxR family transcriptional regulator	A0A1B0YZX7	Pseudomonas_phage	6.7e-64	98.4
WP_038819782.1\|2844_3711_-	ParB N-terminal domain-containing protein	A0A1B0YZX8	Pseudomonas_phage	1.8e-149	94.8
WP_023106490.1\|3940_4207_-	hypothetical protein	A0A2H4J103	uncultured_Caudovirales_phage	2.3e-15	50.0
WP_123809179.1\|4279_4462_-	hypothetical protein	W6MYA9	Pseudomonas_phage	7.2e-32	100.0
WP_016852544.1\|4823_5585_-	LexA family transcriptional regulator	A0A2H4J6J6	uncultured_Caudovirales_phage	3.6e-40	59.0
WP_079276246.1\|6062_6767_+	DNA-binding protein	A0A1B0YZY9	Pseudomonas_phage	1.2e-122	96.6
WP_038819787.1\|6831_7593_+	helix-turn-helix domain-containing protein	A0A1B0YZZ0	Pseudomonas_phage	3.7e-90	96.0
WP_038819788.1\|7589_8273_+	hypothetical protein	A0A1B0YZY6	Pseudomonas_phage	1.2e-116	91.2
WP_003159465.1\|8269_8476_+	hypothetical protein	A0A1B0YZY8	Pseudomonas_phage	3.1e-31	94.1
WP_038819789.1\|8472_9054_+	bacteriophage lambda NinG family protein	A0A0U4KL68	Pseudomonas_phage	5.6e-102	94.8
WP_021205615.1\|9050_9347_+	hypothetical protein	A0A1B0YZZ2	Pseudomonas_phage	4.3e-42	86.7
WP_038819790.1\|9384_10059_+	hypothetical protein	A0A1B0YZZ3	Pseudomonas_phage	4.0e-120	99.1
WP_079276247.1\|10237_10777_+	DUF4124 domain-containing protein	A0A1B0Z2K9	Pseudomonas_phage	2.4e-75	82.7
WP_023517910.1\|10954_11269_+\|holin	phage holin, lambda family	A0A0A0YUH2	Pseudomonas_phage	9.8e-53	99.0
WP_038819792.1\|11268_11886_+	glycoside hydrolase family 19 protein	A0A0U4JP23	Pseudomonas_phage	2.7e-107	94.6
WP_038819793.1\|11885_12335_+	hypothetical protein	A0A0U4JX95	Pseudomonas_phage	8.8e-55	94.6
WP_052171282.1\|12426_12846_+	HNH endonuclease	A0A0U4B0J6	Pseudomonas_phage	9.0e-78	99.3
WP_020750362.1\|12979_13390_+\|terminase	P27 family phage terminase small subunit	A0A2H4PI39	Pseudomonas_phage	1.6e-10	34.8
WP_049878518.1\|13382_15146_+\|terminase	terminase large subunit	A0A0U4B0M7	Pseudomonas_phage	0.0e+00	99.7
WP_021205610.1\|15145_16549_+\|portal	phage portal protein	A0A0U4IJ43	Pseudomonas_phage	7.8e-267	100.0
WP_023121705.1\|16565_17438_+\|protease	Clp protease ClpP	A0A0U4B0J0	Pseudomonas_phage	1.8e-157	100.0
WP_023118129.1\|17451_18663_+\|capsid	phage major capsid protein	A0A0U4JIW8	Pseudomonas_phage	1.7e-214	99.5
WP_021205607.1\|18709_18898_+	hypothetical protein	A0A0U4JVT0	Pseudomonas_phage	6.9e-22	100.0
WP_021205606.1\|18901_19081_+	hypothetical protein	A0A0U4K5G7	Pseudomonas_phage	6.0e-23	96.6
WP_038819795.1\|19091_19424_+\|head,tail	phage gp6-like head-tail connector protein	A0A0U4JEH2	Pseudomonas_phage	1.6e-53	99.1
WP_034035677.1\|19424_19976_+	hypothetical protein	NA	NA	NA	NA
WP_038819796.1\|19972_20566_+	hypothetical protein	A0A0U4J906	Pseudomonas_phage	5.1e-103	99.5
WP_038819797.1\|20578_21016_+	hypothetical protein	A0A0U4IBQ1	Pseudomonas_phage	1.5e-72	96.6
WP_023517902.1\|21039_21825_+	hypothetical protein	A0A0U4ISK2	Pseudomonas_phage	1.1e-140	95.4
WP_023517901.1\|21881_22247_+	hypothetical protein	A0A0U4KLC4	Pseudomonas_phage	2.4e-58	98.3
WP_023465516.1\|22291_22441_+	hypothetical protein	NA	NA	NA	NA
WP_038819799.1\|22430_24566_+	tape measure protein	A0A0U3TH20	Pseudomonas_phage	0.0e+00	99.0
WP_003098501.1\|24575_25079_+	hypothetical protein	A0A0U4IIK1	Pseudomonas_phage	1.8e-93	100.0
WP_079276248.1\|25080_26784_+	hypothetical protein	A0A0U4JP39	Pseudomonas_phage	0.0e+00	96.8
WP_038819801.1\|26786_27197_+	hypothetical protein	A0A1B0YZV0	Pseudomonas_phage	4.7e-63	94.8
WP_038819802.1\|27196_27742_+	hypothetical protein	A0A0A0YWE1	Pseudomonas_phage	5.2e-94	94.5
WP_038819803.1\|27754_28159_+	hypothetical protein	A0A0A0YR47	Pseudomonas_phage	4.5e-66	98.5
WP_038819804.1\|28155_29814_+	hypothetical protein	A0A0A0YRR5	Pseudomonas_phage	0.0e+00	97.6
WP_038819805.1\|29842_30430_+	hypothetical protein	A0A1B0Z051	Pseudomonas_phage	3.5e-104	95.9
WP_033994923.1\|30422_30614_+	hypothetical protein	A0A1B0Z2L3	Pseudomonas_phage	1.3e-28	96.8
WP_038819806.1\|30618_31179_+	hypothetical protein	A0A0U4JIY3	Pseudomonas_phage	3.2e-99	98.9
WP_023086976.1\|31179_31461_+	hypothetical protein	A0A1W6JTD4	Pseudomonas_phage	3.6e-46	100.0
WP_038819807.1\|31453_32386_+	hypothetical protein	A0A1B0YZW2	Pseudomonas_phage	1.3e-174	98.4
WP_003124028.1\|32385_32685_+	hypothetical protein	A0A1B0YZW1	Pseudomonas_phage	3.7e-49	98.0
WP_033971922.1\|32681_32903_+	hypothetical protein	A0A0U3DK06	Pseudomonas_phage	2.4e-21	72.5
WP_038819808.1\|33102_33501_-	hypothetical protein	E5AGG6	Erwinia_phage	2.4e-11	34.5
WP_124141373.1\|33519_33711_-	hypothetical protein	NA	NA	NA	NA
WP_038819809.1\|33820_34495_-	hypothetical protein	A0A2K8I970	Pseudomonas_phage	9.0e-120	90.6
WP_023109386.1\|34562_34835_+	hypothetical protein	A0A0U4JEI3	Pseudomonas_phage	4.5e-46	97.8

DBSCAN-SWA_2

78143 : 87172

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003098558.1\|78143_78779_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
WP_038819811.1\|78824_79718_+	peptidoglycan DD-metalloendopeptidase family protein	A0A076G6R1	Bacillus_phage	1.0e-06	34.3
WP_003113871.1\|79822_80827_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.0e-34	34.8
WP_003092272.1\|81253_81577_-	ferredoxin family protein	NA	NA	NA	NA
WP_003113873.1\|81643_84211_-	DNA mismatch repair protein MutS	E5RUN9	Heterocapsa_circularisquama_DNA_virus	1.4e-19	21.5
WP_034020223.1\|84336_85344_-	TolB family protein	NA	NA	NA	NA
WP_003092262.1\|85491_85998_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
WP_003092260.1\|86131_87172_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

Anti-CRISPR protein detection

Acr_ID: NZ_ASRD01000041.1|WP_038819808.1|33102_33501_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_ASRD01000041.1|WP_023106490.1|3940_4207_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_ASRD01000041.1|WP_123809179.1|4279_4462_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_ASRD01000041.1|WP_038819808.1|33102_33501_-|hypothetical-protein

33102_33501_-

132 aa aa

AcrIF11

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0490\|WP_038819808.1\|AcrIF11\|I-F\|Verified\|Pseudomonas-aeruginosa	1.0	1	1.0

797-34835

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_ASRD01000188_1	Unclear	1.5\|1550\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1550-1581	32	5622-5653	2
NZ_ASRD01000188_1	Unclear	1.7\|1670\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1670-1701	32	6919-6950	2
NZ_ASRD01000188_1	Unclear	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	26380-26349	2

1. spacer 1.5|1550|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 5622-5653, mismatch: 2

ttcccgcctgatatgtacctaatgttcatatt	CRISPR spacer
ttcctgcctaatatgtacctaatgttcatatt	Protospacer
****.****.**********************

2. spacer 1.7|1670|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 6919-6950, mismatch: 2

gcgaacgaccaaggggtgtgctggccggcggt	CRISPR spacer
gcgaacgaccaaggcgtgtgctggccggctgt	Protospacer
************** ************** **

3. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 26380-26349, mismatch: 2

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

NZ_ASRD01000041.1|WP_023106490.1|3940_4207_-|hypothetical-protein

3940_4207_-

88 aa aa

HTH_LUXR

Identity	Hit_domain_coverage
0.42857142857142855	0.9655172413793104

797-34835

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_ASRD01000188_1	Unclear	1.5\|1550\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1550-1581	32	5622-5653	2
NZ_ASRD01000188_1	Unclear	1.7\|1670\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1670-1701	32	6919-6950	2
NZ_ASRD01000188_1	Unclear	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	26380-26349	2

1. spacer 1.5|1550|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 5622-5653, mismatch: 2

ttcccgcctgatatgtacctaatgttcatatt	CRISPR spacer
ttcctgcctaatatgtacctaatgttcatatt	Protospacer
****.****.**********************

