CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_KI913075	Enterococcus faecalis EnGen0422 adiGh-supercont1.2, whole genome shotgun sequence	1 crisprs	DEDDh,csa3	0	4	0
NZ_KI913073	Enterococcus faecalis EnGen0422 adiGh-supercont1.13, whole genome shotgun sequence	1 crisprs	NA	2	0	0
NZ_KI913074	Enterococcus faecalis EnGen0422 adiGh-supercont1.14, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_KI913069	Enterococcus faecalis EnGen0422 adiGh-supercont1.1, whole genome shotgun sequence	0 crisprs	cas3,DinG	0	8	0
NZ_KI913081	Enterococcus faecalis EnGen0422 adiGh-supercont1.8, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_KI913077	Enterococcus faecalis EnGen0422 adiGh-supercont1.4, whole genome shotgun sequence	0 crisprs	csa3,cas3	0	0	0
NZ_KI913080	Enterococcus faecalis EnGen0422 adiGh-supercont1.7, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_KI913082	Enterococcus faecalis EnGen0422 adiGh-supercont1.9, whole genome shotgun sequence	0 crisprs	NA	0	0	2
NZ_KI913076	Enterococcus faecalis EnGen0422 adiGh-supercont1.3, whole genome shotgun sequence	0 crisprs	DinG,DEDDh,csa3	0	2	0
NZ_KI913072	Enterococcus faecalis EnGen0422 adiGh-supercont1.12, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_KI913071	Enterococcus faecalis EnGen0422 adiGh-supercont1.11, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_KI913070	Enterococcus faecalis EnGen0422 adiGh-supercont1.10, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_KI913078	Enterococcus faecalis EnGen0422 adiGh-supercont1.5, whole genome shotgun sequence	1 crisprs	NA	7	2	0
NZ_KI913079	Enterococcus faecalis EnGen0422 adiGh-supercont1.6, whole genome shotgun sequence	0 crisprs	WYL	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

183 : 17709

Streptococcus_phage(94.44%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001291561.1\|183_1401_-\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|1482_1686_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001845478.1\|1669_1921_+	hypothetical protein	NA	NA	NA	NA
WP_000857133.1\|2146_2377_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|2373_2796_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_013670292.1\|3024_3096_-	hypothetical protein	NA	NA	NA	NA
WP_001227347.1\|3300_3654_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_011058338.1\|3713_3899_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_002414694.1\|3999_5919_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A2K5B2A5	Erysipelothrix_phage	0.0e+00	99.7
WP_012386611.1\|5934_6021_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224320.1\|6295_7231_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_000769868.1\|7227_8229_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|8225_10403_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|10405_12853_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|12836_13343_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|13317_13815_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|13931_14153_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|14195_15401_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|15423_15576_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|15578_16964_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|16992_17379_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|17394_17709_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0

DBSCAN-SWA_2

324351 : 368505

Enterococcus_phage(26.09%)

terminase,portal,holin,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002356529.1\|324351_325005_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002356528.1\|325047_325698_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002362558.1\|325911_327858_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.4e-56	32.2
WP_002356525.1\|327872_328505_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002356523.1\|328687_329896_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-27	35.4
WP_002356521.1\|329888_331598_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002388394.1\|331881_332592_-	YcjF family protein	NA	NA	NA	NA
WP_002362556.1\|332735_333638_-	diacylglycerol kinase family lipid kinase	NA	NA	NA	NA
WP_002362555.1\|333760_334774_-	hypothetical protein	NA	NA	NA	NA
WP_002356517.1\|334915_336064_-	glycerate kinase	W6LM47	Streptococcus_phage	6.8e-43	36.7
WP_002379729.1\|336085_337378_-	GntP family permease	NA	NA	NA	NA
WP_002362276.1\|337487_338171_-	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_002362553.1\|338320_339394_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002356512.1\|339390_340227_-	ABC transporter permease	NA	NA	NA	NA
WP_002356510.1\|340226_341033_-	ABC transporter permease	NA	NA	NA	NA
WP_002356508.1\|341051_342137_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	7.6e-36	42.6
WP_002356507.1\|342162_342705_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002356506.1\|342968_343961_+	YhdH/YhfP family quinone oxidoreductase	NA	NA	NA	NA
WP_002359575.1\|343976_344750_+	phosphopantothenate--cysteine ligase	Q9HH70	Methanothermobacter_phage	3.4e-14	31.0
WP_002359573.1\|344746_345301_+	phosphopantothenoylcysteine decarboxylase	A0A1V0S7W6	Shearwaterpox_virus	3.1e-25	37.2
WP_002356501.1\|345304_345940_+	ECF transporter S component	NA	NA	NA	NA
WP_002384107.1\|345995_347201_-	aminoacyltransferase	NA	NA	NA	NA
WP_002356499.1\|347438_347945_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	8.5e-06	28.4
WP_033624714.1\|348180_349287_-	N-acetylmuramoyl-L-alanine amidase	V5URN7	Enterococcus_phage	2.2e-91	51.1
WP_002378446.1\|349299_349680_-\|holin	holin	A0A097QQ04	Enterococcus_phage	1.1e-61	100.0
WP_002368228.1\|349690_349813_-	XkdX family protein	NA	NA	NA	NA
WP_033624715.1\|349814_350192_-	hypothetical protein	NA	NA	NA	NA
WP_033624716.1\|350730_351471_-	hypothetical protein	A0A1X9IGH6	Lactococcus_phage	1.8e-28	36.6
WP_033624668.1\|351476_352922_-	peptidase M23	A0A1S5SA59	Streptococcus_phage	8.2e-70	36.5
WP_002363380.1\|352921_353644_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	6.0e-37	37.6
WP_033624669.1\|353640_358095_-\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	4.9e-89	48.7
WP_002364305.1\|358081_358387_-	hypothetical protein	NA	NA	NA	NA
WP_002409775.1\|358455_358854_-	hypothetical protein	NA	NA	NA	NA
WP_010784604.1\|358916_359225_-	hypothetical protein	C9E2K1	Enterococcus_phage	2.2e-09	53.3
WP_025194241.1\|359227_359833_-\|tail	phage major tail protein, TP901-1 family	A0A1X9IGH1	Lactococcus_phage	1.3e-21	35.6
WP_023042479.1\|359851_360244_-	hypothetical protein	NA	NA	NA	NA
WP_010816898.1\|360240_360579_-	hypothetical protein	A0A1X9IGH0	Lactococcus_phage	1.9e-14	40.0
WP_002378454.1\|360575_360851_-	hypothetical protein	NA	NA	NA	NA
WP_002363369.1\|360847_361180_-	hypothetical protein	A0A097BY74	Leuconostoc_phage	3.1e-09	38.9
WP_002363368.1\|361250_362147_-	hypothetical protein	U3PDP8	Lactobacillus_phage	3.3e-69	49.8
WP_002378456.1\|362160_362814_-	hypothetical protein	NA	NA	NA	NA
WP_033593778.1\|362918_363845_-	hypothetical protein	A0A097QPZ9	Enterococcus_phage	1.8e-131	98.4
WP_010784607.1\|363837_365322_-\|portal	phage portal protein	A0A097QPZ5	Enterococcus_phage	3.8e-139	99.6
WP_002369892.1\|365321_366605_-\|terminase	PBSX family phage terminase large subunit	Q9AZ91	Lactobacillus_prophage	6.0e-157	65.5
WP_002364295.1\|366585_367020_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-44	64.5
WP_002369893.1\|367051_367216_-	hypothetical protein	NA	NA	NA	NA
WP_050591810.1\|368097_368505_-	autolysin	D2IZL7	Enterococcus_phage	4.5e-66	98.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_KI913075

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_KI913075_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_KI913075_1

493969-494042

Orphan

Consensus_repeat	Method
ATAGTTGGCGAGCAACAGAAAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_KI913075_1

>merge|NZ_KI913075|1|493969-494042|CRISPRCasFinder
ATAGTTGGCGAGCAACAGAAAAACTCGATATAGAATTGGACGTAGAGCCAATAGTTGGTGAGCAACAGAAAAAC

>NZ_KI913075|1|1|493969-494042|CRISPRCasFinder
ATAGTTGGCGAGCAACAGAAAAAC	TCGATATAGAATTGGACGTAGAGCCA
ATAGTTGGTGAGCAACAGAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_KI913075.1\|WP_002354866.1\|503119_503491_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226923
NZ_KI913075.1\|WP_002354877.1\|489309_490023_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_KI913075.1\|WP_002414925.1\|484940_486245_-\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_KI913075.1\|WP_002354884.1\|486237_487506_-\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_KI913075.1\|WP_002354869.1\|497799_498354_-\|septum-formation-protein-Maf	unknown	unknown	gnl\|CDD\|238310
NZ_KI913075.1\|WP_002381060.1\|496083_497055_-\|ribose-phosphate-diphosphokinase	unknown	unknown	gnl\|CDD\|234929
NZ_KI913075.1\|WP_002354864.1\|503578_504376_-\|TIGR00282-family-metallophosphoesterase	unknown	unknown	gnl\|CDD\|379099
NZ_KI913075.1\|WP_002354860.1\|506488_507535_-\|recombinase-RecA	unknown	unknown	gnl\|CDD\|236476
NZ_KI913075.1\|WP_002365385.1\|483348_483603_-\|hypothetical-protein	unknown	unknown	unknown
NZ_KI913075.1\|WP_002404005.1\|490284_493029_+\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471
NZ_KI913075.1\|WP_002354883.1\|487714_488164_+\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|376605
NZ_KI913075.1\|WP_002354871.1\|497229_497667_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|234692
NZ_KI913075.1\|WP_002360992.1\|483906_484773_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224343
NZ_KI913075.1\|WP_002354875.1\|493043_493694_+\|beta-phosphoglucomutase	unknown	unknown	gnl\|CDD\|213672
NZ_KI913075.1\|WP_002394745.1\|488209_488914_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372694
NZ_KI913075.1\|WP_002354863.1\|504535_506092_-\|ribonuclease-Y	unknown	unknown	gnl\|CDD\|237177
NZ_KI913075.1\|WP_002380978.1\|500542_503119_-\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|235444
NZ_KI913075.1\|WP_002354873.1\|494943_495096_-\|putative-holin-like-toxin	unknown	unknown	gnl\|CDD\|319017
NZ_KI913075.1\|WP_002354868.1\|498378_500511_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|223400
NZ_KI913075.1\|WP_002354889.1\|482976_483339_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_KI913075.1\|WP_002354866.1\|503119_503491_-\|hypothetical-protein	gnl\|CDD\|226923	COG4550, COG4550, Predicted membrane protein [Function unknown].	8.72333e-15
NZ_KI913075.1\|WP_002354877.1\|489309_490023_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	6.92052e-137
NZ_KI913075.1\|WP_002414925.1\|484940_486245_-\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	4.48881e-85
NZ_KI913075.1\|WP_002354884.1\|486237_487506_-\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	1.15225e-51
NZ_KI913075.1\|WP_002354869.1\|497799_498354_-\|septum-formation-protein-Maf	gnl\|CDD\|238310	cd00555, Maf, Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or nucleic acid-binding protein with structural similarity to the hypoxanthine/xanthine NTP pyrophosphatase Ham1 from Methanococcus jannaschii, RNase H from Escherichia coli, and some other nucleotide or RNA-binding proteins.	1.6551e-85
NZ_KI913075.1\|WP_002381060.1\|496083_497055_-\|ribose-phosphate-diphosphokinase	gnl\|CDD\|234929	PRK01259, PRK01259, ribose-phosphate diphosphokinase.	0
NZ_KI913075.1\|WP_002354864.1\|503578_504376_-\|TIGR00282-family-metallophosphoesterase	gnl\|CDD\|379099	pfam13277, YmdB, YmdB-like protein. This family of putative phosphoesterases contains the B. subtilis protein YmdB.	2.68643e-155
NZ_KI913075.1\|WP_002404005.1\|490284_493029_+\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	1.16272e-173
NZ_KI913075.1\|WP_002354883.1\|487714_488164_+\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|376605	pfam01741, MscL, Large-conductance mechanosensitive channel, MscL.	2.8499e-49
NZ_KI913075.1\|WP_002354871.1\|497229_497667_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|234692	PRK00222, PRK00222, peptide-methionine (R)-S-oxide reductase MsrB.	2.48715e-93
NZ_KI913075.1\|WP_002360992.1\|483906_484773_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224343	COG1426, COG1426, Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown].	8.53832e-35
NZ_KI913075.1\|WP_002354875.1\|493043_493694_+\|beta-phosphoglucomutase	gnl\|CDD\|213672	TIGR01990, bPGM, beta-phosphoglucomutase. This model represents the beta-phosphoglucomutase enzyme which catalyzes the interconverison of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate. The 6-phosphate is capable of non-enzymatic anomerization (alpha <-> beta) while the 1-phosphate is not. A separate enzyme is responsible for the isomerization of the alpha anomers. Beta-D-glucose-1-phosphate results from the phosphorylysis of maltose (2.4.1.8), trehalose (2.4.1.64) or trehalose-6-phosphate (2.4.1.216). Alternatively, these reactions can be run in the synthetic direction to create the disaccharides. All sequenced genomes which contain a member of this family also appear to contain at least one putative maltose or trehalose phosphorylase. Three species, Lactococcus, Enterococcus and Neisseria appear to contain a pair of paralogous beta-PGM's. Beta-phosphoglucomutase is a member of the haloacid dehalogenase superfamily of hydrolase enzymes. These enzymes are characterized by a series of three catalytic motifs positioned within an alpha-beta (Rossman) fold. beta-PGM contains an inserted alpha helical domain in between the first and second conserved motifs and thus is a member of subfamily IA of the superfamily. The third catalytic motif comes in three variants, the third of which, containing a conserved DD or ED, is the only one found here as well as in several other related enzymes (TIGR01509). The enzyme from L. lactis has been extensively characterized including a remarkable crystal structure which traps the pentacoordinate transition state. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	7.1375e-106
NZ_KI913075.1\|WP_002394745.1\|488209_488914_-\|hypothetical-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	3.13542e-11
NZ_KI913075.1\|WP_002354863.1\|504535_506092_-\|ribonuclease-Y	gnl\|CDD\|237177	PRK12704, PRK12704, phosphodiesterase; Provisional.	0
NZ_KI913075.1\|WP_002380978.1\|500542_503119_-\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|235444	PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional.	0
NZ_KI913075.1\|WP_002354873.1\|494943_495096_-\|putative-holin-like-toxin	gnl\|CDD\|319017	pfam16935, Hol_Tox, Putative Holin-like Toxin (Hol-Tox). Hol_Tox is a family of small proteins (34-48aas) with a single TM region. Members can exhibit antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria.	6.38667e-13
NZ_KI913075.1\|WP_002354868.1\|498378_500511_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|223400	COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair].	0
NZ_KI913075.1\|WP_002354860.1\|506488_507535_-\|recombinase-RecA	gnl\|CDD\|236476	PRK09354, recA, recombinase A; Provisional.	0