2. spacer 1.7|1670|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 6919-6950, mismatch: 2

gcgaacgaccaaggggtgtgctggccggcggt	CRISPR spacer
gcgaacgaccaaggcgtgtgctggccggctgt	Protospacer
************** ************** **

3. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 26380-26349, mismatch: 2

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

NZ_ASRD01000041.1|WP_123809179.1|4279_4462_-|hypothetical-protein

4279_4462_-

60 aa aa

HTH_LUXR

Identity	Hit_domain_coverage
0.42857142857142855	0.9655172413793104

797-34835

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_ASRD01000188_1	Unclear	1.5\|1550\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1550-1581	32	5622-5653	2
NZ_ASRD01000188_1	Unclear	1.7\|1670\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	1670-1701	32	6919-6950	2
NZ_ASRD01000188_1	Unclear	1.17\|2270\|32\|NZ_ASRD01000188\|PILER-CR,CRISPRCasFinder,CRT	2270-2301	32	26380-26349	2

1. spacer 1.5|1550|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 5622-5653, mismatch: 2

ttcccgcctgatatgtacctaatgttcatatt	CRISPR spacer
ttcctgcctaatatgtacctaatgttcatatt	Protospacer
****.****.**********************

2. spacer 1.7|1670|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 6919-6950, mismatch: 2

gcgaacgaccaaggggtgtgctggccggcggt	CRISPR spacer
gcgaacgaccaaggcgtgtgctggccggctgt	Protospacer
************** ************** **

3. spacer 1.17|2270|32|NZ_ASRD01000188|PILER-CR,CRISPRCasFinder,CRT matches to NZ_ASRD01000041 position: 26380-26349, mismatch: 2

catcgaggcggagcgtatgcaccaggtcgatc	CRISPR spacer
catcgaggcggagcgtatgcacaagatcgatc	Protospacer
********************** **.******

8. NZ_ASRD01000007

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

172325 : 178511

Powai_lake_megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092811.1\|172325_172757_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.2e-22	41.7
WP_003092814.1\|173000_173201_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003092818.1\|173226_173565_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_034020265.1\|173571_175431_-	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	4.8e-107	40.1
WP_003092824.1\|175473_175995_-	co-chaperone HscB	NA	NA	NA	NA
WP_003100617.1\|176002_176326_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.8e-24	50.5
WP_003092829.1\|176353_176740_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	79.8
WP_038819576.1\|176775_177990_-	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	2.6e-32	36.9
WP_003092836.1\|178019_178511_-	Fe-S cluster assembly transcriptional regulator IscR	M4M9K8	Vibrio_phage	2.2e-06	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

9. NZ_ASRD01000059

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17833 : 25495

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003094039.1\|17833_18517_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-28	33.2
WP_003112760.1\|18733_19528_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003112759.1\|19470_19800_-	DUF190 domain-containing protein	A0A2H4J2R0	uncultured_Caudovirales_phage	3.1e-25	47.7
WP_003094051.1\|19819_20203_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.7e-36	69.9
WP_003120890.1\|20431_21118_+	hypothetical protein	NA	NA	NA	NA
WP_003094059.1\|21173_22817_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.2e-175	64.2
WP_003094064.1\|22867_23161_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	7.5e-15	49.5
WP_003094066.1\|23357_23825_-	membrane protein FxsA	NA	NA	NA	NA
WP_003112758.1\|23893_24628_-	HugZ family protein	NA	NA	NA	NA
WP_003094072.1\|24736_25495_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	7.7e-11	28.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

10. NZ_ASRD01000031

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

24596 : 67162

Pseudomonas_phage(73.81%)

terminase,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038819709.1\|24596_25112_+	hypothetical protein	A0A2K8HVM8	Pseudomonas_phage	5.5e-93	91.2
WP_038819710.1\|25407_26094_+	hypothetical protein	A0A2K8I970	Pseudomonas_phage	8.0e-124	92.1
WP_003116782.1\|26075_26339_-	hypothetical protein	A0A0U4JX18	Pseudomonas_phage	1.2e-43	94.3
WP_033953369.1\|26374_26638_-	hypothetical protein	B5WZU5	Pseudomonas_phage	2.2e-37	92.0
WP_038819714.1\|26634_27003_-	hypothetical protein	H2BDA0	Pseudomonas_phage	5.2e-45	81.1
WP_038819715.1\|26999_27629_-	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	1.2e-110	95.2
WP_079276243.1\|27673_29749_-	acyltransferase	B5WZU0	Pseudomonas_phage	1.2e-61	35.7
WP_079276244.1\|29761_31447_-	hypothetical protein	A0A291I973	Pseudomonas_phage	5.2e-185	72.6
WP_033994432.1\|31513_34261_-	hypothetical protein	A0A0H5ART3	Pseudomonas_phage	6.0e-239	48.0
WP_033994431.1\|34226_34640_-	hypothetical protein	B5WZT7	Pseudomonas_phage	8.6e-41	61.5
WP_003116774.1\|34643_35129_-	DUF1833 family protein	B5WZT6	Pseudomonas_phage	9.2e-34	47.5
WP_049874140.1\|35130_35601_-	hypothetical protein	B5WZT5	Pseudomonas_phage	3.7e-32	44.6
WP_038819717.1\|35600_38882_-\|tail	tail length tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	1.8e-93	35.6
WP_071536105.1\|38832_39108_-	hypothetical protein	NA	NA	NA	NA
WP_033977283.1\|39227_39716_-	hypothetical protein	NA	NA	NA	NA
WP_033977281.1\|39774_40944_-	Ig-like domain-containing protein	A0A059VG08	Pseudomonas_phage	7.6e-58	39.4
WP_033994428.1\|41005_41413_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_038819718.1\|41409_41805_-	hypothetical protein	A0A059VF88	Pseudomonas_phage	1.8e-27	49.2
WP_029982117.1\|41804_42179_-	hypothetical protein	A0A0S2SYG4	Pseudomonas_phage	1.6e-09	34.8
WP_038819719.1\|42183_43176_-	hypothetical protein	A0A2H4IY91	uncultured_Caudovirales_phage	8.9e-84	50.3
WP_038819720.1\|43172_43691_-	hypothetical protein	A0A059VG19	Pseudomonas_phage	1.1e-37	54.0
WP_038819721.1\|43748_44192_-	hypothetical protein	NA	NA	NA	NA
WP_031692843.1\|44204_45134_-	DUF2184 domain-containing protein	L7TMZ5	Rhizobium_phage	2.5e-104	60.8
WP_038819722.1\|45143_45599_-	DUF2190 family protein	A0A2R3UAC1	Siphoviridae_environmental_samples	7.5e-38	59.7
WP_038819723.1\|45598_46720_-	DUF2213 domain-containing protein	A0A2H4J6J7	uncultured_Caudovirales_phage	1.8e-93	65.5
WP_038819724.1\|46722_48531_-	DUF1073 domain-containing protein	A0A2H4J4I9	uncultured_Caudovirales_phage	3.6e-216	62.3
WP_038819726.1\|48530_49817_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-145	58.8
WP_038819727.1\|49803_50400_-\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	9.9e-46	59.9
WP_023123621.1\|50408_50693_-\|holin	phage holin family protein	H2BD74	Pseudomonas_phage	1.7e-40	96.8
WP_004349441.1\|50685_51075_-	hypothetical protein	H2BD73	Pseudomonas_phage	9.9e-63	100.0
WP_003116756.1\|51189_51876_-	hypothetical protein	H2BD72	Pseudomonas_phage	9.7e-130	100.0
WP_019396730.1\|51904_52348_-	RusA family crossover junction endodeoxyribonuclease	J7I4J7	Pseudomonas_phage	2.1e-77	99.3
WP_033968894.1\|52340_52754_-	hypothetical protein	NA	NA	NA	NA
WP_038819731.1\|52881_53844_-	hypothetical protein	A0A2H4JCW9	uncultured_Caudovirales_phage	3.6e-13	47.4
WP_009314063.1\|53847_54444_-	hypothetical protein	NA	NA	NA	NA
WP_023109489.1\|54538_54760_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038819734.1\|54865_55597_+	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	1.7e-71	59.2
WP_049874141.1\|55626_56433_+	hypothetical protein	NA	NA	NA	NA
WP_073670967.1\|57315_58086_-	hypothetical protein	NA	NA	NA	NA
WP_143176659.1\|58201_59158_-	hypothetical protein	A0A1B5FPB0	Escherichia_phage	6.1e-13	33.9
WP_031673425.1\|59249_59462_+	hypothetical protein	L7TKR9	Pseudomonas_virus	6.8e-34	98.6
WP_038819737.1\|59497_59869_+	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	1.9e-63	99.2
WP_010793151.1\|60501_60723_+	hypothetical protein	A0A127KNM7	Pseudomonas_phage	2.8e-30	95.7
WP_031692829.1\|60719_60899_+	hypothetical protein	Q9MC67	Pseudomonas_phage	1.4e-24	100.0
WP_038819738.1\|61360_62164_+	hypothetical protein	H2BD50	Pseudomonas_phage	5.4e-148	94.8
WP_003451743.1\|62172_62388_+	hypothetical protein	J7I4L3	Pseudomonas_phage	4.1e-34	98.6
WP_019486669.1\|62384_63380_+	hypothetical protein	J7HXB6	Pseudomonas_phage	7.0e-129	81.6
WP_009314053.1\|63386_63587_+	hypothetical protein	J7I437	Pseudomonas_phage	1.9e-30	100.0
WP_049874128.1\|63597_64530_+	DNA translocase FtsK	J7I0T4	Pseudomonas_phage	1.4e-166	99.4
WP_038819740.1\|64533_66276_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	4.9e-295	96.7
WP_161628792.1\|66419_67162_+	site-specific DNA-methyltransferase	A0A222ZJV5	Mycobacterium_phage	3.2e-62	45.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

11. NZ_ASRD01000081

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000081_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000081_1

25803-25944

Orphan

Consensus_repeat	Method
CACGCGCCGATCCAGGCGTGGGGCGAATAACCGCTGCGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ASRD01000081_1

>merge|NZ_ASRD01000081|1|25803-25944|CRISPRCasFinder
CACGCGCCGATCCAGGCGTGGGGCGAATAACCGCTGCGCGGGGTAAACGGCGGATAACGCCGTTGGCACCTGTTCCGGACCGATGAAAGAAGCTGCACTTTCACGCGCCGATCCAGGCGTAGGGCGAATAACCGCTGCGCGG

>NZ_ASRD01000081|1|1|25803-25944|CRISPRCasFinder
CACGCGCCGATCCAGGCGTGGGGCGAATAACCGCTGCGCGG	GGTAAACGGCGGATAACGCCGTTGGCACCTGTTCCGGACCGATGAAAGAAGCTGCACTTT
CACGCGCCGATCCAGGCGTAGGGCGAATAACCGCTGCGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000081.1\|WP_003101353.1\|24104_24848_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_ASRD01000081.1\|WP_003115857.1\|31932_32361_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_ASRD01000081.1\|WP_003118173.1\|22572_23868_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_ASRD01000081.1\|WP_003144549.1\|19865_20585_-\|B3/4-domain-containing-protein	unknown	unknown	gnl\|CDD\|225917
NZ_ASRD01000081.1\|WP_003101360.1\|19199_19838_-\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225366
NZ_ASRD01000081.1\|WP_023131743.1\|28931_29366_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100005
NZ_ASRD01000081.1\|WP_034019919.1\|32425_34834_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|227114
NZ_ASRD01000081.1\|WP_003101332.1\|29397_30198_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197320
NZ_ASRD01000081.1\|WP_003101349.1\|25491_25773_+\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|185338
NZ_ASRD01000081.1\|WP_073653001.1\|30919_31852_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NZ_ASRD01000081.1\|WP_025921192.1\|18728_19196_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_ASRD01000081.1\|WP_023910741.1\|35176_35995_+\|2,5-didehydrogluconate-reductase-DkgB	unknown	unknown	gnl\|CDD\|183012
NZ_ASRD01000081.1\|WP_023086944.1\|24947_25349_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_ASRD01000081.1\|WP_003129343.1\|17680_18703_+\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_ASRD01000081.1\|WP_003118177.1\|30220_30784_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|273591
NZ_ASRD01000081.1\|WP_003101357.1\|20886_22530_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236239
NZ_ASRD01000081.1\|WP_003101372.1\|16645_17374_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_ASRD01000081.1\|WP_003159290.1\|36044_36503_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_ASRD01000081.1\|WP_003101343.1\|27903_28827_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176161
NZ_ASRD01000081.1\|WP_003101348.1\|25980_27369_-\|protease-IV	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000081.1\|WP_003115857.1\|31932_32361_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	1.32056e-32
NZ_ASRD01000081.1\|WP_003118173.1\|22572_23868_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	1.57564e-172
NZ_ASRD01000081.1\|WP_003144549.1\|19865_20585_-\|B3/4-domain-containing-protein	gnl\|CDD\|225917	COG3382, COG3382, Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS-beta [General function prediction only].	7.89952e-94
NZ_ASRD01000081.1\|WP_003101353.1\|24104_24848_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.82321e-13
NZ_ASRD01000081.1\|WP_023131743.1\|28931_29366_+\|RidA-family-protein	gnl\|CDD\|100005	cd02198, YjgH_like, YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	3.77661e-48
NZ_ASRD01000081.1\|WP_034019919.1\|32425_34834_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|227114	COG4773, FhuE, Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid [Inorganic ion transport and metabolism].	0
NZ_ASRD01000081.1\|WP_003101332.1\|29397_30198_-\|exodeoxyribonuclease-III	gnl\|CDD\|197320	cd09086, ExoIII-like_AP-endo, Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Escherichia coli ExoIII, Neisseria meningitides NExo,and related proteins. These are ExoIII family AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiencies. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity. For example, Neisseria meningitides Nape and NExo, and exonuclease III (ExoIII) and endonuclease IV (EndoIV) in Escherichia coli. NExo and ExoIII are found in this subfamily. NExo is the non-dominant AP endonuclease. It exhibits strong 3'-5' exonuclease and 3'-deoxyribose phosphodiesterase activities. Escherichia coli ExoIII is an active AP endonuclease, and in addition, it exhibits double strand (ds)-specific 3'-5' exonuclease, exonucleolytic RNase H, 3'-phosphomonoesterase and 3'-phosphodiesterase activities, all catalyzed by a single active site. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes ExoIII and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	1.01718e-128
NZ_ASRD01000081.1\|WP_003101349.1\|25491_25773_+\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|185338	PRK15441, PRK15441, peptidyl-prolyl cis-trans isomerase C; Provisional.	3.49418e-30
NZ_ASRD01000081.1\|WP_073653001.1\|30919_31852_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	2.6919e-60
NZ_ASRD01000081.1\|WP_025921192.1\|18728_19196_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	1.26397e-05
NZ_ASRD01000081.1\|WP_023910741.1\|35176_35995_+\|2,5-didehydrogluconate-reductase-DkgB	gnl\|CDD\|183012	PRK11172, dkgB, 2,5-didehydrogluconate reductase DkgB.	0
NZ_ASRD01000081.1\|WP_023086944.1\|24947_25349_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	1.57269e-41
NZ_ASRD01000081.1\|WP_003129343.1\|17680_18703_+\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	3.44804e-111
NZ_ASRD01000081.1\|WP_003118177.1\|30220_30784_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|273591	TIGR01382, Uncharacterized_protein_MJ0967, intracellular protease, PfpI family. The member of this family from Pyrococcus horikoshii has been solved to 2 Angstrom resolution. It is an ATP-independent intracellular protease that crystallizes as a hexameric ring. Cys-101 is proposed as the active site residue in a catalytic triad with the adjacent His-102 and a Glu residue from an adjacent monomer. A member of this family from Bacillus subtilis, GSP18, has been shown to be expressed in response to several forms of stress. A role in the degradation of small peptides has been suggested. A closely related family consists of the thiamine biosynthesis protein ThiJ and its homologs. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	2.78031e-77
NZ_ASRD01000081.1\|WP_003101357.1\|20886_22530_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236239	PRK08322, PRK08322, acetolactate synthase large subunit.	0
NZ_ASRD01000081.1\|WP_003101372.1\|16645_17374_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.12299e-43
NZ_ASRD01000081.1\|WP_003159290.1\|36044_36503_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.57316e-14
NZ_ASRD01000081.1\|WP_003101343.1\|27903_28827_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176161	cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.19159e-101
NZ_ASRD01000081.1\|WP_003101360.1\|19199_19838_-\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|225366	COG2808, PaiB, Transcriptional regulator [Transcription].	1.68427e-111