>NZ_KI913075.1|WP_002354875.1|493043_493694_+|beta-phosphoglucomutase
MTIGFIFDLDGVITDTAKFHYQAWKALADSLGISIDETFNETLKGISRMDSLDRILAHGHRENAFTPAEKEALAQQKNDHYVQLLEHLTTEDVLPGVVPLLQQAQARHIPCAVASASKNAPLILEKLGVRAYFATIVDPDSLSKGKPDPEIFLAAADSIGVLPQNAIGFEDAQSGIDGLKAAGIYAVGLSASQPLIGADMQVSEMTELSVDALLNR
>NZ_KI913075.1|WP_002404005.1|490284_493029_+|glycoside-hydrolase-family-65-protein
MSIQVHKEAPNMTILELTFATNQLTTTFFNHKLEPLHQKTFPFEALTIEETVPELCQLIVAEAAPILGGIVADFPEDFFSPEETLALVPQAVIQAFAEQLNTPLLTAAEQVAAPNLLAAFEEKRQYLAWHLDYYGYVPGKNEYAVESLLTVGNGFLGLRGTTPEMTISDDHYPATYIAGLYNTAASEVAGQVVENEDFVNAPDNQHIALKIGDATDWLTISPDTLQQLHRQLNLKTGLFVAEMILKDADNQQIKLTTKKIANMAQPNDYHLQYTFEPLNFSAPITLKTVTDGSVYNYNVARYRNLTAKHFQVTALSAQENKTVIEVCTNQSNLSVRETALITGDFFEKEAITIQEEAEKIAQVVTVMAHQGTRYTLEKQVFVQASHAEQSWQVPFTPKDSFAAAAQESARAWQTLWQQANITVTGDLMSQKLLRIHSYHLLASASPFSNQAQALDVSITARGLHGEAYRGHIFWDEIFILPFYIQHYPDTAKQLLLYRYHRLEKAKENAAASQYRGAMYPWQSGRDGRETTQKLHLNPLNGHWGEDHSILQRHVSLAIAYNAWLYWHSTQDHEFMKQYGGEMLLEIAQFWNSAATLDDATGRFFIDKVMGPDEFHEGYPDQAESGLKNNAYTNLMVVWLFEELTNILALFSEEEQAQLFAKTQTSSADLARMQQIQNSLEIEVNSDGIIAQYEGYFGLKEIDWAAMKEKYGNIYRMDRILKAEGESPDDYKVAKQADTLMLFYNLDKTRVDQILEDLGYQLPADYLEKNLLYYLKRTSHGSTLSRIVHAQLAEMAQFHELSWQLYQEALYSDYRDIQGGTTAEGIHTGVMAATIHVTLATYAGVDTRQNELSICPNLPEHWQALAFQFIHQGVTYQFSLTQTSVTITADKDTQLLVQGALIPLTAERPKEVHYQ
>NZ_KI913075.1|WP_002354877.1|489309_490023_-|trehalose-operon-repressor
MNKFHDIFLELEQQIVQGDYQPGDLLPSENQLVETYNVSRETIRKALNLLINAGYIQKKQGKGSIVLNFKKFNFPISGVTSYKELQQTQHIESHTHVVSLEEIPVERNLAQLTGWTEGAPVWRLVRQREIEGEVDILDIDYLIKEIVPELPKHRAEDSIFDYLENDLGLAISYAQKEITVEPLTEMDKQLIGEVEGNHVVVVRSIMNLEDTRCFGYTESRHRLNKFKFVEFARRRKL
>NZ_KI913075.1|WP_002394745.1|488209_488914_-|hypothetical-protein
MKKKIMASLLVGSAVVGASLAPLSAQAVTTGNTPVQVEFGGGVLPDHENSTGGALDPDPTKPNTDFDLLAVPRSFDFPLAKINDDLSAIKETSRVIRDIMVGDVRGTKEGWHVTGELTKMSNGTDELAGDINFELEVSYAEYVTHITPPYYGAAPTLNGINIANDPTAPSAIGTNIKIGGGATVLMNATVGKGQGTWAGRFGNMTLNVTTPMQELKKGAYTGNITWNLVAGPSI
>NZ_KI913075.1|WP_002354883.1|487714_488164_+|large-conductance-mechanosensitive-channel-protein-MscL
MIKEFKEFIMRGSVLDLAVGVVIGSAFTAIVTQVVEGLITPLISLIFVLTTGKKSADDALGALVYKVEGVEFNIGSVISALITFLITAFVLFLIVKAANKMKNRGKKEEAAEEEVVPTSEDYLKEIRDLLAAQTPPAETVKTDSTFTEK
>NZ_KI913075.1|WP_002354884.1|486237_487506_-|insulinase-family-protein
MSVQLVKGVNLHVIPTEKYKTVRLLVRFNTRLNHETITKRTLLSSLMETNSLNYPNQVKLSERLAELYGASFGIGVSKKGNQHWFNISMNIVNDHYLQDSQVLAEAVDFLKEIIFAPNIQAGQFEAETFQREKENLKAYLESIVEDKQTYASLALQSVYFNQSEDQKIPSFGTVAALAEETAASLAAYYQKMLAEDQVDIFVLGDVNEAELVPLFKQLPFTPREEGKAAIFYNQPIRNVIEERTEREVLAQSKLNLAYNTDIYYGDSYYFALQVFNGIFGGFPHSKLFMNVREKEHLAYYASSSIDTFRGFMTVQTGIDGKNRNQVLRLISTELENIRLGKISELEIEQTKAMLKNQYILALDNAGAWLEKEYLNELMPQTMLTAEEWIARINAVTISEIQEVAKRLELQAIFFLEGETEND
>NZ_KI913075.1|WP_002414925.1|484940_486245_-|insulinase-family-protein
MIKKDYAQIKETLYTETLANGLKVYLLPKNDFQKTYGLFTTDYGSIDNTFVPIGQEEMIEVPDGIAHFLEHKMFEKEDGDVFQKFGQQGASANAFTSFTKTSYLFSTTDQVTQNLETLLDFVQSPYFTKETVEKEKGIIGQEIQMYLDDPNWCLFFGILGNLYPKHPLHIDIAGTVASIAEITAEDLYTCYNTFYHPSNMTLFVVGKMDPEALMAFIRENQAAKEFPAAQPIRRHFPEETAADIVKESAIEMAVTRAKVLVGLKGLDEVPTTGRDLMKYQVTVNLLLQLLFGNTSQNYLALYDEGLLDDSFSYDFNLDRSFHFADIGGDSEQPEVLAERIEAILLSATTSPELTEENLSLLKKKMIGKYFQSLNSLEYIANQFSQSLFGETTLFDKIEVIESIQLADVRQVAETLIREEGLSRFYMYPKGETEQ
>NZ_KI913075.1|WP_002360992.1|483906_484773_-|helix-turn-helix-domain-containing-protein
MASVNIGETLKEARLQKNISIDELQQMTKIQKRYLEIIEQNDFESLPGTFYVRAFIRQYASAVGLDGNQLVDIYDGKEPAIVEEPKPVYEELEGSRKQLHDEEKQSSWLLRNLPAIAFSLIGLAIAVVVLYIMWQDQKAEPIIQTPATSASVEKPKESSQAPESSTQSSTPPSSSSEPEKKTAVAVVSDANNQVTATVKDANSPINITFKGTEGSCWIGVMVDGNYTYQHTLQAGETETTALPANAANATLILGASNNVAIQVDGADLTLEKTPVLIRKDVTLGITYR
>NZ_KI913075.1|WP_002365385.1|483348_483603_-|hypothetical-protein
MVKIASNQGAAQKAIAGIKNVSVNKNQTCHLGESNISSMKKGVKVSNQLLNQLAKVVNGVNAQANKFPKLAATIAARDSQTTFK
>NZ_KI913075.1|WP_002354889.1|482976_483339_-|hypothetical-protein
MEKDTNEKLRRNYAEQIVEKERAMDQLSKEKKQIQTIFGTLESELTRNFRELEQLNAEVIHKGGKSTRWEQEELSGKQRYLRGFLQQQTHELSQRYTKATAQSNEERLQLQRERSRLSWD
>NZ_KI913075.1|WP_002354873.1|494943_495096_-|putative-holin-like-toxin
MVRMSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
>NZ_KI913075.1|WP_002381060.1|496083_497055_-|ribose-phosphate-diphosphokinase
MSKHYFDPRLKIFSLNSNRPLAEKIADAVGVELGKCSVTQFSDGEIQVNIEESIRGAHVYVIQSTSSPVNDNLMELLIMIDALKRASAKTINVVMPYYGYARQDRKARAREPITAKLVANMIEKAGATRMLTLDLHAVQIQGFFDIPVDHLMGAPLIADYFIEHGIQGDDVVVVSPDHGGVTRARKLAEFLKAPIAIIDKRRPKANVAEVMNIIGHVEGKTCVLIDDMIDTAGTISLAANALKEAGAKDVYASCTHPVLSGPALQRIEDSAIERLVVTDSIYLSDDRKIAKIDEVSVGELIGDAIKRIHENKPVSPLFETKNK
>NZ_KI913075.1|WP_002354871.1|497229_497667_-|peptide-methionine-(R)-S-oxide-reductase-MsrB
MTKPTEEELKQTLTDLQYAVTQENATERPFSGEYDDFYQDGIYVDIVSGEPLFSSLDKYDAGCGWPSFTKPIEKRGVKEKADFSHGMHRVEVRSQEADSHLGHVFTDGPLQEGGLRYCINAAALRFVPVADLEKEGYGEYLSLFK
>NZ_KI913075.1|WP_002354869.1|497799_498354_-|septum-formation-protein-Maf
MQIILASQSPRRQELLKRVVPTFTIAPADIDETVGKDGLPAEYVAQMAAQKAAAIAEQSPEALVIGCDTIVALAGEILGKPTSREDGYRMLRLLSGKTHDVYTSVTLKQGEKERSATVHSTVTFYPLTDTEIHAYLDTAEYADKAGAYGIQGQGALLIEAIAGDYYAIMGLPIAKVARLLKEFN
>NZ_KI913075.1|WP_002354868.1|498378_500511_-|DNA-mismatch-repair-endonuclease-MutL
MGKIQELSEQLANQIAAGEVVERPASVVKELVENALDAGSTQIDIFIEEAGLKTIQIIDNGEGIAKEDVLNAFKRHATSKIHTRDDLFRIRSLGFRGEALPSIASVSEMIVETATAEEEEGSYVILKGGKVEENRPAALRKGTKMTVSNLFYNTPARLKYVKTIQTELANIGDIVNRLALSHPKVAFRLVHDGHKMMSTTGNGDLKQTIAGIYGISTAKKMLKIEGKDLDFTLTGYVSLPEVTRASRNYLSTIINGRYIKNFALNKAIVAGYGSKLMVGRFPIAVLEIEMDPLLVDVNVHPTKQEVRLSKEKDLMALIEQAIQEVLSQEQLIPNAADNLRFKKKLPPEPKAEQMEIPLSTEQPAVKQRPGSLSYNPATGRFYAEHATDETPASSAPEAVNQTERAVDPMDDPFAPPVPESTSVAEETSAYETSSAAVDSENHWETASNEQQVIAEETKITEVPDSEPSLRSSEAADEVFQEEMKLHPEFDANSATSQRELKQALNKLEEERPTERFPELEYFGQMHGTYLFAQSKDGLFIIDQHAAQERIKYEYFREKIGEVSDDLQELLVPIVIDYPNSDALKIKEQKETLAEVGIHLEDFGQNSFIVRAHPTWYPAGEEESIVREMIDMLLTTGSVSVKKFREATAIMMSCKRSIKANHYLNEQQARVLLKDLALCENPFNCPHGRPVLIHFTNSDMERMFKRIQDPH
>NZ_KI913075.1|WP_002380978.1|500542_503119_-|DNA-mismatch-repair-protein-MutS
MPQKTKNTPMMEQYLSIKAQYKDAFLFYRLGDFYELFYEDAINAAQILELTLTSRNRNADDPIPMCGVPYHAAQGYIDTLIEQGYKVAICEQVEDPKTTKGMVKREVVQLVTPGTVMNSKGLEAKDNNYLTAVLTDGNQFGFAYVDLSTGELKTAVLADEEGVLNEASALQTKEMVLGSGIPESLKENLSLRLNIIFSTQETVEENAEFSFLTNELINPLEIEITGKLLSYLSVTQKRSLSHIQKAVEYQPDHFLKMDHYSKFNLELSQSIRTGQKKGTLLWLLDETKTAMGGRLLKQWLDRPLIQERQIKTRQEMVQSLLNSYFERLDLQAALTNVYDLERLAGRVAFGSVNGRDLIQLRTSLEQVPTIRQLIVGINQGEWDDLLVDLNPVEDLVELIATAINEEAPLQITEGNVIKDGYNDQLDEYRDAMRNGKQWLAELEAKERQETGIKNLKIGYNRVFGYFIEITKSNLANLEEGKYERKQTLANAERFITPELKELERLILEAEEKSVELEYQLFLAVREQVKTNIDRLQTLAKTISAVDVLQSFATISERYQYVRPTLRSNTKNLAIVEGRHPVVEKVLGHQEYIPNSIRMNPETDILLITGPNMSGKSTYMRQLALTVVMAQIGCFVPAESAEMPIFDQIFTRIGASDDLIAGQSTFMVEMMEANQALRHATPNSLILFDELGRGTATYDGMALAQAIIEYIHREVQAKTLFSTHYHELTVLDETLKGLKNIHVGAVEKDGEVVFLHKMMEGPADKSYGIHVAKIAGLPSPLLERAATILSALEAEETTIPSSVHHEEVSEVHEETEQLSLFKEVSTEELSVIDTLKKMNLLEMTPLDALNMLHQLQKRI
>NZ_KI913075.1|WP_002354866.1|503119_503491_-|hypothetical-protein
MEPLNLDAQSNKELEKLLHLIGQDEVIQRYQAIEEKVKKNKKLTELVEEIKAAQKDAVQFAHYGKPTAEKEAIQRADAKTKEFDEHPLVVAYREQLIEANDLVQHVTALIQYRVNEELEKEGN
>NZ_KI913075.1|WP_002354864.1|503578_504376_-|TIGR00282-family-metallophosphoesterase
MRILFIGDVVGSLGREALATYVPKLKKKYRPQVTIANGENAASGRGITGKIYKKFLQDGVDVVTMGNHTWDNKDIFEFIDDAKKMVRPANFPEDVPGQGMVFVKVNQLELAVINLQARTFMVPLEDPFKKAAELVAIARKRTPLIFVDFHGETTSEKQAMSWFLDGQVSAVVGTHTHVQTNDARILPKGTAFLSDVGMTGPYDGILGMKREPIIEKFMTALPKRFEVVETGRTILSACILEIDDQTGQAKMIEPIQISEDRPFQE
>NZ_KI913075.1|WP_002354863.1|504535_506092_-|ribonuclease-Y
MVLNILLAIVGLIVGLGLGFVIAKSRHDKAINGAKISASSILENARKESETLKKEALLEAKEENQKYRSEIESELKESRLELKSQENRLIQREQTLDRKDDSLEKREGSLEEKEEKLGARQQLIDEREKEVENLINQQHQELERIASLSKEEAKSIIMKSTEEELNHELTLMVKESEQRAKEESDRKAKNLLSLAIQRCAADSVSETTVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIIDDTPEAVVLSGFDPIRREIARMTLEKLIQDGRIHPARIEEMVEKSRKEMDERIREYGEQAAFEVGAHTLHPDLIKILGRLRFRTSYGQNVLNHSIEVAKLAGVLAAELGEDVQLAKRAGLLHDIGKALDHEIEGSHVEIGAELAAKYKENSVVINAIASHHGDVEATSVISVLVAAADALSAARPGARSESLENYIRRLENLENISNSFEGVDSSFAVQAGREVRVMVKPEEISDLESVRLVRDIRKKIEDDLDYPGHIKVTVIRETRAVDYAK
>NZ_KI913075.1|WP_002354860.1|506488_507535_-|recombinase-RecA
MADDRKVALDAALKKIEKNFGKGSIMKLGEKADQKISTIPSGSLALDVALGVGGYPRGRIIEVYGPESSGKTTVSLHAIAEVQRNGGTAAFIDAEHALDPQYAEKLGVNIDELLLSQPDTGEQGLEIADALVSSGAIDIVVIDSVAALVPRAEIDGEMGASHVGLQARLMSQALRKLSGSINKTKTIAIFINQIREKVGVMFGNPETTPGGRALKFYATVRLEVRRAEQLKQGTDIVGNRTKIKVVKNKVAPPFKVAEVDIMYGQGISQEGELLDMAVEKDLISKSGAWYGYKEERIGQGRENAKQYMADHPEMMAEVSKLVRDAYGIGDGSTITEEAEGQEELPLDE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