>NZ_ASRD01000081.1|WP_003101349.1|25491_25773_+|peptidyl-prolyl-cis-trans-isomerase
MARATARHILVSSEAKCNELKTAIEGGADFAEVAREHSSCPSGRDGGNLGSFGPGQMVREFDQVVFSAPLNVVQGPVKTQFGYHLLEVTSRQD
>NZ_ASRD01000081.1|WP_023086944.1|24947_25349_-|GFA-family-protein
MSQTFHGSCLCGALHYRLSSPPHALSHCHCGQCRKAHGAAFASYGSVPVADLHIDRGADLLAAFRSSPAVLRRFCSRCGSPLFWSRSEGEFADWVSVALGSLDTPFPAAKQKHVQVASMACWCRIADDWPRFD
>NZ_ASRD01000081.1|WP_003101353.1|24104_24848_-|class-I-SAM-dependent-methyltransferase
MSATALYTDLSHYYDLMCADIDYQAQSHCVRRLHQLFGNQGRRHLDLACGTGPHVRHFLDFGYRSAGLDINQPMLDLARQRCPEAHFSRQDMAGFQVDEPLDLITCFLYSIHYNAGLERLRACLASVHGALADGGVFCFNTVDKGQIDNRAFVRHSVEHRGSRFTFGSGWYYSGEGERQALRLGIEKTTDGTTQTWEDEHPMVALGFAELQHLLQTHFEVQVFEHDYERITPWAGSSGNALFVCVKR
>NZ_ASRD01000081.1|WP_003118173.1|22572_23868_-|OprD-family-porin
MSSPFSPRSPRTLRGLGALALCGGFVAPAPAAFLEDGSARLEARTVYFNRDFRDGSSANPQGASKREEAAQGFILDLRSGYTEGALGFGVDTLAMLGIKLDSSPADSNSGLLPSSGHDPRRSVDQYAKAGVAGKMRFSQTQFRYGAMLPDMPLLKYNDGRLLPTLFHGAQLTSEEIAGLRFSATRLERYTARDSSDAQDIRLHCKNKRYACDTTGNRFDAYQLDYQVNDGLLLQYAQGGLRNVYRQRYLGAVGKRQVGAGKLSADLRWFDSEDAGAARAGKIDNRALSLLLAYAQGGHTLSAGWQRMNGASSMPYLDGSNPYLANYLQVNDFANPEERSWQLRYDFDLRSVGVPGLSFMTRYVNGDHIRLANGDEGKEWERDIELKYVVQSGRFKDLSLRLRNATYRTDFERSARDVDEVRLIASYNLSLF
>NZ_ASRD01000081.1|WP_003101357.1|20886_22530_+|acetolactate-synthase-large-subunit
MAKAADVVVQCLENEGVQYVFGIPGEENLDLLESLRKSQIRLVLTRHEQSAGFMAATYGRLTGKTGVSLSTLGPGATNLVTAGAYAYLGGMPMLMITGQKPIKKSKQGRFQILDVVGMMQPLTKYTHQLASADNIPSRVREAFRLAEEEKPGAVHLELPEDIAAEQTDSLPIPPSLSRRPLAEYKAICAAVEKLRAARSPILVIGAGANRKMTAKVLKQLIDKTGIPFVTTQMGKGVVDERHPRFLGNAALSAGDFVHRAVEAADLIVNVGHDVIEKPPFFMVRGGTEVIHVNFRSAEVDPVYFPQIEVVGDIANAIWQIGEALDDTAHWDFTRLLAIREANEAQVAEGADDPRFPLYPQRLVADVRRALPSQGIVALDNGMYKIWFARNYKAHMPNTVLLDNALATMGAGLPSAMAAHLVYPDRPIVAVCGDGGFMMNSQELETAVRLKMNLTVIILRDNGYGMIRWKQSNMGFADFGLDYGNPDFVHYAEAYGAHGHRVDSAEGFLPLLERCLGTPGVHVIDCPVDYSENDRILNVELRERALAV
>NZ_ASRD01000081.1|WP_003144549.1|19865_20585_-|B3/4-domain-containing-protein
MPEHAPILPVIAAEVAALAPGFRALSLTVEAAPIVRPEIADRAVERACQALARGEPDWAEAHLAAWAEAFRRFGAKPQRTPCSAEALRKRALRDGGLPSIDPVVDLYNAISVQFAIPVGGENLAAYAGTPRLVVADGSETFDTLKNGEAVDESPDPGEVVWRDDLGVTCRRWNWRQGVRTRLDASARRMWFILESLPEMPLAALHEAGGLLLDELRLMMPGMRADSRLLCVATEPTDSV
>NZ_ASRD01000081.1|WP_003101360.1|19199_19838_-|FMN-binding-negative-transcriptional-regulator
MYLPSHFEESDPQALHALIRDYPLGLLVSHGEAGLDANHLPFELSPEKGAQGTLEAHVARNNPVWSELRDGDEVLVVFRAGDAYISPQWYPSKQEHHRQVPTWNYRVVHAHGRVRIRDDERYVRGLVARLTRTHEATQETPWKMTDGPADYIDEMLRLIVGIEIEITRLVGKFKLSQNKEARDIRGASAALLARGEQAIGAAMDDCAARRDG
>NZ_ASRD01000081.1|WP_025921192.1|18728_19196_+|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MLERTFRPDLRRSCAMSQPFLWRRVNDSSGFAEPRVFIRVYLEPGSIDAAIAFYEDLQGVAHDMRFDFPEKRLTLAAVGAFLLLEGSDEALAPFRSTTGTLLVDDIEPYHRRLLAAGAQIIFGPARAPTGACFNALLPDGTVVEFVHHRPQPGEA
>NZ_ASRD01000081.1|WP_003129343.1|17680_18703_+|GlxA-family-transcriptional-regulator
MERRRFSAALQGQNLRFTGAGEGGSARARVGFLLLEHFSLPAFTQALDTLVTANLIRSESFAVSNFSLSGEPVTSDLGLLICPDLALASAARQGLDLLVVCGGLRTPLRSSAALREALQDVASRGVALAGLWNGAWFLGDAGLLDGYRCCIHPEHRAALAEIARNSQVTSDSYMVDRDRLTAASPTGAFNLALEWIARRHGRDLVEAVVDILAFEESRYRRVRPALHEKMSEPLREVINLMAANIEEPLSQEQLAHYVGRSRRQIERLFQQQLGTTPVRYYLELRITECRRLLQHSDLTMLEVLVACGFVSPSHFSKCYTAFYGYPPSKEVRYGNVRSTK
>NZ_ASRD01000081.1|WP_003101372.1|16645_17374_-|GntR-family-transcriptional-regulator
MKAQPDVDSNSADAPFDRKAVLGDALRRRILSMELAPGAVVDELALCDEFGLSRPPVRELLRQIAAEGYIELEANRAPRVAAMSHDSLHAFFLAAPLIYIATTQLAATHASEAEIETLKAIQEDFRKAIEEKHVENRVIHNDAFHLEIGRMAHNDYLMPSLRRLLIDHARLGKIFYRHPTTDDMQRDLELACDQHDQIVDAIQRRDPDAAADIVRAHFELSRRRMAEYAAPAGVEVALVYEG
>NZ_ASRD01000081.1|WP_003101348.1|25980_27369_-|protease-IV
MHKRTYLNACLVLALAAGASQALAAPGASEMAGDVAVLQASPASTGHARFANPNAAISAAGIHFAAPPARRVARAAPLAPKPGTPLQVGVGLKTATPEIDLTTLEWIDTPDGRHTARFPISAAGAASLRAAIRLETRSGSLPDDVLLHFAGAGKEIFEASGKDLSVNRPYWSPVIEGDTLTVELVLPANLQPGDLRLSVPQVSYFADSLYKAGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP
>NZ_ASRD01000081.1|WP_003101343.1|27903_28827_-|LysR-family-transcriptional-regulator
MDRFDAMQAFARVVDTGSFTKAAETLHMSRTSVTQLVQQLEARLRVRLLNRTTRKLNLTADGAAYYERVVRLLAELDDAETSLSSAALAPRGRLRIDVPSPLARLLLIPALPEFHARYPEIQIDLGVSDRLVDLIDENVDCVIRGGELRDQSLMARRVGDLQLGVYAAPAYLQRAGVPSHPRELEDSHQRIVGFLWARTGKALPYAMRRGEECLRVAGRHVLAVDDGNAYLAAGLAGLGILWLPHYMAREPLARGELLPLFEDWSLEPMPLYLAFPPNRHVSGKLRVFIEWVAELIARHAPPLHPPL
>NZ_ASRD01000081.1|WP_023131743.1|28931_29366_+|RidA-family-protein
MTGPGAPGWRYRTTVRDVVFPAGRQALYERNRYSPAVRSDGLLFVSGQVGSRDDGSPEPELETQVRRAFDNLNAVLAAAGCGFDDVLDVTVFMVDAEANFERIWKIVPEYWGEAPYPTLTAVGVNWLYGFSFEIKVVARLPEGR
>NZ_ASRD01000081.1|WP_003101332.1|29397_30198_-|exodeoxyribonuclease-III
MDTLKIATFNVNGIQTRLAALLAWLEREAPDIVCLQELKTPDARFPAAALEKAGYGAIWQGQSAWNGVAILARDSQPLEVRRGLPGNASDPHSRYLEAAVDGLLVASLYLPNGNPQPGPKFDYKLAWFEHLIRHAAELMESGHPVVLAGDFNVVPSDFDIYDTRSWKKDALLQPESRECFERLLRQGWVDALRQRFPDRRLYTFWDYFRQHWQRDAGLRIDHLLLSASLADHLEDAGVDRWVRGEEHASDHAPAWVSLRRPSEPRR
>NZ_ASRD01000081.1|WP_003118177.1|30220_30784_-|type-1-glutamine-amidotransferase
MSAKLQGKNVLVITANTGIERDELLEPLKTLKQQGATVTHATIEGGEAQTWVHDSEKDLIVNSDARLQGLRAEDYDLLLVPGGTVNADTLRQDSEARRLVREFSDAGKTVAAICHGPWLLIDAGVARGKTLTSYSSVRIDLTNAGADWVDTRVKVCPANGWTLITSRNPGDLQAFNEAIGEALQAAA
>NZ_ASRD01000081.1|WP_073653001.1|30919_31852_-|NAD(P)/FAD-dependent-oxidoreductase
MKLTLFRDYPNGRYAMTFDVIIVGGSYAGISAGMQLARARRRVLVMDTGLRRNRFARASHGFLGQDGRDPAAIADDARAQLLAYPSVEWLSEAAVAAKKEADGFVVKAANGERFTARRLILASGVADELPEIPGLAERWGRHVFHCPYCHGYELDGGPIGVLAASPLAIHHALMLPDWGATTFFLNGVFEPDAEQMSRLDRRGVTIEREAVVALGGARADVTLASSRTITLAGLFTQPRTRMASPLAALLGCEFEDGPSGPFIRTDGMRETSVPGVFACGDAALAAGNVAIAVGDGARTGGAAHHSLLFR
>NZ_ASRD01000081.1|WP_003115857.1|31932_32361_+|Rrf2-family-transcriptional-regulator
MRNDTRLSRMLHVLIHMARHEGPATSEAIGQMLGTNPVVVRRTMALLKNEGYVSSEKGHRGGWRLAKPLADITLLDIHQALGASSIFAIGLSTDHPECLVEQAVNEALGEAFEAAQALLLERLGSVTLEQLASEFERRYRPC
>NZ_ASRD01000081.1|WP_034019919.1|32425_34834_-|TonB-dependent-siderophore-receptor
MKHVVSSALLLGLSSLSLAAQAAPIALDLPAQPLAASLEQLQGASGLRIRFDRAAVADRRAPALRGTLEPSEALQRLLAGSGLSGEVRGGDAWVEAAATGAGIAPGDSVDLGALSVVATQDPATAAITEDSGSYTTRAMRTSTKLAMSIRETPQSVSVVTRQRMDDQGMRDLNDAVKGVTGLTVQQYGPARVKYAARGFDVDNIMYDGLPTSISTYTQDVISAADLAMFDRVEVVRGATGLMQGAGNPAAAINMVRKRPTQDFRASLQGSVGTWDRYRSEADVSGPLNSEGTLRGRAVVAYQKGDSFQDHVSSERGVFYGIAEADLSPDTTFAIGASNQNDNRNDNWVGLPSPLGGRHLDLKRSSYYGADWSYWDTDTTHLFSDLTHRFANGWQMKLAADKLWARINMLGLYNDCYYSTTGCASMTQNPGDYSYTDDHDSYDAYANGPFQLLGREHELVVGASYRQERFDGHGGWGSLFNKDGTPTGPMDPTQWDPSSTLKPRLNTSLWGMKLDQEQKGAYLTTRLNLADPLKVILGGRLDWYKADADTDSYKVTRNVTRYAGVIYDLNQTYSVYASYTDIFKPQSNFDAGGGLLDPITGKNYEIGLKGEHFGGALNSQIALFQIDQENRATEDVGGPSPCPFSPTSRYCSRASGKVRSQGVDLELSGALGDDWQMMAGYTYVDAKYKHDSNKANEGKPFDAAKPRHLFKLATSYTLPGELHKWRVGGDLATQSKTEDSSTGFQQGGYTVVNTMLGYKVNERIDTRLNFNNLFDKYYYSGIDFGNLNYGEPRNLMFTVKYSL
>NZ_ASRD01000081.1|WP_023910741.1|35176_35995_+|2,5-didehydrogluconate-reductase-DkgB
MSSTIHPLPSFGLGTFRLTGQVVVDSVRSALELGYRAIDTAQIYGNEADIGRAIAESGVPRSELFLTTKVWVDNYAREKLLASLRGSLEKLRTDRLDLVLIHWPAPGNGVELAEYMAALAEAKSLGLTRRIGVSNFNIELTRQAIAAVGAGEISTIQIELSPYLQNRALTAYLEEQGIAVTSYMTLAYGKVLKDPTLAGIAARHRATVAQVALAWAMQLGYAVIPSSTRRENLASNLLARDLRLDAEDMARIAGLERNGREVSPQGLAPAWD
>NZ_ASRD01000081.1|WP_003159290.1|36044_36503_-|GNAT-family-N-acetyltransferase
MQSLHTLVSVRPVAHEDFEQWLEYWKAYQAFYEVELSAQATEATWRRFFDEGEPMHCAVATDGSRLHGIVNFLYHRSTWAAQDVCYLEDLYVSPDVRGQQIGKQLIEYVRRQAEERRCARLYWHTQESNHRAQRLYDWVADKPGVIEYRIEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