377 : 37237

Enterococcus_phage(63.16%)

terminase,integrase,tRNA,portal,tail

attL 28079:28097|attR 38672:38690

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033624668.1\|377_1823_-	peptidase M23	A0A1S5SA59	Streptococcus_phage	8.2e-70	36.5
WP_002363380.1\|1822_2545_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	6.0e-37	37.6
WP_033624669.1\|2541_6996_-\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	4.9e-89	48.7
WP_002364305.1\|6982_7288_-	hypothetical protein	NA	NA	NA	NA
WP_002409775.1\|7356_7755_-	hypothetical protein	NA	NA	NA	NA
WP_010784604.1\|7817_8126_-	hypothetical protein	C9E2K1	Enterococcus_phage	2.2e-09	53.3
WP_025194241.1\|8128_8734_-\|tail	phage major tail protein, TP901-1 family	A0A1X9IGH1	Lactococcus_phage	1.3e-21	35.6
WP_023042479.1\|8752_9145_-	hypothetical protein	NA	NA	NA	NA
WP_010816898.1\|9141_9480_-	hypothetical protein	A0A1X9IGH0	Lactococcus_phage	1.9e-14	40.0
WP_002378454.1\|9476_9752_-	hypothetical protein	NA	NA	NA	NA
WP_002363369.1\|9748_10081_-	hypothetical protein	A0A097BY74	Leuconostoc_phage	3.1e-09	38.9
WP_002363368.1\|10151_11048_-	hypothetical protein	U3PDP8	Lactobacillus_phage	3.3e-69	49.8
WP_002378456.1\|11061_11715_-	hypothetical protein	NA	NA	NA	NA
WP_033593778.1\|11819_12746_-	hypothetical protein	A0A097QPZ9	Enterococcus_phage	1.8e-131	98.4
WP_010784607.1\|12738_14223_-\|portal	phage portal protein	A0A097QPZ5	Enterococcus_phage	3.8e-139	99.6
WP_002369892.1\|14222_15506_-\|terminase	PBSX family phage terminase large subunit	Q9AZ91	Lactobacillus_prophage	6.0e-157	65.5
WP_002364295.1\|15486_15921_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-44	64.5
WP_002369893.1\|15952_16117_-	hypothetical protein	NA	NA	NA	NA
WP_002364337.1\|16998_17415_-	autolysin	D2IZL7	Enterococcus_phage	7.1e-67	97.8
WP_010708415.1\|17804_18008_-	hypothetical protein	D2IYV4	Enterococcus_phage	1.8e-31	97.0
WP_010708414.1\|18011_18212_-	hypothetical protein	D2IYV3	Enterococcus_phage	6.0e-32	100.0
WP_002380820.1\|18215_18416_-	hypothetical protein	D2IYV2	Enterococcus_phage	1.8e-31	100.0
WP_033624676.1\|18419_18992_-	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	8.8e-68	66.8
WP_002365172.1\|18984_19245_-	hypothetical protein	D2IZL2	Enterococcus_phage	7.3e-46	100.0
WP_021164528.1\|19399_19807_-	hypothetical protein	D2IZY8	Enterococcus_phage	2.1e-39	67.4
WP_033624677.1\|19850_20615_-	site-specific DNA-methyltransferase	A0A097QQ03	Enterococcus_phage	1.8e-140	97.2
WP_080266738.1\|20670_20841_-	hypothetical protein	D2IYU5	Enterococcus_phage	8.2e-14	100.0
WP_033624679.1\|20897_21659_-	hypothetical protein	D2IYU3	Enterococcus_phage	1.1e-137	95.7
WP_033624681.1\|21655_22081_-	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.3e-68	92.9
WP_002357015.1\|22098_22398_-	hypothetical protein	D2IZY1	Enterococcus_phage	5.1e-43	89.9
WP_010712209.1\|22398_22701_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.2e-47	99.0
WP_002364216.1\|22704_23667_-	DUF4373 domain-containing protein	D2IZR2	Enterococcus_phage	5.9e-149	90.9
WP_033624682.1\|23680_24571_-	DNA recombination protein RecT	D2IYT9	Enterococcus_phage	1.2e-161	99.3
WP_010708317.1\|24669_25611_-	hypothetical protein	D2IZK1	Enterococcus_phage	2.9e-177	99.7
WP_010708316.1\|25607_25709_-	hypothetical protein	D2IYT7	Enterococcus_phage	1.8e-08	93.9
WP_002364220.1\|25708_25936_-	hypothetical protein	D2IZX4	Enterococcus_phage	8.6e-35	97.3
WP_010708315.1\|25935_26271_-	hypothetical protein	NA	NA	NA	NA
WP_002396620.1\|26315_26501_-	hypothetical protein	D2IZ58	Enterococcus_phage	1.1e-22	94.7
WP_033624684.1\|26491_26686_-	hypothetical protein	D2IZ57	Enterococcus_phage	1.0e-28	96.9
WP_033624686.1\|26866_27589_-	antirepressor	D2IYT0	Enterococcus_phage	7.3e-43	63.3
WP_016622206.1\|27609_27927_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_023042504.1\|28001_28316_+	hypothetical protein	NA	NA	NA	NA
28079:28097	attL	NA	NA	NA	NA
WP_023042505.1\|28296_28425_-	hypothetical protein	NA	NA	NA	NA
WP_023042506.1\|28440_28623_-	hypothetical protein	NA	NA	NA	NA
WP_023042507.1\|28923_29343_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	2.6e-37	60.9
WP_023042508.1\|29360_29783_+	ImmA/IrrE family metallo-endopeptidase	A0A1C8E988	Bacillus_phage	4.4e-32	48.5
WP_080248216.1\|30123_30693_+	hypothetical protein	A0A097BY93	Leuconostoc_phage	4.1e-09	67.3
WP_033624687.1\|30767_31898_+\|integrase	site-specific integrase	S5MBZ0	Brevibacillus_phage	5.4e-69	40.3
WP_002356498.1\|32207_33167_+	diacylglycerol kinase family lipid kinase	NA	NA	NA	NA
WP_002404066.1\|33233_35843_-	ATP-dependent RecD-like DNA helicase	A0A218KCE8	Bacillus_phage	4.3e-61	30.7
WP_002362550.1\|35869_36514_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_002356493.1\|36730_37237_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
38672:38690	attR	NA	NA	NA	NA

DBSCAN-SWA_2

123465 : 134378

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002356382.1\|123465_124233_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-30	35.2
WP_002385686.1\|124638_126822_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.1e-286	66.8
WP_002365065.1\|126854_127451_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	2.3e-50	56.1
WP_002362328.1\|127495_128614_-	DNA polymerase IV	D0R0A3	Streptococcus_phage	4.2e-13	29.1
WP_002365066.1\|128739_129498_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002356375.1\|129481_130144_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.0e-15	32.3
WP_002356373.1\|130158_131031_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.2e-81	57.6
WP_002356372.1\|131142_131490_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_002356371.1\|131482_132322_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002384059.1\|132438_133389_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.2e-34	33.0
WP_002356367.1\|133390_133720_-	hypothetical protein	NA	NA	NA	NA
WP_002356366.1\|133739_134378_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.1e-54	53.8

DBSCAN-SWA_3

155171 : 205997

Enterococcus_phage(41.03%)

terminase,integrase,tRNA,plate,protease,portal,tail,holin

attL 197217:197231|attR 201961:201975

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002362481.1\|155171_155882_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002385677.1\|155892_156435_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002356329.1\|156522_157293_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002356327.1\|157458_158034_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_002365080.1\|158139_159690_+	membrane protein	NA	NA	NA	NA
WP_002356324.1\|159710_160775_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	9.8e-20	51.5
WP_002356323.1\|161034_162099_-	FUSC family protein	NA	NA	NA	NA
WP_061866705.1\|162354_162552_-	hypothetical protein	NA	NA	NA	NA
WP_002414603.1\|163398_164208_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_002404583.1\|164603_165842_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	1.2e-175	74.5
WP_002369080.1\|165846_166050_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	2.6e-30	100.0
WP_002367247.1\|166052_166286_-\|holin	holin	D2J075	Enterococcus_phage	7.0e-24	70.2
WP_002369972.1\|166319_166457_-	XkdX family protein	NA	NA	NA	NA
WP_002414602.1\|166456_166831_-	hypothetical protein	NA	NA	NA	NA
WP_002414601.1\|166845_167370_-	hypothetical protein	NA	NA	NA	NA
WP_002369975.1\|167369_167687_-	hypothetical protein	NA	NA	NA	NA
WP_002414600.1\|167679_167997_-	hypothetical protein	NA	NA	NA	NA
WP_010784633.1\|167989_168898_-\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	1.4e-11	25.7
WP_010784634.1\|168912_171612_-	peptidoglycan DD-metalloendopeptidase family protein	Q9AZX5	Lactococcus_phage	2.7e-175	38.2
WP_002414530.1\|171608_172343_-	hypothetical protein	A0A1B1P7Q0	Bacillus_phage	1.1e-09	24.8
WP_002414529.1\|172332_175257_-	tape measure protein	D7RWD8	Brochothrix_phage	1.6e-80	43.6
WP_002364485.1\|175478_175832_-	hypothetical protein	A0A2H4JAA8	uncultured_Caudovirales_phage	4.1e-07	36.3
WP_002414527.1\|175884_176727_-\|tail	tail protein	A0A1D6Z291	Staphylococcus_phage	3.2e-10	51.8
WP_002414526.1\|176727_177102_-	hypothetical protein	NA	NA	NA	NA
WP_002402415.1\|177105_177504_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002414525.1\|177496_177874_-	hypothetical protein	A0A090EUC2	Clostridium_phage	6.1e-09	31.7
WP_002395886.1\|177870_178215_-	hypothetical protein	NA	NA	NA	NA
WP_002414524.1\|178223_178460_-	hypothetical protein	NA	NA	NA	NA
WP_002414522.1\|178483_179386_-	hypothetical protein	A0A2L0HPQ0	Pseudomonas_phage	1.3e-09	24.9
WP_002414521.1\|179399_180026_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_002414520.1\|180243_180564_-	hypothetical protein	NA	NA	NA	NA
WP_002414519.1\|180620_180851_-	hypothetical protein	NA	NA	NA	NA
WP_002414518.1\|180851_182636_-	hypothetical protein	A0A090D822	Clostridium_phage	4.3e-12	30.0
WP_002414517.1\|182610_184086_-\|portal	phage portal protein	E5DV51	Deep-sea_thermophilic_phage	1.1e-37	28.4
WP_025193069.1\|184098_185373_-\|terminase	PBSX family phage terminase large subunit	A0A1B1UZZ1	Enterococcus_phage	7.9e-234	94.7
WP_002414515.1\|185362_185824_-\|terminase	terminase small subunit	D7RWC4	Brochothrix_phage	4.8e-24	46.7
WP_002369895.1\|186201_187062_-	hypothetical protein	A0A0S2MYE5	Enterococcus_phage	1.2e-113	99.5
WP_002357362.1\|187919_188336_-	autolysin	D2IZL7	Enterococcus_phage	1.7e-68	99.3
WP_002414920.1\|188725_188926_-	hypothetical protein	D2IZL5	Enterococcus_phage	2.8e-29	87.9
WP_010784645.1\|189108_189624_-	DUF1642 domain-containing protein	D2IYV1	Enterococcus_phage	1.1e-66	78.8
WP_002414886.1\|189757_190090_-	hypothetical protein	D2IYU9	Enterococcus_phage	6.7e-36	90.2
WP_010784646.1\|190090_190471_-	hypothetical protein	D2IZL0	Enterococcus_phage	5.3e-37	67.2
WP_025193072.1\|190467_190704_-	hypothetical protein	NA	NA	NA	NA
WP_010784647.1\|190711_191761_-	DNA (cytosine-5-)-methyltransferase	A0A141E1L1	Streptococcus_phage	4.6e-131	64.6
WP_025191024.1\|191813_192020_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	5.6e-25	98.4
WP_002414634.1\|192039_192369_-	hypothetical protein	NA	NA	NA	NA
WP_002414633.1\|192380_192908_-	single-stranded DNA-binding protein	A0A097PAQ3	Streptococcus_pyogenes_phage	2.0e-42	56.0
WP_002365159.1\|192912_193764_-	helix-turn-helix domain-containing protein	A0A0H4TJ49	Erysipelothrix_phage	2.0e-23	37.5
WP_002414632.1\|193767_194409_-	hypothetical protein	U5U4M2	Lactobacillus_phage	3.7e-30	35.1
WP_002365157.1\|194413_195430_-	AAA family ATPase	A0A0S2SY47	Bacillus_phage	9.2e-60	43.2
WP_002381628.1\|195441_195921_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	1.2e-33	48.4
WP_002414626.1\|196115_196229_-	hypothetical protein	C9E2M6	Enterococcus_phage	4.0e-09	94.1
WP_002364665.1\|196410_196596_-	hypothetical protein	D2IZW5	Enterococcus_phage	3.2e-19	86.7
WP_002414624.1\|196606_197317_-	phage regulatory protein	D2IYT0	Enterococcus_phage	7.5e-117	90.6
197217:197231	attL	NA	NA	NA	NA
WP_002414623.1\|197398_197668_-	hypothetical protein	NA	NA	NA	NA
WP_002414622.1\|197682_197877_-	helix-turn-helix transcriptional regulator	A0A1S5SDM7	Streptococcus_phage	1.5e-11	51.7
WP_002401993.1\|198121_198469_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	4.9e-21	45.2
WP_002401992.1\|198497_198908_+	ImmA/IrrE family metallo-endopeptidase	A0A1P8VVK5	Streptococcus_phage	4.4e-05	31.2
WP_002414621.1\|198997_199732_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	1.3e-23	54.4
WP_002414620.1\|199744_200074_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	8.4e-23	49.1
WP_033072557.1\|200196_201378_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	4.5e-50	35.6
WP_002356321.1\|201481_201631_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002365139.1\|201756_203895_-	penicillin-binding protein 2	NA	NA	NA	NA
201961:201975	attR	NA	NA	NA	NA
WP_002362353.1\|204059_205997_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	2.3e-112	36.3