12. NZ_ASRD01000064

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_ASRD01000064.1|WP_025324765.1|134606_134999_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_ASRD01000064.1|WP_023086531.1|135574_135949_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_ASRD01000064.1|WP_025324765.1|134606_134999_-|hypothetical-protein

134606_134999_-

130 aa aa

AcrIF3

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0003\|YP_007392440.1\|AcrIF3\|I-F\|Verified\|Pseudomonas-phage-JBD88a	0.4251968503937008	0.9307692307692308	0.8785714285714286

NZ_ASRD01000064.1|WP_023086531.1|135574_135949_-|hypothetical-protein

135574_135949_-

124 aa aa

AcrIF12

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0491\|ABR13388.1\|AcrIF12\|I-F\|Verified\|Pseudomonas-aeruginosa	0.9193548387096774	1	1.0

NZ_ASRD01000064.1_135348_135552_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_ASRD01000064.1_135348_135552_-	WP_023086532.1	1.0	1	1.0

13. NZ_ASRD01000118

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6192 : 27292

uncultured_Caudovirales_phage(30.43%)

tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034020508.1\|6192_7029_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.6e-70	56.5
WP_003085203.1\|7025_8075_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003117978.1\|8076_8682_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.1e-75	66.3
WP_003118919.1\|9029_9287_-	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
WP_003121852.1\|9283_9646_-	hypothetical protein	Q9MC89	Pseudomonas_phage	4.2e-15	50.4
WP_003113192.1\|9642_10272_-	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	1.6e-86	78.0
WP_003113193.1\|10304_11294_-	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.5e-107	55.8
WP_003101635.1\|11351_11558_-	hypothetical protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_003085182.1\|11532_12405_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
WP_023083951.1\|12414_14652_-\|tail	phage tail length determinator protein	NA	NA	NA	NA
WP_003085178.1\|14821_15166_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	3.8e-18	46.7
WP_003085175.1\|15180_15684_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
WP_003085173.1\|15696_16857_-\|tail	phage tail sheath family protein	Q38068	Phage_PS17	1.2e-188	83.4
WP_016852415.1\|16899_17340_-	hypothetical protein	Q9ZXK5	Pseudomonas_virus	1.4e-33	51.7
WP_003161927.1\|17347_19453_-\|tail	phage tail fiber protein	Q9ZXK6	Pseudomonas_virus	3.0e-222	52.7
WP_003118911.1\|19454_19988_-\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.9e-62	64.6
WP_003161928.1\|19980_20868_-	bacteriophage protein	S4TNY7	Salmonella_phage	4.1e-88	59.8
WP_003085143.1\|20864_21191_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
WP_003121844.1\|21343_21901_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	6.0e-45	70.3
WP_003101620.1\|21897_22413_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	1.8e-32	43.4
WP_003118908.1\|22434_22884_-	hypothetical protein	B5TK61	Pseudomonas_phage	5.0e-26	53.3
WP_003118907.1\|23246_23606_-	hypothetical protein	NA	NA	NA	NA
WP_003085132.1\|23653_23854_-	repressor PtrB	Q9ZXI6	Pseudomonas_virus	3.6e-08	50.0
WP_003113202.1\|24311_25082_+	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
WP_003113203.1\|25181_25496_+	transcription regulatory protein PrtN	NA	NA	NA	NA
WP_015649712.1\|25813_27292_-	anthranilate synthase component I	S4VNU7	Pandoravirus	3.7e-41	29.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

14. NZ_ASRD01000080

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000080_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000080_1

63598-63690

Orphan

Consensus_repeat	Method
GGTCTGTTCGCTGCCGTTGTCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ASRD01000080_1

>merge|NZ_ASRD01000080|1|63598-63690|CRISPRCasFinder
GGTCTGTTCGCTGCCGTTGTCGGCCAGGCGGGCTTCGGCCTTGGTCATGTCCTTGTGCAGGCGGTCGATGGTCTGCTCGCTGCCGTTGTCGGC

>NZ_ASRD01000080|1|1|63598-63690|CRISPRCasFinder
GGTCTGTTCGCTGCCGTTGTCGGC	CAGGCGGGCTTCGGCCTTGGTCATGTCCTTGTGCAGGCGGTCGAT
GGTCTGCTCGCTGCCGTTGTCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000080.1\|WP_003161310.1\|62054_62669_+\|cytochrome-b/b6-domain-containing-protein	unknown	unknown	gnl\|CDD\|226602
NZ_ASRD01000080.1\|WP_003095488.1\|68407_68752_-\|osmotically-inducible-lipoprotein-OsmE	unknown	unknown	gnl\|CDD\|183058
NZ_ASRD01000080.1\|WP_003095513.1\|61377_62001_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000080.1\|WP_003121132.1\|56541_57654_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|225779
NZ_ASRD01000080.1\|WP_003095479.1\|69534_69951_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183165
NZ_ASRD01000080.1\|WP_038819962.1\|71597_72461_+\|oxaloacetate-decarboxylase	unknown	unknown	gnl\|CDD\|225311
NZ_ASRD01000080.1\|WP_003099398.1\|70125_71391_-\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212673
NZ_ASRD01000080.1\|WP_003161312.1\|62665_63433_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026
NZ_ASRD01000080.1\|WP_073653058.1\|72552_73167_-\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000080.1\|WP_003107570.1\|54656_55286_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236881
NZ_ASRD01000080.1\|WP_003161885.1\|64094_64628_-\|bacterioferritin	unknown	unknown	gnl\|CDD\|225104
NZ_ASRD01000080.1\|WP_003112310.1\|64926_66996_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_ASRD01000080.1\|WP_003095496.1\|66997_67810_-\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	unknown	unknown	gnl\|CDD\|226231
NZ_ASRD01000080.1\|WP_003095483.1\|68840_69380_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225167
NZ_ASRD01000080.1\|WP_003095515.1\|60550_61240_-\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_ASRD01000080.1\|WP_003095526.1\|53923_54427_-\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237322
NZ_ASRD01000080.1\|WP_023117901.1\|57873_59190_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_ASRD01000080.1\|WP_003095517.1\|59180_60572_-\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_ASRD01000080.1\|WP_003095492.1\|67956_68364_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377850
NZ_ASRD01000080.1\|WP_034020332.1\|55444_56545_+\|ferredoxin-reductase	unknown	unknown	gnl\|CDD\|99812

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000080.1\|WP_003161310.1\|62054_62669_+\|cytochrome-b/b6-domain-containing-protein	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	1.20616e-69
NZ_ASRD01000080.1\|WP_003095488.1\|68407_68752_-\|osmotically-inducible-lipoprotein-OsmE	gnl\|CDD\|183058	PRK11251, PRK11251, osmotically-inducible lipoprotein OsmE.	1.90142e-51
NZ_ASRD01000080.1\|WP_003099398.1\|70125_71391_-\|Hsp70-family-protein	gnl\|CDD\|212673	cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins. This bacterial subfamily includes the uncharacterized Escherichia coli YegD. It belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. YegD lacks the SBD. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some family members are not chaperones but instead, function as NEFs for their Hsp70 partners, other family members function as both chaperones and NEFs.	0
NZ_ASRD01000080.1\|WP_003121132.1\|56541_57654_+\|fatty-acid-desaturase	gnl\|CDD\|225779	COG3239, DesA, Fatty acid desaturase [Lipid metabolism].	7.76501e-66
NZ_ASRD01000080.1\|WP_003095479.1\|69534_69951_+\|hypothetical-protein	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	1.76735e-18
NZ_ASRD01000080.1\|WP_038819962.1\|71597_72461_+\|oxaloacetate-decarboxylase	gnl\|CDD\|225311	COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism].	1.91128e-86
NZ_ASRD01000080.1\|WP_003161312.1\|62665_63433_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	7.66842e-96
NZ_ASRD01000080.1\|WP_003107570.1\|54656_55286_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|236881	PRK11202, PRK11202, HTH-type transcriptional repressor FabR.	4.59942e-41
NZ_ASRD01000080.1\|WP_003161885.1\|64094_64628_-\|bacterioferritin	gnl\|CDD\|225104	COG2193, Bfr, Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism].	1.30318e-50
NZ_ASRD01000080.1\|WP_003112310.1\|64926_66996_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	0
NZ_ASRD01000080.1\|WP_003095496.1\|66997_67810_-\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	gnl\|CDD\|226231	COG3708, COG3708, Uncharacterized protein conserved in bacteria [Function unknown].	1.65802e-48
NZ_ASRD01000080.1\|WP_003095483.1\|68840_69380_-\|MOSC-domain-containing-protein	gnl\|CDD\|225167	COG2258, COG2258, Uncharacterized protein conserved in bacteria [Function unknown].	5.52525e-29
NZ_ASRD01000080.1\|WP_003095515.1\|60550_61240_-\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	2.43467e-112
NZ_ASRD01000080.1\|WP_003095526.1\|53923_54427_-\|urease-accessory-protein-UreE	gnl\|CDD\|237322	PRK13261, ureE, urease accessory protein UreE; Provisional.	2.44267e-58
NZ_ASRD01000080.1\|WP_023117901.1\|57873_59190_+\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.80524e-107
NZ_ASRD01000080.1\|WP_003095517.1\|59180_60572_-\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_ASRD01000080.1\|WP_003095492.1\|67956_68364_+\|hypothetical-protein	gnl\|CDD\|377850	pfam07498, Rho_N, Rho termination factor, N-terminal domain. The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It it thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers. This domain is found to the N-terminus of the RNA binding domain (pfam07497).	0.000208897
NZ_ASRD01000080.1\|WP_034020332.1\|55444_56545_+\|ferredoxin-reductase	gnl\|CDD\|99812	cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	3.1744e-85