DBSCAN-SWA_4

526805 : 581740

Streptococcus_phage(35.71%)

tRNA,holin,transposase,integrase

attL 550435:550451|attR 590886:590902

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002405937.1\|526805_527765_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	4.6e-37	36.4
WP_002392705.1\|528051_529065_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002404002.1\|529219_529765_+	cysteine hydrolase	G3MA16	Bacillus_virus	1.0e-25	37.8
WP_002354830.1\|529976_530660_-\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_002354829.1\|530656_531076_-\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_002354828.1\|531227_531956_-	response regulator	NA	NA	NA	NA
WP_002354827.1\|531936_533706_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	4.2e-60	28.5
WP_002354826.1\|533797_534616_-	membrane protein	NA	NA	NA	NA
WP_002354825.1\|534628_535300_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002354824.1\|535296_536019_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-22	33.7
WP_077497656.1\|536380_536773_-	OsmC family protein	NA	NA	NA	NA
WP_002354822.1\|536979_537249_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002354818.1\|537359_537509_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002404001.1\|537524_538499_+	GTP-binding protein	NA	NA	NA	NA
WP_002354815.1\|538514_538655_+	putative metal homeostasis protein	NA	NA	NA	NA
WP_002404000.1\|538675_540211_+	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002413934.1\|540268_541243_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_002354811.1\|541430_542201_-	ABC transporter permease	NA	NA	NA	NA
WP_002354809.1\|542193_543129_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.4e-22	29.4
WP_002354802.1\|543386_543806_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_002354800.1\|543818_544310_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002365419.1\|544326_545142_+	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_010784810.1\|545138_545966_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002381047.1\|546113_548633_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002403998.1\|548687_550274_-	CHAP domain-containing protein	A0A286QRX8	Streptococcus_phage	4.9e-07	34.7
550435:550451	attL	NA	NA	NA	NA
WP_002354788.1\|551419_551980_-	hypothetical protein	NA	NA	NA	NA
WP_002372037.1\|555880_556288_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	3.6e-31	48.9
WP_002372035.1\|556645_557005_+	winged helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	2.3e-21	49.6
WP_002372033.1\|557001_559119_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.7e-245	64.6
WP_002403997.1\|559339_560152_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002403996.1\|560313_561570_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.0e-48	30.8
WP_002403995.1\|561659_561857_+	hypothetical protein	NA	NA	NA	NA
WP_002403994.1\|561962_563012_+\|integrase	site-specific integrase	E3W8I1	Leuconostoc_phage	1.2e-38	31.0
WP_002354786.1\|563068_563461_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002365424.1\|563474_563918_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_011109590.1\|563979_564087_+	hypothetical protein	NA	NA	NA	NA
WP_002354782.1\|564139_564607_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_002354781.1\|564735_565455_-	DUF5105 domain-containing protein	NA	NA	NA	NA
WP_002354779.1\|565538_567059_-	gluconokinase	NA	NA	NA	NA
WP_002354778.1\|567167_567860_+	prepilin peptidase	NA	NA	NA	NA
WP_002354777.1\|567908_571562_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.4e-65	24.8
WP_002354775.1\|571728_575352_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	2.0e-48	24.5
WP_002354774.1\|575713_576055_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	5.5e-17	42.5
WP_002354773.1\|576054_576285_-	hypothetical protein	NA	NA	NA	NA
WP_002354768.1\|576459_576675_-	DNA-binding protein	NA	NA	NA	NA
WP_002354765.1\|576813_577806_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_002354763.1\|578069_578699_-	chitin-binding protein	NA	NA	NA	NA
WP_100815058.1\|579264_579357_+	hypothetical protein	NA	NA	NA	NA
WP_002381036.1\|579391_581008_+	phosphatase PAP2/LCP family protein	NA	NA	NA	NA
WP_002392818.1\|581337_581481_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_073340360.1\|581599_581740_+\|holin	putative holin-like toxin	NA	NA	NA	NA
590886:590902	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_KI913078

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_KI913078_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_KI913078_1

51915-52281

Orphan

II-A,II-B

Consensus_repeat	Method
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRISPRCasFinder
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRT
ATGTTTTGGTACCATTCTAAACAACATGACTCTAAAACCATG	PILER-CR

5 spacers

The CRISPR arrays of NZ_KI913078_1

>merge|NZ_KI913078|1|51915-52281|CRISPRCasFinder,CRT,PILER-CR
GTGATAGTTTGTTTTTTAACAACATGGCTATAAAACAGGGGAGAAAAAGCCAAATCAAAAAAGTTTGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTATAACGTAAATCACAGTCTTTTGTAAGTCGTTTTGGTACCATTCCAAACAACATGACTCTAAAACATTAACGTAGTTGATTCAGAAAAACCAAGCGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTATGGTTTTGAATAAATTGTACATCATTATGTTTTGGTACCATTCTAAACAACATGACTCTAAAACCCTGTGGTCGGACAGGTGACGCCAGCAGATGTTTTGGTACCATTCTAAACAACATGACTCTAAAACC

>NZ_KI913078|1|1|51915-52280|CRISPRCasFinder
GTGATAGTTTGTTTTTTAACAACATGGCTATAAAAC	AGGGGAGAAAAAGCCAAATCAAAAAAGTTT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TATAACGTAAATCACAGTCTTTTGTAAGTC
GTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	ATTAACGTAGTTGATTCAGAAAAACCAAGC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TATGGTTTTGAATAAATTGTACATCATTAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CCTGTGGTCGGACAGGTGACGCCAGCAGAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_KI913078|1|1|51981-52280|CRT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TATAACGTAAATCACAGTCTTTTGTAAGTC
GTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	ATTAACGTAGTTGATTCAGAAAAACCAAGC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TATGGTTTTGAATAAATTGTACATCATTAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CCTGTGGTCGGACAGGTGACGCCAGCAGAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_KI913078|1|1|52113-52281|PILER-CR
GTTTTGGTACCATTCTAAACAACATGACTCTAAAACTATGGT	TTTGAATAAATTGTACATCATTAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAACCCTGTG	GTCGGACAGGTGACGCCAGCAGAT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_KI913078.1\|WP_002364247.1\|47341_49075_-\|thiol-reductant-ABC-exporter-subunit-CydD	unknown	unknown	gnl\|CDD\|274323
NZ_KI913078.1\|WP_011109517.1\|51667_51766_-\|hypothetical-protein	unknown	unknown	unknown
NZ_KI913078.1\|WP_002356966.1\|55597_55963_-\|DUF1033-family-protein	unknown	unknown	gnl\|CDD\|336361
NZ_KI913078.1\|WP_002364254.1\|58710_59835_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_KI913078.1\|WP_002360015.1\|44518_45499_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_KI913078.1\|WP_002364253.1\|58504_58654_-\|hypothetical-protein	unknown	unknown	unknown
NZ_KI913078.1\|WP_002364245.1\|42251_43463_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_KI913078.1\|WP_002414495.1\|53385_55467_-\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_KI913078.1\|WP_002360018.1\|42043_42175_-\|hypothetical-protein	unknown	unknown	unknown
NZ_KI913078.1\|WP_002356976.1\|49079_50093_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_KI913078.1\|WP_002356959.1\|60060_60405_-\|DUF1831-domain-containing-protein	unknown	unknown	gnl\|CDD\|370163
NZ_KI913078.1\|WP_002362073.1\|56761_57277_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
NZ_KI913078.1\|WP_002364252.1\|56059_56629_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_KI913078.1\|WP_002364256.1\|61774_62749_-\|ribose-phosphate-diphosphokinase	unknown	unknown	gnl\|CDD\|235039
NZ_KI913078.1\|WP_002360007.1\|60472_61618_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
NZ_KI913078.1\|WP_002364246.1\|45578_47345_-\|thiol-reductant-ABC-exporter-subunit-CydC	unknown	unknown	gnl\|CDD\|227320
NZ_KI913078.1\|WP_002362065.1\|39514_41938_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
NZ_KI913078.1\|WP_002360016.1\|43491_44397_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_KI913078.1\|WP_002356974.1\|50089_51508_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_KI913078.1\|WP_002364250.1\|52437_53301_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117

Protein	Function_ID	Function_description	E-value
NZ_KI913078.1\|WP_002364247.1\|47341_49075_-\|thiol-reductant-ABC-exporter-subunit-CydD	gnl\|CDD\|274323	TIGR02857, transport_ATP-binding_protein, thiol reductant ABC exporter, CydD subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD.	0
NZ_KI913078.1\|WP_002364250.1\|52437_53301_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	5.07904e-27
NZ_KI913078.1\|WP_002356966.1\|55597_55963_-\|DUF1033-family-protein	gnl\|CDD\|336361	pfam06279, DUF1033, Protein of unknown function (DUF1033). This family consists of several hypothetical bacterial proteins. Many of the sequences in this family are annotated as putative DNA binding proteins but the function of this family is unknown.	4.62165e-64
NZ_KI913078.1\|WP_002356976.1\|49079_50093_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	9.60464e-103
NZ_KI913078.1\|WP_002414495.1\|53385_55467_-\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_KI913078.1\|WP_002364245.1\|42251_43463_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	5.05823e-122
NZ_KI913078.1\|WP_002360015.1\|44518_45499_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	2.52576e-80
NZ_KI913078.1\|WP_002356959.1\|60060_60405_-\|DUF1831-domain-containing-protein	gnl\|CDD\|370163	pfam08866, DUF1831, Putative amino acid metabolism. Solution of the structure of the Lactobacillus plantarum protein from this family has indicated a potential new fold with remote similarities to TBP-like (TATA-binding protein) structures. This similarity, in combination with genomic context analysis, leads us to propose an involvement in amino-acid metabolism. The potentially novel fold is an alpha + beta fold comprising two beta sheets packed against a single helix. The enzyme is present in the cytosol.	1.33245e-53
NZ_KI913078.1\|WP_002362073.1\|56761_57277_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	1.1162e-31
NZ_KI913078.1\|WP_002364252.1\|56059_56629_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	3.60546e-15
NZ_KI913078.1\|WP_002364256.1\|61774_62749_-\|ribose-phosphate-diphosphokinase	gnl\|CDD\|235039	PRK02458, PRK02458, ribose-phosphate pyrophosphokinase; Provisional.	0
NZ_KI913078.1\|WP_002360007.1\|60472_61618_-\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	5.37018e-179
NZ_KI913078.1\|WP_002364246.1\|45578_47345_-\|thiol-reductant-ABC-exporter-subunit-CydC	gnl\|CDD\|227320	COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].	0
NZ_KI913078.1\|WP_002364254.1\|58710_59835_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_KI913078.1\|WP_002360016.1\|43491_44397_-\|prenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	8.82053e-105
NZ_KI913078.1\|WP_002356974.1\|50089_51508_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_KI913078.1\|WP_002362065.1\|39514_41938_-\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.48202e-174

>NZ_KI913078.1|WP_011109517.1|51667_51766_-|hypothetical-protein
MIEEREEILVAPKKIVRNASVLFGFCLRKLYT
>NZ_KI913078.1|WP_002356974.1|50089_51508_-|cytochrome-ubiquinol-oxidase-subunit-I
MFDIVTLARIQFAMTTVFHFFFVPFSIGLALVVAIMETMYVVKKEERYRKMAKFWGNIFLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFFLESTFLGLWIFTWDKMNPKVHVTFIWLVVFGSMMSAFWILVANSFMQHPVGYVINNGRAEMVDFVAVISNPKVWYEFSHVIMGAFTLGGMAVAGMAAFQLLKKRDISFHKASMRIGLWVTLFGSIGVLLAGDLQMKALIEGQPMKFAAMEGAYEDSDDPAAWTLIAWADEREHKQVFGIDIPYMLSILSYNKLSGSVDGMDTVNKRLVEKYGDDKNYYPPVNTLFWSFRIMAGFGALMLLVAALGLFFTRKKKPSLYEKKWMLWIVALCTFAPFLANTTGWLVTELGRYPWTVYGLFTIEQSVSPNVSVASLITSNVIYFLLFAGLGSVMVYLVILELRKGPDYEAKKLAKENEPALDPFDKGVFGE
>NZ_KI913078.1|WP_002356976.1|49079_50093_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MSTLQLLWFVLIGVLFSGFFFLEGFDFGVGMAVQTLAHNDDEKDQVVATIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLILFTILFGLIIRGVSFEFRHNMPEGKRRRMWNWTLSIGSFLVPFFFGILFISLVQGMPLDANGNMHAQFTDYFNLFSIVGGVALTLLCYLHGMNYIALKTEGPIRERARNYAEILYGVLYVGLVVFAVLMYFKTDFYEKNFAVTLILTLAIVVLTVIANVGVFKRKEMLAFLASGLTLVVLVALLFSGLFPRVMIGSEGFDLLIKDATSTPYTLKIMTWISLSILPFVLAYTAWSYYIFRKRISQTAVPEGY
>NZ_KI913078.1|WP_002364247.1|47341_49075_-|thiol-reductant-ABC-exporter-subunit-CydD
MIDKDILQMPKIKKILVLLAGFSFLQAVFIIGQAFFLSKAIVGLWSGGHLNQQLQSILLFFIFYLGRHVITYFRERMLDTFSYERSKELREQLLTKIFRLGPNVVQKNGTGNMVTMALEGISQTENYLQLILTKMMNMMIIPWIILAFVFTQDIRSGVTLLIVFPIIIIFMIVLGYAAQSKADKQYAAFQMLSNHFIDSLRGIDTLKLFGLSKKYAGSIYHTSERFRKATMSTLKIAILSTFALDFFTTLSVAVVAVFLGLSLLNGTILLFPALVTLILAPEFFLPIRDFSSDYHATLDGKNSFQAIQAVLALPEAEQTDVLTLDDWHQESQLSVTALNFSYEDATQEAIQSLQFSVDGRKKIGIIGASGSGKSTLINLLSGFLLPTEETSQLAINGQTIPHFLQKDWQKQILYIPQAPYIFQDTLANNIRFYTPEATDEAIQQAIQLVGLDELVKDLPEGIQTLIGESGRMLSGGQAQRVALARAFVDQKRHVLLFDEPTAHLDIETEVEMKERMLPLMNNHLVFFATHRLHWMEEMDYILVMEKGQLVEQGTLAELIEKDGYYVQLMKQMRGGRQ
>NZ_KI913078.1|WP_002364246.1|45578_47345_-|thiol-reductant-ABC-exporter-subunit-CydC
MMEKQPTTKDVWKNDQWVRPFLKRYKKTLYFALLLGFLTFFSAGALMFTSGYLISRAASLPENILLIYIPIVLTRAFGIGRPVFRYVERLTSHNWVLKMTSDLRLKLYNVLEKDAIFFKTKYRTGDILGLLSEDINHIQNLYLRTIFPTVIAWILYIFLVIALGFFSWWFALCMLLMLGVVVFLLPLVSVLVNGARQEKHKYAKNELYQTLTDNILGVSDWVFSQRGSEFVARYETDEANVRALDEKMKQFNRGRDFVLQLLFGVIAIAVLAWTSVRFPGNHGGAANWIGAFVLTVFPLIDAFAPLPAAAQETTIYKDSIRRFNELPEGEDDSTEAPVQPNGTSLSIEHLSFAYENQEKKVLNDLSLTIPEKQKLAILGRSGSGKSTLASLIRGDLRPTSGEILLGNIPTEAFGETMTEYIGVMHQAPYLFRTTILNNIRIGREEASEAEVWAVLEKVGLKEMVAQLPEGLQTMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTTGLDPITEQQLLETFFEALKDKTVIWITHHLQGVTLMDQVIFIEDGQLEMSGTPEELLATNAHYQKLYRIDRGISSFEE
>NZ_KI913078.1|WP_002360015.1|44518_45499_+|polyprenyl-synthetase-family-protein
MNTFWKSFPDVERSLTETCELIEQTLHTRNEDIEEALVTLARSGGKLLRPAFFFLFAQLGDEEKQEKQQLLKIAASLEILHMATLIHDDIIDDSPLRRGAVTIQSQYGKDVAVYTGDLLFTEFFTLIADAMNGSEFMKINAQGMKRLLLGELDQMSHRFDRRMSIPAYLRSVNGKTAELFSLSCLEGAYFGHSSKEVQRLAKRIGRHIGIAFQVYDDILDYTADTETLKKPALEDLSQGVYTLPLLFAYQAAPDVFSPYLDKGRAITLEEAAEVAALVNDYHGVTEAQAFAKKVTNKAITDIQQLPDGTAKETLLSLTELLLHRSF
>NZ_KI913078.1|WP_002360016.1|43491_44397_-|prenyltransferase
MNREIFFELVELKAKTASVLPFLLGICFSWYQYGRLHVGYVLIFFIAMFIFNMAVDILDNYNDYHHATEVHDYKEKTNIIGRENLSLPLIRKMIFWMILVSALMGIGLSFIVGWPLLIMGLYCYLIGIFYSSGPKPLSSLPLGEVFSGFTMGFMITLICVYINTFEVFNWSAANLWGIFLVALPNTCYIANLMLANNICDLEEDENNKRYTLVHYLGKASSLKLFVGLNTIAMLAILLAVGLGLTPPTMLLMLLTLPFVRKQTQALLKEQVKSKTFVCAVKILAVGATAQVLFFAIGLWWL
>NZ_KI913078.1|WP_002364245.1|42251_43463_-|NAD(P)/FAD-dependent-oxidoreductase
MNKKHVVILGAGYAGLKTLRELQKGAKDVEITLVDRNNYHYEATDLHEVAAGTQPAEKITYNIMDVVDEKMTTFIQGTVKTIDAATQTVALEDGQTINYDYLVVSLGFESESFGIPGVQEHALQMVDVKTALNVYEHIQEQMRQYKATQNEEFLKIVVCGAGFTGIELLGSLVENKPKFAEIAGVSADQIQIYCVEAVTRLLPMFNEKLANYGVQLLKDSAIHLLLGKPIKEIKPGTVVYQDNEAGDLAELSAKTIIWTTGVSGSHVVGDSGFEARRGRVMVQPDLTDANHSNVYIIGDCSAVMDTETNRPYPTTAQIALKMGAHAAKNIQAQLKGEATKPFSFKSQGSVCSVGNTRALGIVGKTDIKGYPASFMKKIIMNKALFETGGTKEMMAKGRFDLYH
>NZ_KI913078.1|WP_002360018.1|42043_42175_-|hypothetical-protein
MLFNFWRISAYFRRSWFCSRRLSVFERGAKIQSDFCPTLIFLK
>NZ_KI913078.1|WP_002362065.1|39514_41938_-|DNA-translocase-FtsK
MAQKRSTNKKKSTTKKKTKKQQQQQERLNYMFLGLIFILFGVFGLFRLGFLGTLLANCLRLVVGNTFPFAAILLILYGLLVMIYGKDFPLKRGRPIFGAVLIYISVLLFFHAFMFRNVSGSQPDILGNTWEFLQSDLKANQVTQNVGGGMIGALLYQGTYFLVAQFGSYLIATLLLLAGIFLMSMWDFQQIVDHFQSIQDRLSHVSAKSQARQEEKEAKRAAKKEAKAAERQAKIEAAAQQKLQERERMEQAAADRLTKTPVETHQPMVEEPAAPTPVQIDSFQQQNQAMPVPPIAATKPQREQEEEAADEAGVLEFEISEEAEDRDYQLPPTDLLDTIQATDQSGEYEKIEKNIGVLEQTFKSFGVDAKVVKASLGPSVTKFEVQPAVGVKVSKIVNLTDDIALALAAKDVRMEAPIPGKSLIGIEVPNSAISTVSFRDIVEAQPSHPDKLLEVPLGRDISGMVQTADLSKMPHLLIAGSTGSGKSVAINGIITGILMQAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTNPRKAAQALQKVVQEMEFRYEKFAATGVRNITGYNQLIQQKNAEDGENRPILPFIVVIVDELADLMMVASNEVEDAIIRLAQMARAAGIHMILATQRPSVDVITGIIKANVPSRMAFAVSSGTDSRTIIDTNGAEKLLGRGDMLFLPMGENKPIRIQGAFISDQEVERVVAFVTDQQEAEYQESMMPTDEPTTSGGGEAPQDELFEEAKNLVVEMQTASISLLQRRFRIGYNRAARLVDELEAHGVIGPSEGSKPRKVFLQAESEEAAPETPEQ
>NZ_KI913078.1|WP_002364250.1|52437_53301_-|AraC-family-transcriptional-regulator
MLANLNQAMDYIEEHLTEEVSFDELAKKTGISVYHFKRTFSFVAGMSLAEYIKKRRLAEANLALLAGKKVTDVAFKYGYQSIEGFSRAFRDWTGQAPSEVMKTQIQKTFPKFSFYIDIKGGQSMDVKLIEKPAFQIVGVSQKVPLQYQGENQAIMELAQRITPQQRAEMHTFDDVYPHQVVNASFDFQEGRTTEGGEMTHMIGFATSQENTYEDLEQLSVPAHTWAVFPNEGPFPQTLQETWARIFSEWLPSSGYQVVAAPEISFTQYQGPAEAKYSEIWLAVTATK
>NZ_KI913078.1|WP_002414495.1|53385_55467_-|DNA-topoisomerase-III
MVAKQLIIAEKPSVAKDLSRVLGANQKNKNYYEGPNVIVTWALGHLLGLKMPEDLNKEWQTWQMETLPMIPKNLGIKPLPKTGHQLKAIKQLANRKDVSEAVIATDAGREGELVARWILEYVRFNKPVKRLWISSQTDKAIKDGFKKIRPAKDYDNLYYSALARAKADWLVGLNVTRALTVKYQDNLSAGRVQTPTLAMVRQQEKTIEQFKPQTYFTISLTVESEKAKMTQKNPYALKERQEAEQLVKELSKQKGLVTDIQEKVKTENAPLPYDLTEIQREANQRFQFSAKKTLSLVQSLYETHKIVSYPRTDSKYLTTDTKGTMKERLQAIADFSPEVKGYLKNGAVVKQQKVFQNAKVTDHHGLIPTEQRPRYEKLSNDEQKIYQMIVQRFLGLFAEPNQTKQTKVTVAFGKETFVFHQNKVVVAGWKTTAEQPLSTVQWQKGMTVAPNFTINKELTSPPKPLTEGTLLGKMEKHSLGTPATRAEIIEKLIKSELMERTNSGLSVSAKGKQLLDLVNPSLVTPELTAKWEKSLEAIASGQQKSQLFLKDIEEDTKKLVREIKQSEKKYQDFSITQKKCPDCGSNLREKNTKDGKIYVCTNQECSYRRRKDPKVSNHRCPQCHKKMVIIEGKNGRSFKCKFCSITEKIPDKKERKQKMTKHEERRLMKKYSQPDEPEESALAQALKAAMNQE
>NZ_KI913078.1|WP_002356966.1|55597_55963_-|DUF1033-family-protein
MYQVITMYGDNEPWWFFDDWQEDIVQEKTFDNLTDAETYYVEVWQKLSQNYTYVNTKPNYLTAFWNDGEERWCEECDEDLQQYFGLALLENHHAVTFENKAEFTTISNHFGKTKFCKRKVI
>NZ_KI913078.1|WP_002364252.1|56059_56629_-|TetR/AcrR-family-transcriptional-regulator
MAKKRNLTKAKILESARNLAEELGVQQLTFQNLAVDLGIKYPSLYNHFKNIAEVKNALVDLLIQELNDALRRALVGKSGAEAIRIYAETYQQFAFENSAVYELLISVPKTQNQQLIEGIHETNQIILQLLAFYPFNNEERLHKSRELRSLIHGYITLRFLGYFQREEATPEESYRRMIEDFIASLEVAR
>NZ_KI913078.1|WP_002362073.1|56761_57277_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MHITNRSHLADRYGKRTSAEFLLHERPILSFPISLAAIPKEARYLSWELIDYDTIPLIGFPFIHWLAANVPVTNEIPEDFSRTALKPTIQGKNSLASPLGKQMIPALATETLPELTERYLGLSPRSGVHTYTLYVYATKNPLNLKEGFFANELHQALNDQRLAKAKFEFLY
>NZ_KI913078.1|WP_002364253.1|58504_58654_-|hypothetical-protein
MLVIKPVNISFSFLFYMPIFFKIRKREKLKIQIVDNFSVYNLVIIFLFF
>NZ_KI913078.1|WP_002364254.1|58710_59835_-|tRNA-2-thiouridine(34)-synthase-MnmA
MADNSKRRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVAKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQLGADYVATGHYAQVETDENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGMEKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLPAKKGNMVTEDGEIKGQHDGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVHFTVDTPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVFYDGMECLGGGLIDRAYQDEKELQYV
>NZ_KI913078.1|WP_002356959.1|60060_60405_-|DUF1831-domain-containing-protein
MAFTTTAAVEGSTVFYKVHPSAKRYTLKDNGFTETKSGNFQLIRSLDPTPQRNEGFKLKITITADLKELKMSITTANGLKPMNIFKNEQHEMSKEKYFFLMDGLISRGVLEKVE
>NZ_KI913078.1|WP_002360007.1|60472_61618_-|cysteine-desulfurase
MEPIYLDHAATTPLHPTVIQAMTENMQTTFGNPSSIHQFGRKAHGLLEEVRQTIAESLQAKPHEIIFNSGGTEGDNTAILAVAFSRQKEGKHIITTAIEHPAVLRTMEYLETLGFEVTYLPVNENGQISMDQFKKSLREETILVSMMYGNNEIGNRLPIAEVGAILKNHSAIFHTDAVQAYGSEVILPHELGIDLLSISAHKINGPKGVGFLFKSDAIQLPPLLHGGEQEEKRRAGTENLAGIIGMGTAVSLLTSAEKQARKTAYQSFQTIILKALEEANIDFSINGEPTNRLAHVLNLHLKGIPSDLLLMHLDLRGIAISTGSACTAGTVDPSHVLTAMYGENSSAIKESIRISFGYGNTPEEIATFSEVLVAVIQQLKK
>NZ_KI913078.1|WP_002364256.1|61774_62749_-|ribose-phosphate-diphosphokinase
MTENYQDDTLRIFSLNANRPLAEKIAASVGTELGKSTVRQFSDGEIQINIEESIRGDHVYIIQATNAPVNDHLMELLILIDALKRASAKTINVILPYYGYARQDRTAKPREPITAKLVANMLVEAGATRLLTLDLHTVQVQGFFDIPVDNLFTMPLFAHYYRQQALVGEEIVIVSPKNSGVQRARSLSEYLDATLAIVDHEEIDGVRQEGYVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEVYACASHGLLSEGAKATLENAPIKEISITDSVYTTADRQPATLNIISCAELMGEALLRIHENKPMSPLFRLESKGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MF157411	Escherichia coli strain EC1000 plasmid pCR2, complete sequence	304-333	0	1.0
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MH375074	Enterococcus phage LY0323, complete genome	32049-32078	0	1.0
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	NC_042127	Enterococcus phage vB_EfaS_AL2, complete genome	31836-31865	0	1.0
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	NC_031260	Enterococcus phage Ec-ZZ2, complete genome	21847-21876	0	1.0
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	KF733017	Enterococcus phage IME-EF4, complete genome	31981-32010	0	1.0
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MH375074	Enterococcus phage LY0323, complete genome	32051-32074	0	1.0
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	NC_042127	Enterococcus phage vB_EfaS_AL2, complete genome	31838-31861	0	1.0
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	NC_031260	Enterococcus phage Ec-ZZ2, complete genome	21849-21872	0	1.0
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	KF733017	Enterococcus phage IME-EF4, complete genome	31983-32006	0	1.0
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP022485	Enterococcus faecalis ARO1/DG plasmid pARO1.2, complete sequence	4124-4153	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	38052-38081	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	1579-1608	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	CP002493	Enterococcus faecalis 62 plasmid EF62pB, complete sequence	38720-38749	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	43030-43059	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	47853-47882	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	53323-53352	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NC_006827	Enterococcus faecalis plasmid pCF10, complete sequence	59015-59044	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	40051-40080	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP028283	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed3, complete sequence	4491-4520	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	41009-41038	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP042215	Enterococcus faecalis strain L15 plasmid pL15-A, complete sequence	4208-4237	1	0.967
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_MG765452	Enterococcus faecalis strain E512 plasmid pE512, complete sequence	16118-16147	1	0.967
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	CAJDJX010000002	Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence	31516-31545	1	0.967
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	10682-10711	1	0.967
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	CAJDJX010000002	Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence	31520-31543	1	0.958
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MK721190	Enterococcus phage vB_EfaS_Ef6.4, complete genome	27973-27996	1	0.958
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	10686-10709	1	0.958
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	NZ_CP041739	Enterococcus faecalis EnGen0107 strain B594 plasmid p1, complete sequence	24217-24246	2	0.933
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MK721199	Enterococcus phage vB_EfaS_Ef5.1, complete genome	28065-28094	2	0.933
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MK721190	Enterococcus phage vB_EfaS_Ef6.4, complete genome	27969-27998	2	0.933
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MK721200	Enterococcus phage vB_EfaS_Ef5.3, complete genome	28357-28386	2	0.933
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	NC_031260	Enterococcus phage Ec-ZZ2, complete genome	981-1010	2	0.933
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	KF733017	Enterococcus phage IME-EF4, complete genome	11644-11673	2	0.933
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	8300-8329	2	0.933
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MT119359	Enterococcus phage heks, complete genome	11839-11868	2	0.933
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	CAJDJX010000002	Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence	11642-11671	2	0.933
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MK125140	Enterococcus phage Nonaheksakonda, complete genome	7356-7385	2	0.933
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MK982307	Enterococcus phage MSF2, complete genome	14541-14570	2	0.933
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MK721199	Enterococcus phage vB_EfaS_Ef5.1, complete genome	28069-28092	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MK721200	Enterococcus phage vB_EfaS_Ef5.3, complete genome	28361-28384	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	32058-32081	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	NC_031260	Enterococcus phage Ec-ZZ2, complete genome	983-1006	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	KF728385	Enterococcus phage IME_EF3, complete genome	29908-29931	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	KF733017	Enterococcus phage IME-EF4, complete genome	11646-11669	2	0.917
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	KJ127304	Enterococcus phage AUEF3, partial genome	19402-19425	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	8304-8327	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MT119359	Enterococcus phage heks, complete genome	11843-11866	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	CAJDJX010000002	Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence	11646-11669	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MK125140	Enterococcus phage Nonaheksakonda, complete genome	7360-7383	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MK125140	Enterococcus phage Nonaheksakonda, complete genome	9738-9761	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MG264739	UNVERIFIED: Enterococcus phage phiNASRA1, complete genome	19946-19969	2	0.917
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	MK982307	Enterococcus phage MSF2, complete genome	14545-14568	2	0.917
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	CAJDKF010000002	Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence	32054-32083	3	0.9
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	KF728385	Enterococcus phage IME_EF3, complete genome	29904-29933	3	0.9
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	KJ127304	Enterococcus phage AUEF3, partial genome	19398-19427	3	0.9
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MK125140	Enterococcus phage Nonaheksakonda, complete genome	9734-9763	3	0.9
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	MG264739	UNVERIFIED: Enterococcus phage phiNASRA1, complete genome	19944-19973	3	0.9
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	156580-156603	3	0.875
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MT074134	Bacteroides phage ARB14, complete genome	36884-36907	4	0.833
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MT074143	Bacteroides phage HNL05, complete genome	37284-37307	4	0.833
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MT074135	Bacteroides phage ARB25, complete genome	36797-36820	4	0.833
NZ_KI913078_1	1.6\|52155\|24\|NZ_KI913078\|PILER-CR	52155-52178	24	MT074144	Bacteroides phage HNL35, complete genome	37325-37348	4	0.833
NZ_KI913078_1	1.7\|52221\|24\|NZ_KI913078\|PILER-CR	52221-52244	24	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	231611-231634	4	0.833
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	413391-413420	5	0.833
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MK496783	Capybara microvirus Cap3_SP_410, complete genome	3412-3441	6	0.8
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MN693358	Marine virus AFVG_25M395, complete genome	6141-6170	6	0.8
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MN694190	Marine virus AFVG_250M608, complete genome	30089-30118	6	0.8
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MT074134	Bacteroides phage ARB14, complete genome	36880-36909	6	0.8
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MT074143	Bacteroides phage HNL05, complete genome	37280-37309	6	0.8
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MT074135	Bacteroides phage ARB25, complete genome	36793-36822	6	0.8
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	MT074144	Bacteroides phage HNL35, complete genome	37321-37350	6	0.8
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NC_014502	Gloeothece verrucosa PCC 7822 plasmid Cy782203, complete sequence	268334-268363	7	0.767
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP032754	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence	26827-26856	7	0.767
NZ_KI913078_1	1.2\|52017\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52017-52046	30	MN694044	Marine virus AFVG_250M514, complete genome	29776-29805	7	0.767
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	156576-156605	7	0.767
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	20908-20937	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP025692	Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence	133-162	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035559	Lactobacillus plantarum strain SRCM103297 plasmid unnamed3	24727-24756	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	22589-22618	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	87952-87981	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP028270	Pediococcus pentosaceus strain SRCM102740 plasmid unnamed1, complete sequence	22740-22769	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP028267	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed1, complete sequence	9446-9475	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP015919	Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence	11178-11207	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP021931	Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence	27801-27830	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP024059	Lactobacillus plantarum strain KACC 92189 plasmid unnamed1	53320-53349	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP028265	Pediococcus pentosaceus strain SRCM102738 plasmid unnamed1, complete sequence	32031-32060	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP018326	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-2, complete sequence	38976-39005	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP018327	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence	992-1021	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035116	Lactobacillus plantarum strain SRCM103295 plasmid unnamed3	94597-94626	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP018798	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.2, complete sequence	27103-27132	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP019582	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_1, complete sequence	10189-10218	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035308	Lactobacillus helveticus strain IDCC3801 plasmid pHel23910, complete sequence	20537-20566	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP025415	Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence	13215-13244	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP021928	Pediococcus pentosaceus strain SRCM100194 plasmid pPP194-2, complete sequence	6938-6967	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	36987-37016	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP050806	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence	19494-19523	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	6123-6152	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP029967	Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence	28417-28446	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP028277	Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence	54324-54353	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	22761-22790	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	LT615366	Enterococcus phage VPE25 genome assembly, chromosome: VPE25	14742-14771	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	LT546029	Enterococcus phage VFW genome assembly, chromosome: VFW	14675-14704	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	LT546030	Enterococcus phage VPE25 genome assembly, chromosome: I	14742-14771	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MT119360	Enterococcus phage nattely, complete genome	14821-14850	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	MT119361	Enterococus phage vipetofem, complete genome	70537-70566	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	HG796796	Uncultured bacterium plasmid pRGF00045	2663-2692	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	324412-324441	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	106037-106066	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	14249-14278	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	232571-232600	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	349574-349603	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	232572-232601	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	258608-258637	8	0.733
NZ_KI913078_1	1.3\|52083\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52083-52112	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	232184-232213	8	0.733
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	NZ_CP047122	Lactobacillus hilgardii strain FLUB plasmid unnamed1	39415-39444	9	0.7
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	KM359505	Prochlorococcus phage P-TIM68, complete genome	108590-108619	9	0.7
NZ_KI913078_1	1.1\|51951\|30\|NZ_KI913078\|CRISPRCasFinder	51951-51980	30	KY971610	Pseudomonas phage PspYZU05, complete genome	121642-121671	9	0.7
NZ_KI913078_1	1.4\|52149\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52149-52178	30	NZ_CP045274	Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence	28090-28119	9	0.7
NZ_KI913078_1	1.5\|52215\|30\|NZ_KI913078\|CRISPRCasFinder,CRT	52215-52244	30	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	231607-231636	9	0.7

1. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MF157411 (Escherichia coli strain EC1000 plasmid pCR2, complete sequence) position: , mismatch: 0, identity: 1.0

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aggggagaaaaagccaaatcaaaaaagttt	Protospacer
******************************

2. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MH375074 (Enterococcus phage LY0323, complete genome) position: , mismatch: 0, identity: 1.0

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcggacaggtgacgccagcagat	Protospacer
******************************

3. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_042127 (Enterococcus phage vB_EfaS_AL2, complete genome) position: , mismatch: 0, identity: 1.0

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcggacaggtgacgccagcagat	Protospacer
******************************

4. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_031260 (Enterococcus phage Ec-ZZ2, complete genome) position: , mismatch: 0, identity: 1.0

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcggacaggtgacgccagcagat	Protospacer
******************************

5. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to KF733017 (Enterococcus phage IME-EF4, complete genome) position: , mismatch: 0, identity: 1.0

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcggacaggtgacgccagcagat	Protospacer
******************************

6. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MH375074 (Enterococcus phage LY0323, complete genome) position: , mismatch: 0, identity: 1.0

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcggacaggtgacgccagcag	Protospacer
************************

7. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to NC_042127 (Enterococcus phage vB_EfaS_AL2, complete genome) position: , mismatch: 0, identity: 1.0

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcggacaggtgacgccagcag	Protospacer
************************

8. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to NC_031260 (Enterococcus phage Ec-ZZ2, complete genome) position: , mismatch: 0, identity: 1.0

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcggacaggtgacgccagcag	Protospacer
************************

9. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to KF733017 (Enterococcus phage IME-EF4, complete genome) position: , mismatch: 0, identity: 1.0

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcggacaggtgacgccagcag	Protospacer
************************

10. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP022485 (Enterococcus faecalis ARO1/DG plasmid pARO1.2, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

11. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgtaaatcacaatcttttgtaagtc	Protospacer
****************.*************

12. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

13. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CP002493 (Enterococcus faecalis 62 plasmid EF62pB, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

14. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

15. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

16. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

17. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_006827 (Enterococcus faecalis plasmid pCF10, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgtaaatcacaatcttttgtaagtc	Protospacer
****************.*************

18. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

19. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP028283 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

20. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

21. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP042215 (Enterococcus faecalis strain L15 plasmid pL15-A, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

22. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_MG765452 (Enterococcus faecalis strain E512 plasmid pE512, complete sequence) position: , mismatch: 1, identity: 0.967

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacagtcttttgtaagtc	Protospacer
*******.**********************

23. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CAJDJX010000002 (Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence) position: , mismatch: 1, identity: 0.967

tatggttttgaataaattgtacatcattat	CRISPR spacer
tatggttttgaataaattgcacatcattat	Protospacer
*******************.**********

24. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 1, identity: 0.967

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacgccagcagat	Protospacer
******** *********************

25. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to CAJDJX010000002 (Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence) position: , mismatch: 1, identity: 0.958

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaataaattgcacatcatt	Protospacer
***************.********

26. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MK721190 (Enterococcus phage vB_EfaS_Ef6.4, complete genome) position: , mismatch: 1, identity: 0.958

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgtacatcatt	Protospacer
*********.**************

27. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 1, identity: 0.958

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacgccagcag	Protospacer
**** *******************

28. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP041739 (Enterococcus faecalis EnGen0107 strain B594 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
tataacgcaaatcacaatcttttgtaagtc	Protospacer
*******.********.*************

29. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK721199 (Enterococcus phage vB_EfaS_Ef5.1, complete genome) position: , mismatch: 2, identity: 0.933

tatggttttgaataaattgtacatcattat	CRISPR spacer
tatggttttgaatgaattgcacatcattat	Protospacer
*************.*****.**********

30. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK721190 (Enterococcus phage vB_EfaS_Ef6.4, complete genome) position: , mismatch: 2, identity: 0.933

tatggttttgaataaattgtacatcattat	CRISPR spacer
tgtggttttgaatgaattgtacatcattat	Protospacer
*.***********.****************

31. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK721200 (Enterococcus phage vB_EfaS_Ef5.3, complete genome) position: , mismatch: 2, identity: 0.933

tatggttttgaataaattgtacatcattat	CRISPR spacer
tatggttttgaatgaattgcacatcattat	Protospacer
*************.*****.**********

32. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_031260 (Enterococcus phage Ec-ZZ2, complete genome) position: , mismatch: 2, identity: 0.933

tatggttttgaataaattgtacatcattat	CRISPR spacer
tatggttttgaatgaattgcacatcattat	Protospacer
*************.*****.**********

33. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to KF733017 (Enterococcus phage IME-EF4, complete genome) position: , mismatch: 2, identity: 0.933

tatggttttgaataaattgtacatcattat	CRISPR spacer
tatggttttgaatgaattgcacatcattat	Protospacer
*************.*****.**********

34. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 2, identity: 0.933

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacaccagcagat	Protospacer
******** ***********.*********

35. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MT119359 (Enterococcus phage heks, complete genome) position: , mismatch: 2, identity: 0.933

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcgggcaggtgacaccagcagat	Protospacer
***********.********.*********

36. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CAJDJX010000002 (Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence) position: , mismatch: 2, identity: 0.933

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacaccagcagat	Protospacer
******** ***********.*********

37. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK125140 (Enterococcus phage Nonaheksakonda, complete genome) position: , mismatch: 2, identity: 0.933

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtcgggcaggtgacaccagcagat	Protospacer
***********.********.*********

38. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK982307 (Enterococcus phage MSF2, complete genome) position: , mismatch: 2, identity: 0.933

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacaccagcagat	Protospacer
******** ***********.*********

39. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MK721199 (Enterococcus phage vB_EfaS_Ef5.1, complete genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

40. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MK721200 (Enterococcus phage vB_EfaS_Ef5.3, complete genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

41. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

42. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to NC_031260 (Enterococcus phage Ec-ZZ2, complete genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

43. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to KF728385 (Enterococcus phage IME_EF3, complete genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgaacatcatt	Protospacer
*********.***** ********

44. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to KF733017 (Enterococcus phage IME-EF4, complete genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

45. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to KJ127304 (Enterococcus phage AUEF3, partial genome) position: , mismatch: 2, identity: 0.917

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaatgaattgcacatcatt	Protospacer
*********.*****.********

46. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacaccagcag	Protospacer
**** ***********.*******

47. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MT119359 (Enterococcus phage heks, complete genome) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcgggcaggtgacaccagcag	Protospacer
*******.********.*******

48. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to CAJDJX010000002 (Enterococcus phage Q69 genome assembly, contig: phageQ69-genome, whole genome shotgun sequence) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacaccagcag	Protospacer
**** ***********.*******

49. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MK125140 (Enterococcus phage Nonaheksakonda, complete genome) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcgggcaggtgacaccagcag	Protospacer
*******.********.*******

50. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MK125140 (Enterococcus phage Nonaheksakonda, complete genome) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacaccagcag	Protospacer
**** ***********.*******

51. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MG264739 (UNVERIFIED: Enterococcus phage phiNASRA1, complete genome) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacaccagcag	Protospacer
**** ***********.*******

52. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to MK982307 (Enterococcus phage MSF2, complete genome) position: , mismatch: 2, identity: 0.917

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtaggacaggtgacaccagcag	Protospacer
**** ***********.*******

53. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to CAJDKF010000002 (Enterococcus phage vB_EfaS_159 genome assembly, contig: phage159-genome, whole genome shotgun sequence) position: , mismatch: 3, identity: 0.9

tatggttttgaataaattgtacatcattat	CRISPR spacer
tgtggttttgaatgaattgcacatcattat	Protospacer
*.***********.*****.**********

54. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to KF728385 (Enterococcus phage IME_EF3, complete genome) position: , mismatch: 3, identity: 0.9

tatggttttgaataaattgtacatcattat	CRISPR spacer
tgtggttttgaatgaattgaacatcattat	Protospacer
*.***********.***** **********

55. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to KJ127304 (Enterococcus phage AUEF3, partial genome) position: , mismatch: 3, identity: 0.9

tatggttttgaataaattgtacatcattat	CRISPR spacer
tgtggttttgaatgaattgcacatcattat	Protospacer
*.***********.*****.**********

56. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MK125140 (Enterococcus phage Nonaheksakonda, complete genome) position: , mismatch: 3, identity: 0.9

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacaccagcagaa	Protospacer
******** ***********.********

57. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MG264739 (UNVERIFIED: Enterococcus phage phiNASRA1, complete genome) position: , mismatch: 3, identity: 0.9

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
cctgtggtaggacaggtgacaccagcagac	Protospacer
******** ***********.********.

58. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.875

gttttgaataaattgtacatcatt	CRISPR spacer
tttttgaataaaatgtacctcatt	Protospacer
 *********** ***** *****

59. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MT074134 (Bacteroides phage ARB14, complete genome) position: , mismatch: 4, identity: 0.833

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaataaattgtatatcgaa	Protospacer
*****************.***.

60. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MT074143 (Bacteroides phage HNL05, complete genome) position: , mismatch: 4, identity: 0.833

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaataaattgtatatcgaa	Protospacer
*****************.***.

61. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MT074135 (Bacteroides phage ARB25, complete genome) position: , mismatch: 4, identity: 0.833

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaataaattgtatatcgaa	Protospacer
*****************.***.

62. spacer 1.6|52155|24|NZ_KI913078|PILER-CR matches to MT074144 (Bacteroides phage HNL35, complete genome) position: , mismatch: 4, identity: 0.833

gttttgaataaattgtacatcatt	CRISPR spacer
gttttgaataaattgtatatcgaa	Protospacer
*****************.***.

63. spacer 1.7|52221|24|NZ_KI913078|PILER-CR matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 4, identity: 0.833

tggtcggacaggtgacgccagcag	CRISPR spacer
tggtcggaaaggtgacgccagtct	Protospacer
******** ************.

64. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 5, identity: 0.833

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
catgatgtaggacaggtgacgccagcggat	Protospacer
* **  ** *****************.***

65. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MK496783 (Capybara microvirus Cap3_SP_410, complete genome) position: , mismatch: 6, identity: 0.8

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
agggcagaaaaagccaaatcaagaattatc	Protospacer
**** *****************.**   *.

66. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MN693358 (Marine virus AFVG_25M395, complete genome) position: , mismatch: 6, identity: 0.8

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aacgcacaaaaagcccaatcaaaaaagatt	Protospacer
*. * * ******** *********** **

67. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MN694190 (Marine virus AFVG_250M608, complete genome) position: , mismatch: 6, identity: 0.8

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
tggagtgcgaaagccaaatcaaaaaaggtt	Protospacer
 **.* * .****************** **

68. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MT074134 (Bacteroides phage ARB14, complete genome) position: , mismatch: 6, identity: 0.8

tatggttttgaataaattgtacatcattat	CRISPR spacer
aaaggttttgaataaattgtatatcgaaat	Protospacer
 * ******************.***.  **

69. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MT074143 (Bacteroides phage HNL05, complete genome) position: , mismatch: 6, identity: 0.8

tatggttttgaataaattgtacatcattat	CRISPR spacer
aaaggttttgaataaattgtatatcgaaat	Protospacer
 * ******************.***.  **

70. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MT074135 (Bacteroides phage ARB25, complete genome) position: , mismatch: 6, identity: 0.8

tatggttttgaataaattgtacatcattat	CRISPR spacer
aaaggttttgaataaattgtatatcgaaat	Protospacer
 * ******************.***.  **

71. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MT074144 (Bacteroides phage HNL35, complete genome) position: , mismatch: 6, identity: 0.8

tatggttttgaataaattgtacatcattat	CRISPR spacer
aaaggttttgaataaattgtatatcgaaat	Protospacer
 * ******************.***.  **

72. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NC_014502 (Gloeothece verrucosa PCC 7822 plasmid Cy782203, complete sequence) position: , mismatch: 7, identity: 0.767

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aatcaacaaaaagccaaaacaaaaaagtta	Protospacer
*.  .* *********** **********

73. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP032754 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaatttct	Protospacer
*.  ********* ***********  *.*

74. spacer 1.2|52017|30|NZ_KI913078|CRISPRCasFinder,CRT matches to MN694044 (Marine virus AFVG_250M514, complete genome) position: , mismatch: 7, identity: 0.767

tataacgtaaatcacagtcttttgtaagtc	CRISPR spacer
aactgcataaatcacaggcttttgtaagcc	Protospacer
 *. .*.********** **********.*

75. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 7, identity: 0.767

tatggttttgaataaattgtacatcattat	CRISPR spacer
aagttttttgaataaaatgtacctcattag	Protospacer
 *   *********** ***** ******

76. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

77. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP025692 (Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

78. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035559 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

79. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

80. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

81. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP028270 (Pediococcus pentosaceus strain SRCM102740 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

82. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP028267 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

83. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP015919 (Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

84. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP021931 (Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

85. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP024059 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

86. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP028265 (Pediococcus pentosaceus strain SRCM102738 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

87. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP018326 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-2, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

88. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP018327 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

89. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035116 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

90. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP018798 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.2, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

91. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP019582 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

92. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035308 (Lactobacillus helveticus strain IDCC3801 plasmid pHel23910, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

93. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP025415 (Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

94. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP021928 (Pediococcus pentosaceus strain SRCM100194 plasmid pPP194-2, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

95. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

96. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP050806 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

97. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

98. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP029967 (Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

99. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP028277 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

100. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
aattgagaaaaaggcaaatcaaaaattcct	Protospacer
*.  ********* ***********  ..*

101. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to LT615366 (Enterococcus phage VPE25 genome assembly, chromosome: VPE25) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
cgaaaagaaaaagccaaatcacaagagtag	Protospacer
 *...**************** **.***

102. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to LT546029 (Enterococcus phage VFW genome assembly, chromosome: VFW) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
cgaaaagaaaaagccaaatcacaagagtag	Protospacer
 *...**************** **.***

103. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to LT546030 (Enterococcus phage VPE25 genome assembly, chromosome: I) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
cgaaaagaaaaagccaaatcacaagagtag	Protospacer
 *...**************** **.***

104. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MT119360 (Enterococcus phage nattely, complete genome) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
cgaaaagaaaaagccaaatcacaagagtag	Protospacer
 *...**************** **.***

105. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to MT119361 (Enterococus phage vipetofem, complete genome) position: , mismatch: 8, identity: 0.733

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
cgaaaagaaaaagccaaatcacaagagtag	Protospacer
 *...**************** **.***

106. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to HG796796 (Uncultured bacterium plasmid pRGF00045) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
attgatgtagttgattcagaaaaagttgag	Protospacer
***.*.****************** . ..

107. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

108. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

109. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

110. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

111. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

112. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

113. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

114. spacer 1.3|52083|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

115. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to NZ_CP047122 (Lactobacillus hilgardii strain FLUB plasmid unnamed1) position: , mismatch: 9, identity: 0.7

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
taacatctcaaagccaaatcaaaaaagttt	Protospacer
 .. .    *********************

116. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to KM359505 (Prochlorococcus phage P-TIM68, complete genome) position: , mismatch: 9, identity: 0.7

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
caaagagaaaaagcaaaattaaaaaaggaa	Protospacer
 ...********** ****.*******

117. spacer 1.1|51951|30|NZ_KI913078|CRISPRCasFinder matches to KY971610 (Pseudomonas phage PspYZU05, complete genome) position: , mismatch: 9, identity: 0.7

aggggagaaaaagccaaatcaaaaaagttt	CRISPR spacer
gaaagagaaaaagcaaaatcaaaaacctaa	Protospacer
....********** **********  *

118. spacer 1.4|52149|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_CP045274 (Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence) position: , mismatch: 9, identity: 0.7

tatggttttgaataaattgtacatcattat	CRISPR spacer
ataggtttttaataaattgtaaatcaagtg	Protospacer
   ****** *********** ****

119. spacer 1.5|52215|30|NZ_KI913078|CRISPRCasFinder,CRT matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 9, identity: 0.7

cctgtggtcggacaggtgacgccagcagat	CRISPR spacer
agcgtggtcggaaaggtgacgccagtcttc	Protospacer
  .********* ************.   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

377 : 30227

Enterococcus_phage(36.0%)

portal,integrase,tail,terminase

attL 4774:4788|attR 38423:38437

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033624668.1\|377_1823_-	peptidase M23	A0A1S5SA59	Streptococcus_phage	8.2e-70	36.5
WP_002363380.1\|1822_2545_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	6.0e-37	37.6
WP_033624669.1\|2541_6996_-\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	4.9e-89	48.7
4774:4788	attL	NA	NA	NA	NA
WP_002364305.1\|6982_7288_-	hypothetical protein	NA	NA	NA	NA
WP_002409775.1\|7356_7755_-	hypothetical protein	NA	NA	NA	NA
WP_010784604.1\|7817_8126_-	hypothetical protein	C9E2K1	Enterococcus_phage	2.2e-09	53.3
WP_025194241.1\|8128_8734_-\|tail	phage major tail protein, TP901-1 family	A0A1X9IGH1	Lactococcus_phage	1.3e-21	35.6
WP_023042479.1\|8752_9145_-	hypothetical protein	NA	NA	NA	NA
WP_010816898.1\|9141_9480_-	hypothetical protein	A0A1X9IGH0	Lactococcus_phage	1.9e-14	40.0
WP_002378454.1\|9476_9752_-	hypothetical protein	NA	NA	NA	NA
WP_002363369.1\|9748_10081_-	hypothetical protein	A0A097BY74	Leuconostoc_phage	3.1e-09	38.9
WP_002363368.1\|10151_11048_-	hypothetical protein	U3PDP8	Lactobacillus_phage	3.3e-69	49.8
WP_002378456.1\|11061_11715_-	hypothetical protein	NA	NA	NA	NA
WP_033593778.1\|11819_12746_-	hypothetical protein	A0A097QPZ9	Enterococcus_phage	1.8e-131	98.4
WP_010784607.1\|12738_14223_-\|portal	phage portal protein	A0A097QPZ5	Enterococcus_phage	3.8e-139	99.6
WP_002369892.1\|14222_15506_-\|terminase	PBSX family phage terminase large subunit	Q9AZ91	Lactobacillus_prophage	6.0e-157	65.5
WP_002364295.1\|15486_15921_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-44	64.5
WP_002369893.1\|15952_16117_-	hypothetical protein	NA	NA	NA	NA
WP_010784609.1\|16615_17080_-	hypothetical protein	NA	NA	NA	NA
WP_010784610.1\|17109_18060_-	hypothetical protein	NA	NA	NA	NA
WP_002357018.1\|18769_19186_-	autolysin	D2IZ17	Enterococcus_phage	1.4e-67	99.3
WP_002357017.1\|19552_19813_-	hypothetical protein	NA	NA	NA	NA
WP_010784611.1\|20092_20497_-	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.5e-58	85.0
WP_002364343.1\|20496_21354_-	helix-turn-helix domain-containing protein	A0A0P0ICZ8	Lactobacillus_phage	1.1e-24	36.1
WP_002357010.1\|21353_21554_-	hypothetical protein	NA	NA	NA	NA
WP_002364344.1\|21558_22200_-	hypothetical protein	U5U4M2	Lactobacillus_phage	4.8e-30	36.0
WP_002364345.1\|22204_22939_-	ERF family protein	A0A1W6JNQ5	Staphylococcus_phage	2.3e-20	29.9
WP_002357007.1\|22931_23249_-	hypothetical protein	NA	NA	NA	NA
WP_002357006.1\|23468_24023_+	hypothetical protein	V9QKZ3	Oenococcus_phage	2.4e-06	24.5
WP_002364347.1\|24307_24646_-	hypothetical protein	NA	NA	NA	NA
WP_002399426.1\|24682_24892_-	hypothetical protein	D2IZ57	Enterococcus_phage	1.4e-18	74.2
WP_002364350.1\|24946_25135_+	YegP family protein	NA	NA	NA	NA
WP_002364352.1\|25160_25886_-	phage regulatory protein	A0A0P0IDD0	Lactobacillus_phage	6.4e-31	54.0
WP_002381719.1\|25924_26236_-	hypothetical protein	NA	NA	NA	NA
WP_033624736.1\|26247_26415_-	hypothetical protein	D2IZW2	Enterococcus_phage	2.1e-09	57.4
WP_010712611.1\|26832_27030_-	hypothetical protein	NA	NA	NA	NA
WP_002358110.1\|27042_27225_-	hypothetical protein	NA	NA	NA	NA
WP_002392358.1\|27521_27854_+	helix-turn-helix transcriptional regulator	D2IZV9	Enterococcus_phage	2.5e-30	57.3
WP_002378467.1\|27871_28216_+	ImmA/IrrE family metallo-endopeptidase	A0A097QQ08	Enterococcus_phage	3.2e-41	71.7
WP_010784612.1\|28250_28979_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	2.4e-22	48.9
WP_002388210.1\|29078_30227_+\|integrase	site-specific integrase	A0A1C8E994	Bacillus_phage	2.3e-38	30.7
38423:38437	attR	NA	NA	NA	NA

DBSCAN-SWA_2

140516 : 158042

Streptococcus_phage(94.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001291561.1\|140516_141734_-\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|141815_142019_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001845478.1\|142002_142254_+	hypothetical protein	NA	NA	NA	NA
WP_000857133.1\|142479_142710_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|142706_143129_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_013670292.1\|143357_143429_-	hypothetical protein	NA	NA	NA	NA
WP_001227347.1\|143633_143987_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_011058338.1\|144046_144232_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_002414694.1\|144332_146252_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A2K5B2A5	Erysipelothrix_phage	0.0e+00	99.7
WP_012386611.1\|146267_146354_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224320.1\|146628_147564_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_000769868.1\|147560_148562_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|148558_150736_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|150738_153186_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|153169_153676_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|153650_154148_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|154264_154486_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|154528_155734_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|155756_155909_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|155911_157297_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|157325_157712_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|157727_158042_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_KI913073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_KI913073_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_KI913073_1

1870-2001

Orphan

Consensus_repeat	Method
GTTGGTTTTTCCCACTTTCGAACA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_KI913073_1

>merge|NZ_KI913073|1|1870-2001|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACAAAGTACTGGTATTATTGGATTCTTCTGGACGTTGGTTTTTCCCACTTTCGAAAGAAACGCCGGTTTTATCATGTTTATCCGAAGGTTGGTTTTTCCCACTTTCGGGAA