>NZ_ASRD01000080.1|WP_003161312.1|62665_63433_+|molybdopterin-dependent-oxidoreductase
MKGPEKKRAKIAVDPSSERQMVDLQRRLLLRGGLSLGALAMLSGCRLQDGDSVDKVLWAMSRWNDRVQAWLFSRMRLAPTFDPSQVASPFPFNAFYPAYNVPEIDLPEYRLQVSGRVRDKRPWSLEQLRRLPQASQVTQLICIEGWSAIGQWSGVPLRTFLELVGADTSAKYVGFKCADRYYSSLDMPSALHPQTLLALEMSGQALPEENGYPLRLRIPTKLGFKNAKHVVEIFVSNSNPGGYWEDQGYNWFSGV
>NZ_ASRD01000080.1|WP_003161310.1|62054_62669_+|cytochrome-b/b6-domain-containing-protein
MNRALHAWPVRLCHWLNAYAMACLIGSGWGIYNASPLLDFRFPAWATLGGWLGGSIAWHLAAMWLLLGNGLCYLAHGLSSGHFRRDFLPLSAAGVWRDLRLALGLRLVHEPGRYNAVQRLLYWLVLALGALLVLSGLAIWKPVQLHGLTALFGGFQGARWVHFLAMAGVVGFVVVHLLLVLLVPRTLLPMIIGREWRRGRRSEG
>NZ_ASRD01000080.1|WP_003095513.1|61377_62001_+|hypothetical-protein
MLRLKASPALLFGLLLASAASFAAQPPAGMLQPLRGTIQQAADDHLQLKARNGQQLTVRLTDKTAIRAVSLAKPEDIQPDSFIGTAAVPQPDGTLKALEVHVFAPSLRGSGEGHRPWENADGSASTMTNGTVGNLVVSQGRRMTVKYGDGEKTVVVPDDVPIVSLEPGERSLLKPGAKVVLFPQKGADGSLTALAISVGKDGVTPPM
>NZ_ASRD01000080.1|WP_003095515.1|60550_61240_-|heavy-metal-response-regulator-transcription-factor
MRILVIEDDTKTGEYLKKGLGESGYAVDWSQHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTARDQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLQLDVLRRKVSRQGQVIALTNKEFALLHLLMRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP
>NZ_ASRD01000080.1|WP_003095517.1|59180_60572_-|heavy-metal-sensor-histidine-kinase
MPARRSLTLYAALLFAAVAALVVSAVGFYLYRSVEEAMLRRSDVMVAGRVEHFRNLLRDNLTLAELKARPRLFENMLGNEQDILLLGQPGEAPIVAVNPRHERLPSLRVVAAGQALNPSVVHAALTHDGIPMRVLAAEVLVGGREPLQITAAHLLLGETRMLAQYRDRVIAAVLLAFLGTALLGWLVLRHGLRPLRTLAAKAAEIHPTSLDTRLDVAAAPAELQQVAQSFNAMLERLDDGYQRLQQFSADLAHEIRTPIGSLMGHGQVALRQPRSNEEYQALIASNQEELERIARMVESILFLARADDVRAAVERSRLDLGEELRRQAEYFEGLAEERGLSLDIQVSGQLRADPQLFRRALSNLLANAIRYASADSLIEVRGLRRSGEFLLSVENACDRLPAEPLSRLFDRFYRGDAARSDAQSSGLGLAIVQAIMRLHGGRAEASAPAPGRIRFDLAFPAQD
>NZ_ASRD01000080.1|WP_023117901.1|57873_59190_+|MFS-transporter
MFSPLVTFPALYTATLLMLAGSGLFTTYIGLRLTQEGAGDLWVGGLMASYYFGLVCGGKFGHKLIASFGHIRSYVACAGIATVTVLLHALVDQLEVWLLLRFITGAVMMNQYMVIESWLNEQAESHQRGKVFAGYMVAVDLGLVLGQGLLALSPTLDYKPLLLVAICFASCLIPLAMTRRVHPAKLVAAPLEVRFFWQRVPQALGTIFIAGLMVGAFYGLAPVYANRNGLDASQSSFFVGMCIVAGFCAQWPLGWLSDRLDRSWLIRGNAVLLCLASIPMWGLVTLPYWLLLANGFVTGMLLFTLYPLAVALANDHVEQPRRVALSAMLLTTYGVGACIGPLVAGALMRHFGPGLFYMLVSGYAVLLVFWVQPKRVTGEHRVDEAPLQHVAMPDTVSPMAATLDPRVEEVPEELVVEAPANIGRSDGELDAGEKPAQS
>NZ_ASRD01000080.1|WP_003121132.1|56541_57654_+|fatty-acid-desaturase
MNRPASPAMRDDRELTPEQLAAFGAELDALRLRTLADLGADDARYIRRVRAAVRVCCWSGRALLMFGWLPPTWLLGSLLLGLGKILENMELGHNVMHGQYDWMNDPEFAGRAYEWDIAGPSDFWRHTHNHIHHTYTNVLGKDDDVGYGVVRLFPEQRWKPFYRWQPLWVTLQALLFQYAVAIQHLRLDKYAKGRLDKAELMPLLRRLRAKLGRQWTKDYLLFPLLGLFAGGFGAVFVGNLLANVLRNLWTFTVIFCGHFTEKAVVFPPSVLEGETRGHWYLRQLRGSSNLEGGPLFHILTGNLSHQIEHHLYPDLPARRYAALSREVREIARRYGQTYNSGRLGRQFLTVLRRIWVYRLPPREPLPAGRG
>NZ_ASRD01000080.1|WP_034020332.1|55444_56545_+|ferredoxin-reductase
MALLPLALLTPLLAPLRRLAARGWLREADVDGLLRHAHLLASLNRHYARVEARYWVADDMLALALRTAPGWPPARPGQHIQLLAERDGVRVGRSYSLTRVVGERLEIAVKRHPDGLLSPWLCEHLAVGQRVELQPAQGDLRWPMQAEAVCLLAAGSGLTPLLGLLREALENGYRGPVLWLHYVRHPGQRAWLGELEALAARHPNLELRWSLTRGARADGCLEGHFQPRHLDGWAADLARSQALACGPAAFVEAVGEQLGARFAGLQTESFSVPRWRSGEAPREVRLRFARSQREVSGDSAASLLEQAEAHGLRPAHGCRQGICASCTCVLLSGCVRDLRSGALCSEPGQPIRLCVSAAHGDLALDL
>NZ_ASRD01000080.1|WP_003107570.1|54656_55286_-|TetR-family-transcriptional-regulator
MSSPRAEQKQQTRHALMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHFSDMDQLGLALVAEVDETFRATLRAVRRNEFELGGLIDASVRIFLDAVGANRSQFLFLAREQYGGSLPIRQAIASLRQRITDDLAADLALLNKMPHLDGAALDVFADLVVKTVFATLPELIDPPAADLPPHLMPAAKITHQLRFIMIGGKHWHGLPG
>NZ_ASRD01000080.1|WP_003095526.1|53923_54427_-|urease-accessory-protein-UreE
MLVIHQRLPARSPRWDEELHLTYEARSKSRLRCFAASGEEVGLFLERGQPPLADGDCLEARDGRLVRVVARSERLLHVTCASPLELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQLGATVEAIEAPFQPEHGAYGGGHHHSHHGEAEFNYAPRLHQFGVRR
>NZ_ASRD01000080.1|WP_003161885.1|64094_64628_-|bacterioferritin
MTTAQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQEMQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILAQEEEHADDMADILDDLA
>NZ_ASRD01000080.1|WP_003112310.1|64926_66996_+|AsmA-family-protein
MTRGRKILTWSLASLVLLLAALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFSAEDITLGNPEWTAGKTKASEFASLERIEFRLAPLPLLWQTIRIPQIKLTQPRAELLRLADGRANWDFDLPASDSDEPSAWQLDIREIGFDKGSVSLDDQRLKTRLEVLVDPLGKPVPFGQLAGKALATGDAANAQDYVFGWKVKGTYKGQALAGSGKVGGMLALQDASKPFPLQAEVSAGSTRAAVVGTLTDPLNLGALDLRLKLSGTSMANLYPLTGITLPDTPAYSTDGHLLARLKEEGGALFRYENFNGKVGASDLHGSLTFVARQPRPKLSGKLTSEQLRFADLGPLIGADSNAEKQKRGQTSRQPGDKVLPVEEFRTERWRDMDADVEFTGKRIVHSDQLPISDLYTHLVLNDGLLRLEPLRFGVAGGKLESDIRLDGGKQPMQSRVKMSARGFKLKQLFPGFAPMQTSFGELNGDASLSGSGNSVAKILGGADGELKMLINDGAISKGLTEIAGLNVGNYLVTKLFGDDEVKINCAAADFGLQKGLMTSRLFVFDTENALVNVDGTVNFANEKLDLDVTPHSKGLRIFSLRSPLYVRGTFAKPDAGVHAGPLVARGAGMIALGVTVGPAASLLALVAPSKSDDNQCTALLQRMRLPAKVPAGKR
>NZ_ASRD01000080.1|WP_003095496.1|66997_67810_-|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR
MLTIGQLARIFEISTKTLRHYDAIGLFVPARTGSDNGYRYYQPEQIEQLSRILALRRLDVPLEAIDRLKRDGALDDPQRLRHFLQRHQHTLREEISARQRLLAELDRTLATLAHWRIRNMHARIVERPAFSVVGMEYFGSAPGDTIGQLWERFIPREHEIAGKHDPEVSYGICAQQPNGEFHYVAGFEVQEGWPVPEGMVRFQVPAQKYAVFTHKGTAPQIAESFQAIYSHLLAERGLEPKAGVDFEYYDQRFRGPLDPNSQVDLYIPIY
>NZ_ASRD01000080.1|WP_003095492.1|67956_68364_+|hypothetical-protein
MPRGDKSKYSDKQQRKAEHIEESYKAKGVSESEAEARAWATVNKQSGGGERKGGSGRAKSETAKRADRKDSAHRAAQARSGRPANRGSASRGKRQGSTSVSEMTREELMQLARKRDIRGRSTMRKAELIEALSRA
>NZ_ASRD01000080.1|WP_003095488.1|68407_68752_-|osmotically-inducible-lipoprotein-OsmE
MYKQSLAALFVMATLAGCASTKVQNPVNYITFRNEPLVKDVEKGMSQQEVLRIGGTPSGTQKRLMKPGSCNSYILNKDGQQQPFYVSFDGSGKVDGSGFLSCSELDRHERDARP
>NZ_ASRD01000080.1|WP_003095483.1|68840_69380_-|MOSC-domain-containing-protein
MQQVIAVSLCATHAFSKQVRPAIRLLKGLGVEGDAHHGVTVKHRSRVRQDPTQPNLRQVHLIHEELHDELRASGFAIGPGTMGENITTRGVDLLGLPTGTRLRLGESALVELTGLRNPCSQLDNYQPGLTAAVLGRDEQGNLIRKAGVMAIVLEDGEVRPGDAIDIQLPPLPHRALEKV
>NZ_ASRD01000080.1|WP_003095479.1|69534_69951_+|hypothetical-protein
MNILRIPMFVLAMAVSAHGFAATAQQEKMTACNAEATTKALKGDERKAFMSGCLKAGAPAGGKATAQQEKMKSCNADASAKSLKGDERKAFMSSCLKAGGSAKAATQQEKMKTCNADATAKALKGDERKAFMSTCLKK
>NZ_ASRD01000080.1|WP_003099398.1|70125_71391_-|Hsp70-family-protein
MNPSTAARALGIDFGTSNSTVGWWRPEVEPLIELEDGKITLPSVVFFNVEERRPVYGRQALGEYLEGYEGRLMRSLKSLLGSKLLKSETTVLGSALPFKDLLGLFIGQLKARGEAAAGQAFDAVVLGRPVFFVDDDPEADREAQDTLVQVANKLGFKEVSFQYEPIAAAFDYERCIQREELVLIVDIGGGTSDFSLVRLAPERRNLAERQDDILATGGVHIGGTDFDKQLSLEGVMPLFGYGSRMKSDAFMPTSYHLNLATWHTINAVYAQKSQLALKNMRYDIVDSTGIDRLFRLIEERAGHWLAMQVEDSKIRLTETERLHLSLERIEAGLGVELTRGLFENAVDGLLERVRNSVAQLLASAGVDPDRVDTVFFTGGSSGIPALRRSVSAMLPNARHVEGNLFGSIGSGLAIEAKKRYG
>NZ_ASRD01000080.1|WP_038819962.1|71597_72461_+|oxaloacetate-decarboxylase
MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQAARIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVVVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEYQAWARDCMEVKE
>NZ_ASRD01000080.1|WP_073653058.1|72552_73167_-|hypothetical-protein
MMGPFRRLAHLIDQGRQLDATLAGDPFALPAPEDRYSVRQLHGLYPRRHPGLYAPLLGSLALLLGAAPLGLAALRLALPEAPLRPLGWLSALPLLAAWLWLIALLSRGASLGPRLARDASLLLVGTGLLLRLASGETSGLVALGGGACAWLLFNSRAMQRYMELVYAQRLYRAQSANRPGSAQRRLANQAAYRERKRRERSGRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