>NZ_KI913073|1|1|1870-2001|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACA	AAGTACTGGTATTATTGGATTCTTCTGGAC
GTTGGTTTTTCCCACTTTCGAAAG	AAACGCCGGTTTTATCATGTTTATCCGAAG
GTTGGTTTTTCCCACTTTCGGGAA

>NZ_KI913073.1|WP_002399362.1|86_1244_-|TraB/GumN-family-protein
MEEDIVRLFYKGSEIILIGTSHISAESADLVRKTIQEENPDTICIEWDEKRYKKNIHPDEWDDTDIVKIIKNKQFPVFIFGVIYKLFQKKVSQDMNSLVGKEFVVAVDESKKLNIKFYLIDRDSSLTFKRAWRMLNFREKVKLPYAFGKIFEGAEETEEEVQNLLESENFEPVFEELKESYPNLWEVFVTERDDYLATKIQNTANGKTVAVLGKAHLKGVSDRLKNNQKSDLKKLEIIPPKKFGSKLLEWIVPGILLILLGVSFYQGTQVGIEQLLRWLLWNGGLSALFTIFALGHPLTVLTSLIFAPLATLLPMVSVGVFSAIVEATVRKPKVKDFQTMDLDLQSLKTIYKNRVLRVFLVFFLSSLGGLLGNIIGGLGIVKNLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5073-5102	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	602-631	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	515-544	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33709-33738	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7643-7672	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66171-66200	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12176-12205	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	503-532	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60906-60935	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92754-92783	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	503-532	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5526-5555	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43889-43918	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83505-83534	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9536-9565	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4944-4973	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	827-856	0	1.0
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	748-777	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	548-577	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	461-490	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33655-33684	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	449-478	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5472-5501	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43943-43972	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83451-83480	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4998-5027	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	773-802	1	0.967
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7697-7726	2	0.933
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66225-66254	2	0.933
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12230-12259	2	0.933
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60960-60989	2	0.933
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92808-92837	2	0.933
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	449-478	2	0.933
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31963-31992	6	0.8
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	MT711976	Streptomyces phage Coruscant, complete genome	87401-87430	7	0.767
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	586542-586571	7	0.767
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	40422-40451	8	0.733
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	149991-150020	8	0.733
NZ_KI913073_1	1.2\|1948\|30\|NZ_KI913073\|CRISPRCasFinder	1948-1977	30	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	2364-2393	8	0.733
NZ_KI913073_1	1.1\|1894\|30\|NZ_KI913073\|CRISPRCasFinder	1894-1923	30	JQ660954	Clostridium phage PhiS63, complete genome	22890-22919	9	0.7

1. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

2. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

3. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

4. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

5. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

6. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

7. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

8. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

9. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

10. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

11. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

12. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

13. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

14. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

15. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

16. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

17. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

18. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.967

aagtactggtattattggattcttctggac	CRISPR spacer
aagtcctggtattattggattcttctggac	Protospacer
**** *************************

19. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

20. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

21. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

22. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

23. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

24. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

25. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

26. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

27. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
********.*********************

28. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
***.****.*********************

29. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
******.*.*********************

30. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
***.****.*********************

31. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
***.****.*********************

32. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
***.****.*********************

33. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
******.*.*********************

34. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 6, identity: 0.8

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattaaaggattcttcaaaat	Protospacer
**************  ********* ..*.

35. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 7, identity: 0.767

aagtactggtattattggattcttctggac	CRISPR spacer
acagagtggttttattggcttcttctggat	Protospacer
* . * **** ******* **********.

36. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 7, identity: 0.767

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
aaacgccgtttttatcatttttaatggtgg	Protospacer
******** ********* **** . * .*

37. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
tagtgccggtcttatcatgtttatctttac	Protospacer
 *..******.**************.  *

38. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
tagtgccggtcttatcatgtttatctttac	Protospacer
 *..******.**************.  *

39. spacer 1.2|1948|30|NZ_KI913073|CRISPRCasFinder matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaacgccggttttatcatgtttatccgaag	CRISPR spacer
tagtgccggtcttatcatgtttatctttac	Protospacer
 *..******.**************.  *

40. spacer 1.1|1894|30|NZ_KI913073|CRISPRCasFinder matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 9, identity: 0.7

aagtactggtattattggattcttctggac	CRISPR spacer
ttgtactgatattattggtttcttcgtttt	Protospacer
  ******.********* ******    .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_KI913069

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146942 : 153652

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355354.1\|146942_147644_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.9e-16	40.8
WP_002386098.1\|147802_148372_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	3.1e-12	28.5
WP_002381196.1\|148416_149703_+	TPM domain-containing protein	NA	NA	NA	NA
WP_002355357.1\|149742_150708_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.1e-130	71.3
WP_002355358.1\|150908_153068_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.9e-266	63.3
WP_002355359.1\|153048_153426_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	D9J0S1	Brochothrix_phage	1.4e-13	34.9
WP_002355360.1\|153427_153652_-	redoxin NrdH	A0A0M7REK7	Lactobacillus_phage	6.4e-14	49.3

DBSCAN-SWA_2

157206 : 206258

Bacillus_phage(27.27%)

transposase,integrase,tRNA

attL 161401:161426|attR 211456:211481

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355365.1\|157206_158376_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	3.6e-31	28.9
WP_002355366.1\|158419_158650_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
161401:161426	attL	NA	NA	NA	NA
WP_002355369.1\|161678_162716_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002335374.1\|162741_163680_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002355370.1\|164204_164804_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.5e-28	35.6
WP_002294574.1\|166535_166991_+	copper-responsive transcriptional repressor TcrY	NA	NA	NA	NA
WP_002335389.1\|169545_169752_+	copper chaperone TcrZ	NA	NA	NA	NA
WP_010784692.1\|169890_171963_+	copper-translocating P-type ATPase TcrB	E4ZFI9	Streptococcus_phage	2.2e-60	29.4
WP_000653331.1\|172485_175458_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	3.6e-197	36.4
WP_000238804.1\|175588_176194_+	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	33.7
WP_010784694.1\|176197_176563_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_010783490.1\|176540_177125_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.0e-42	52.2
WP_002414917.1\|177368_177857_+\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_002392382.1\|179000_180209_+	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_002358522.1\|180338_180755_+	hypothetical protein	NA	NA	NA	NA
WP_002380052.1\|180784_180907_+	hypothetical protein	NA	NA	NA	NA
WP_010711388.1\|181051_181717_+	hypothetical protein	NA	NA	NA	NA
WP_077497736.1\|181762_182236_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.9e-08	32.6
WP_102882804.1\|182370_182664_+	recombinase family protein	NA	NA	NA	NA
WP_100815088.1\|182676_182883_+	hypothetical protein	NA	NA	NA	NA
WP_002363071.1\|182962_183781_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002363072.1\|183936_184644_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002363073.1\|184636_186139_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002358535.1\|186149_186632_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002358536.1\|187264_188029_-	YibE/F family protein	NA	NA	NA	NA
WP_002358539.1\|189417_189591_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002358540.1\|189603_189990_+	hypothetical protein	NA	NA	NA	NA
WP_002363076.1\|190041_190446_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_002363077.1\|190639_191710_+	ammonium transporter	NA	NA	NA	NA
WP_002363078.1\|191812_192946_+	NAD(P)-binding domain-containing protein	V9VEY6	Lactococcus_phage	2.2e-06	26.7
WP_002370911.1\|194014_194326_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.6e-23	65.6
WP_002367939.1\|194431_194707_-\|transposase	transposase	A0A0N9S8A3	Staphylococcus_phage	1.1e-10	40.9
WP_002358549.1\|195215_196382_-	ROK family transcriptional regulator	NA	NA	NA	NA
WP_002363081.1\|196747_198814_+	family 31 glucosidase	NA	NA	NA	NA
WP_002358551.1\|198813_199599_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002358552.1\|199591_200404_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002363085.1\|200428_200911_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002358554.1\|200922_201330_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002364888.1\|201434_202742_+	xylose isomerase	NA	NA	NA	NA
WP_002363087.1\|202803_204294_+	xylulokinase	NA	NA	NA	NA
WP_010706719.1\|205298_206258_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.9e-35	35.8
211456:211481	attR	NA	NA	NA	NA

DBSCAN-SWA_3

550590 : 558512

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355794.1\|550590_551649_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.1
WP_002403713.1\|551648_552605_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-23	33.9
WP_002355796.1\|552645_553716_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	7.6e-89	49.0
WP_002355797.1\|554116_554638_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.0e-14	33.3
WP_002355798.1\|554751_554952_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002403714.1\|555012_555372_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002363280.1\|555417_555768_-	hypothetical protein	NA	NA	NA	NA
WP_002358829.1\|555865_556225_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_002414664.1\|556352_556787_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002403715.1\|556804_557320_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	1.0e-38	48.8
WP_002403716.1\|557336_558512_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.5e-85	47.7

DBSCAN-SWA_4

912830 : 927138

Enterococcus_phage(27.27%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002357859.1\|912830_915227_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.7e-19	24.1
WP_002360497.1\|915251_915602_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002393873.1\|915684_915915_+	hypothetical protein	NA	NA	NA	NA
WP_002357857.1\|915974_916448_-	toxin	A0A097BY56	Enterococcus_phage	1.1e-60	71.2
WP_002357856.1\|916494_916977_-	helix-turn-helix transcriptional regulator	R9QTP6	Staphylococcus_phage	1.2e-20	48.6
WP_075551614.1\|917145_917328_+	hypothetical protein	NA	NA	NA	NA
WP_002357855.1\|917358_918129_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	2.5e-33	57.0
WP_002404235.1\|918147_918990_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	3.3e-31	31.0
WP_010706586.1\|918992_919085_+	hypothetical protein	NA	NA	NA	NA
WP_002381950.1\|919077_919449_+	hypothetical protein	NA	NA	NA	NA
WP_002357851.1\|919468_919876_+	RinA family phage transcriptional activator	E9LUP5	Lactobacillus_phage	2.5e-16	38.4
WP_002381949.1\|920121_920514_+	hypothetical protein	NA	NA	NA	NA
WP_002381948.1\|920526_921039_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	8.8e-35	49.4
WP_002357848.1\|921071_921431_+	hypothetical protein	A0A2P1JTV4	Anoxybacillus_phage	2.8e-11	36.0
WP_002357847.1\|921448_921817_+	hypothetical protein	NA	NA	NA	NA
WP_002404234.1\|921806_924740_+	membrane protein	W8EBC4	Geobacillus_phage	6.9e-15	41.2
WP_002365553.1\|924741_925668_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	9.0e-147	78.6
WP_002357844.1\|925680_927138_+	structural protein	C9E2K6	Enterococcus_phage	9.5e-175	47.7

DBSCAN-SWA_5

1369215 : 1377859

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002364081.1\|1369215_1369788_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.2e-25	35.1
WP_033624655.1\|1369784_1370816_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	8.2e-56	44.4
WP_002384438.1\|1370817_1372257_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.7e-49	32.3
WP_002414592.1\|1372232_1374452_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-146	40.1
WP_002364085.1\|1374448_1375123_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002357271.1\|1375123_1375375_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002357270.1\|1375388_1376102_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3ELR0	Synechococcus_phage	4.3e-48	43.0
WP_002384435.1\|1376253_1377378_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_002384434.1\|1377370_1377859_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.8e-19	42.0

DBSCAN-SWA_6

1408328 : 1426420

Staphylococcus_phage(20.0%)

transposase,protease,integrase

attL 1424618:1424642|attR 1429684:1429708

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002371018.1\|1408328_1409183_-\|protease	trypsin-like serine protease	A0A2H4PQP1	Staphylococcus_phage	2.8e-09	27.3
WP_077497612.1\|1409231_1410764_-	M4 family metallopeptidase coccolysin	NA	NA	NA	NA
WP_087942341.1\|1410998_1412069_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002371016.1\|1411998_1412526_-	HD domain-containing protein	NA	NA	NA	NA
WP_002360101.1\|1412743_1413649_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_002360100.1\|1413822_1414239_-	hypothetical protein	NA	NA	NA	NA
WP_033072592.1\|1415153_1415255_+	hypothetical protein	NA	NA	NA	NA
WP_002297659.1\|1415396_1416575_-\|integrase	site-specific integrase	S6C485	Thermus_phage	3.4e-29	30.5
WP_002297662.1\|1416677_1416989_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002360096.1\|1417337_1417583_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297668.1\|1417576_1417978_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002297670.1\|1418545_1420381_-	beta-galactosidase	NA	NA	NA	NA
WP_002330923.1\|1420552_1421815_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002360092.1\|1421952_1422177_+	hypothetical protein	NA	NA	NA	NA
WP_002298159.1\|1422173_1422338_+	hypothetical protein	NA	NA	NA	NA
WP_002298157.1\|1422431_1423724_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-31	40.4
WP_002313174.1\|1423997_1424258_-	hypothetical protein	NA	NA	NA	NA
1424618:1424642	attL	NA	NA	NA	NA
WP_101495273.1\|1424862_1426024_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.3
WP_077497620.1\|1426096_1426303_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	2.0e-06	53.3
WP_002383094.1\|1426306_1426420_+\|transposase	IS3 family transposase	NA	NA	NA	NA
1429684:1429708	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1440203 : 1453912

Streptococcus_phage(90.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002371002.1\|1440203_1441394_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	5.6e-24	28.4
WP_002298831.1\|1441498_1442410_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.3e-57	41.1
WP_002298830.1\|1442428_1443433_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	1.4e-121	66.3
WP_002384404.1\|1443429_1445553_-\|transposase	transposase	A0A1S5SF30	Streptococcus_phage	2.4e-174	58.7
WP_002330910.1\|1445557_1448005_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_002298826.1\|1447991_1448381_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	2.5e-42	66.7
WP_002330909.1\|1448444_1449173_+	hypothetical protein	NA	NA	NA	NA
WP_011109507.1\|1449179_1450007_-	abortive infection family protein	NA	NA	NA	NA
WP_002298823.1\|1450080_1450584_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	3.1e-56	61.2
WP_002298822.1\|1450596_1450818_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002414793.1\|1451214_1452465_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.0e-113	62.1
WP_002330905.1\|1452596_1452731_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002360076.1\|1452727_1453912_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.0e-142	62.1

DBSCAN-SWA_8

1548258 : 1565784

Streptococcus_phage(94.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001291561.1\|1548258_1549476_-\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|1549557_1549761_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001845478.1\|1549744_1549996_+	hypothetical protein	NA	NA	NA	NA
WP_000857133.1\|1550221_1550452_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|1550448_1550871_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_013670292.1\|1551099_1551171_-	hypothetical protein	NA	NA	NA	NA
WP_001227347.1\|1551375_1551729_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_011058338.1\|1551788_1551974_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_002414694.1\|1552074_1553994_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A2K5B2A5	Erysipelothrix_phage	0.0e+00	99.7
WP_012386611.1\|1554009_1554096_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224320.1\|1554370_1555306_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_000769868.1\|1555302_1