15. NZ_ASRD01000111

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_ASRD01000111_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_ASRD01000111_1

30594-30690

Orphan

Consensus_repeat	Method
GGCGTTATCCGCCGATACACCGAAGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_ASRD01000111_1

>merge|NZ_ASRD01000111|1|30594-30690|CRISPRCasFinder
GGCGTTATCCGCCGATACACCGAAGCCCTACGCGATGCCCACCCTTGGGGTAGGGCGAATAACGCCATGGGCGTTATCCGCCGATACACCGAAGCCC

>NZ_ASRD01000111|1|1|30594-30690|CRISPRCasFinder
GGCGTTATCCGCCGATACACCGAAGCCC	TACGCGATGCCCACCCTTGGGGTAGGGCGAATAACGCCATG
GGCGTTATCCGCCGATACACCGAAGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_ASRD01000111.1\|WP_034019894.1\|30739_32086_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_ASRD01000111.1\|WP_003101858.1\|41547_42216_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380064
NZ_ASRD01000111.1\|WP_003084062.1\|22340_23123_+\|CoA-transferase-subunit-beta	unknown	unknown	gnl\|CDD\|224968
NZ_ASRD01000111.1\|WP_003084073.1\|28566_29508_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_ASRD01000111.1\|WP_003084082.1\|34479_35295_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
NZ_ASRD01000111.1\|WP_003112675.1\|25794_27174_+\|3-carboxy-cis,cis-muconate-cycloisomerase	unknown	unknown	gnl\|CDD\|181627
NZ_ASRD01000111.1\|WP_031631613.1\|27188_27980_+\|3-oxoadipate-enol-lactonase	unknown	unknown	gnl\|CDD\|131480
NZ_ASRD01000111.1\|WP_017148897.1\|36348_37614_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_ASRD01000111.1\|WP_003101861.1\|37679_39005_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_ASRD01000111.1\|WP_014602360.1\|42255_43110_-\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|183586
NZ_ASRD01000111.1\|WP_038820091.1\|24473_25772_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182433
NZ_ASRD01000111.1\|WP_034019891.1\|39550_41455_+\|TIM-barrel-protein	unknown	unknown	gnl\|CDD\|225726
NZ_ASRD01000111.1\|WP_003084057.1\|20802_21342_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_ASRD01000111.1\|WP_003101871.1\|33413_34457_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_ASRD01000111.1\|WP_003101885.1\|29698_30532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_ASRD01000111.1\|WP_003101874.1\|32391_33171_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_ASRD01000111.1\|WP_019681270.1\|23119_24325_+\|3-oxoadipyl-CoA-thiolase	unknown	unknown	gnl\|CDD\|181624
NZ_ASRD01000111.1\|WP_003101866.1\|35444_36323_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_ASRD01000111.1\|WP_003084060.1\|21492_22344_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
NZ_ASRD01000111.1\|WP_003084072.1\|27990_28392_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478

Protein	Function_ID	Function_description	E-value
NZ_ASRD01000111.1\|WP_034019894.1\|30739_32086_-\|MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	6.51442e-150
NZ_ASRD01000111.1\|WP_003101858.1\|41547_42216_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380064	pfam17938, TetR_C_29, Tetracyclin repressor-like, C-terminal domain. This domain is found in the C-terminal region of putative TetR-family regulatory proteins.	1.32593e-55
NZ_ASRD01000111.1\|WP_003084062.1\|22340_23123_+\|CoA-transferase-subunit-beta	gnl\|CDD\|224968	COG2057, AtoA, Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit [Lipid metabolism].	2.86135e-82
NZ_ASRD01000111.1\|WP_003084073.1\|28566_29508_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.31699e-45
NZ_ASRD01000111.1\|WP_003112675.1\|25794_27174_+\|3-carboxy-cis,cis-muconate-cycloisomerase	gnl\|CDD\|181627	PRK09053, PRK09053, 3-carboxy-cis,cis-muconate cycloisomerase; Provisional.	0
NZ_ASRD01000111.1\|WP_031631613.1\|27188_27980_+\|3-oxoadipate-enol-lactonase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.92468e-107
NZ_ASRD01000111.1\|WP_017148897.1\|36348_37614_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	0
NZ_ASRD01000111.1\|WP_003101861.1\|37679_39005_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.91219e-90
NZ_ASRD01000111.1\|WP_014602360.1\|42255_43110_-\|shikimate-dehydrogenase	gnl\|CDD\|183586	PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed.	2.75817e-178
NZ_ASRD01000111.1\|WP_038820091.1\|24473_25772_+\|MFS-transporter	gnl\|CDD\|182433	PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional.	0
NZ_ASRD01000111.1\|WP_034019891.1\|39550_41455_+\|TIM-barrel-protein	gnl\|CDD\|225726	COG3185, COG3185, 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only].	1.54953e-164
NZ_ASRD01000111.1\|WP_003084057.1\|20802_21342_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.10984e-24
NZ_ASRD01000111.1\|WP_003101871.1\|33413_34457_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	2.89973e-60
NZ_ASRD01000111.1\|WP_003084082.1\|34479_35295_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	3.04586e-22
NZ_ASRD01000111.1\|WP_003101874.1\|32391_33171_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.10427e-66
NZ_ASRD01000111.1\|WP_019681270.1\|23119_24325_+\|3-oxoadipyl-CoA-thiolase	gnl\|CDD\|181624	PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated.	0
NZ_ASRD01000111.1\|WP_003101866.1\|35444_36323_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	8.8898e-13
NZ_ASRD01000111.1\|WP_003084060.1\|21492_22344_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	5.98071e-84
NZ_ASRD01000111.1\|WP_003084072.1\|27990_28392_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	9.24e-69

>NZ_ASRD01000111.1|WP_003101885.1|29698_30532_+|hypothetical-protein
MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPDKFAKRIYSFTHADGYRYGSNFFNLDVFLSDNRDPRKGTDHGGSEVYAVYRHQLYASRVFDRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKNHFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKDTAAETLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF
>NZ_ASRD01000111.1|WP_003084073.1|28566_29508_+|LysR-family-transcriptional-regulator
MSRKLHIHAPAIHYFDMVRRCHSIREAARRLNVASSAVNRQILKLEDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLRTGHVEIATIEAVTSDLLPCVLKAMRERYPDITVGVTLLGSQAIPEAVSSGAVDLGLAFALPRSADLQQVSVGHFRLGAIVSPQHPLARHQAIAFADCVEHGLIMAKSELSIHHLLAPLQRRLREPRRAVLESSSLELSRQLARRGLGVAFQTRLGIEADIAQGELRFLPLKDNGGIHSDLGLYVRTGRYLPVAVDALARQIAEEVRLREREEARLNEA
>NZ_ASRD01000111.1|WP_003084072.1|27990_28392_+|4-carboxymuconolactone-decarboxylase
MDEKQRYEAGMQVRRAVLGDAHVERSLANLTPFNEEFQEMITRHAWGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSAIYCGIPAANATFHLAESVWDELGVESQQASR
>NZ_ASRD01000111.1|WP_031631613.1|27188_27980_+|3-oxoadipate-enol-lactonase
MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPALTAHFRVLRYDIRGHGASLVTPGPYAIGQLGADVLALLDALELPRVHFCGLSMGGLIGQWLGIHAGERLGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASVARWFTAGFAEREPAQVERIVAMLAATSPQGYAANCAAVRDADFREQLGLVQAPTLIVAGSHDAVTTPDNARFMQARIADAQLVEFAAAHLSNVEAGDAFSRRLVDFLLSA
>NZ_ASRD01000111.1|WP_003112675.1|25794_27174_+|3-carboxy-cis,cis-muconate-cycloisomerase
MSDVPANQLFDAYFMAAPMRAVFSDRGRLQGMLDFEAALARAEARTGVVPATAVAPIEAACRAELYDPLALAEAVATAGNSAIPLVKALGRQVAAGDAEAERYVHLGATSQDAMDSGLVLQLRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATPVTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALAEELGLALPEQPWHTQRDRLVEFASVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSSTMPHKRNPVSSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVAGALQQAIGLLEGLEVDAQRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRAVEQRRELRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHHALGFEPHPA
>NZ_ASRD01000111.1|WP_038820091.1|24473_25772_+|MFS-transporter
MTAPVHQYSNEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAGSLAIACMPTYASIGTLAPALLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASFQYVTLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLSETASKSTLERKESGTFAELFKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASAVMTFALLAYMLMQPLFGMLSDRIGRKTSMLWFGTLGTLCTLPILLALKTVSSPYMAFFLIILALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGLKSVGMENVFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP
>NZ_ASRD01000111.1|WP_019681270.1|23119_24325_+|3-oxoadipyl-CoA-thiolase
MSREVFICDAVRTPIGRFGGSLSAVRADDLAAVPLKALVERNPGVDWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAFRAIACGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYGIDPMPQTADNVADDYRVSRADQDAFALRSQQRAGRAQEAGFFAEEIVPVTIRGRKGDTLVEHDEHPRPDTTLEALARLKPVNGPERTVTAGNASGVNDGAAALVLASAEAVEKHGLTPRARVLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACLRELGVADDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQGLALAIERV
>NZ_ASRD01000111.1|WP_003084062.1|22340_23123_+|CoA-transferase-subunit-beta
MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPDVVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQVDRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVTSVGHGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAIRFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE
>NZ_ASRD01000111.1|WP_003084060.1|21492_22344_+|CoA-transferase-subunit-A
MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKDLTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEHSHADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVIHAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVCLVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEGKR
>NZ_ASRD01000111.1|WP_003084057.1|20802_21342_+|helix-turn-helix-domain-containing-protein
MSMRLKLLRKKLGVTLETLADKTGLTKSYLSKVERGLNTPSIAAALKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLPFIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRSLGETQAELLVVIHSDE
>NZ_ASRD01000111.1|WP_034019894.1|30739_32086_-|MFS-transporter
MNSPSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDTAAMGFIAPALTRDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVFLFGLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFCGFNLGMACGGFVSAKLIPLFGWHSLLLLGGLLPLVLAVVLLFRLPESARYLVVRNRGSERVRQVLAPIAPAQVALARSFHVPEQQTVQARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYLLTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGVFAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG
>NZ_ASRD01000111.1|WP_003101874.1|32391_33171_+|IclR-family-transcriptional-regulator
MAGSLIERALGLLELLASDARGLPLQQLADRLDIPKSAAHRMLAELIRLGYVRQDDDTSRYRLSTRLAALGFRFLASSGVVDLVQPVLDGLARETGELVRLGVIEGDRQTWIAKSQGATSGLRYDPDMGREAPLFYTASGHAWLASLSDKAALALVERQGVGAARDFGPNAPRSRSELLRYLKRAREHGYAWQIECSAPGMAAMAALVRHPEDGRALGVLSVAGPSARFGEARMHELAPLLLAAAQDLSHASQASELFR
>NZ_ASRD01000111.1|WP_003101871.1|33413_34457_+|Gfo/Idh/MocA-family-oxidoreductase
MDAPLRIALIGAGNMGRQHYHRLQRIAGARLCAVADPQGQAFAADAGVPWFGDHRRLLEEARPQAAIVANPNNLHVATALDCLAAGVPLLLEKPVGVQLDEVSELVAVARRSGVPLLVGHHRRHNPLVVRARQLIAEGALGRLLSVTALWQLKKPDSYFEVAWRREPGAGMLLTNLIHDLDLLRHLCGEVREVQALAGNAIRGLPNEDNIALLLRFANGALGSLTGCDAAAAPWSWELAAGENPVYPRQAEQPCYLLAGTEGALSLPQLRRWRYAEARQGWHDPLAASVEAVATGDPLQRQLEHFVRVARGEEAPLMDATDAARTLALVEAVREAARSGRACAPASF
>NZ_ASRD01000111.1|WP_003084082.1|34479_35295_+|sugar-phosphate-isomerase/epimerase
MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEHHYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLVAGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLLLDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGLDLLALLRALPENLPLSLEVPALDLLARGVDGAERARLAIERTRALLARL
>NZ_ASRD01000111.1|WP_003101866.1|35444_36323_+|DMT-family-transporter
MNASTSPLPASDQTLRGILLICAAVFLFASHDGLSKFLSGFYPIVMVVWARYLVHTLLMVAVFVPRNGLAVIRSRRPLMQLARALCLIGTSLFFTTGLRYLPLAEATAVNFLAPLLVTALSVPLLKEKVSLGQWLAVLTGFIGVLFIVRPGGALFTPAALFPLGSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLMMIALGGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHVPDAWALLGILVICASGLVVAWRRGR
>NZ_ASRD01000111.1|WP_017148897.1|36348_37614_-|OprD-family-porin
MSHPSHVRALCASLCLGAGLPVHAGHVHAGQGFLEDAKASLTVRNFHLHRNFVGDASQDKTEEWTQSFILDAHSGFTQGSVGFGLDVLGLYSLKLDGGKGTAGTQLLPIHDDGRPADDFGRLAVAGKLRVSNSELKIGEWMPVLPILRSDDGRSLPQTFRGGQLSANEIAGLTLYAGQFRGNSPRNDASMQDMSLFGRPAATSDRFDFAGGEYRFNGERSLLGLWNAELKDIYRQQYLQLQHSQPLGDWLLGANLGGFRGRDAGSARAGKLDNRTVSALFSARYGLHSLYLGLQKVSGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFVGLGLPGLTFMTRYLHGDHVRLAGVTDDGSEWGRESELGYTLQSGAFKRLNVRWRNSSQRRDWGSNTRFDENRLIVSYPLSLL
>NZ_ASRD01000111.1|WP_003101861.1|37679_39005_-|MFS-transporter
MIHSSSSRLLAADAPRESRGGRIRNAFAVGRTRWGMLALVFFATTLNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDKVGVKRAFFLAVLLWSLATGAHGLATSAAGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGIFNAGTNVGAMVTPALLPLILGVWGWQAAFLCMSALGLVWLVFWWRNYYNPEEHPRVKQSELEYIQQQEEPPATRVPFSQILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYGLGISVTQMGIPLILIWLTADFGSVGGGILSSWLIGRGMPAIRARLLSMLLFACTIVGVVFAANASGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPKHLMSTVFGFGGMCAALGGMFMTQIVGGVLTATNNNYAVLFTMIPAMYFIALTWLYFMAPRRIEA
>NZ_ASRD01000111.1|WP_034019891.1|39550_41455_+|TIM-barrel-protein
MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLHYDGSPRDVRRLCADLDLEILLFQPFRDFEGCRRERLERNLERAERKFDLMQELGTDLVLVCSNVAADALGEPALLADDLRQLAERAAVRGLRIGYEALAWGRQVNTWEQAWDLVRRADQANLGLILDSFHTLSLDGDPRGIADLPGEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGFDLAGFLAPVVASGYRGPLSLEVFNDGFRAAPTRANAVDGLRSLLYLEDKTREHLQRQTPHVAVDELFAPPPASLCDGIEFLEFAVDETLSARLGQWLQRLGFARAGEHRSKNVSLLRQGDINLVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALERARAYGGQPYRGLLGPNEREIPAVRALDGSLLYLVERHTEGRSIYDSDFVTNDADTSGLGLRRVDHVALALPAEGLDSWVLFYKSLFDFGADDEVVLPDPYGLVTSRAVRSPCGSVRLPLNISEDRNTAIARSLSSYRGSGVHHIAFDCADIFAAVAQAKEAGVALLEIPLNYYDDLAARFDFDDEFLSELAYYNVLYDRDAQGGELFHVFTEPFEERFFFEILQRRHDYAGYGAANVPVRLAAMAQARRGVRRVKL
>NZ_ASRD01000111.1|WP_003101858.1|41547_42216_+|TetR/AcrR-family-transcriptional-regulator
MSKPDPAVVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLSGARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAMEKLVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEAEGVFRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRRMIGEAVLRYIRA
>NZ_ASRD01000111.1|WP_014602360.1|42255_43110_-|shikimate-dehydrogenase
MSAPRSVLAGLIGAGIQASRTPALHEREGDAQGIRYLYRLIDLDPLGKSADDLEFLLAAASDLGFTGLNVTFPCKQAIIPLLDDLSAEARGIGAVNTVVLRDGRRIGHNTDCLGFAEGFRRGLADAPRQRVVQMGAGGAGAAVAHALLAEGVERLVLFDVDPARAQALADNLNQHFGAPRALAGSDLAGALGDAQGLVNTTPVGMAKLPGMPVPAELLRADLWVAEVIYFPLETELLRQARALGCRTLDGGTMAVFQAVKAFELFSGVAADAARMQAHFASLGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage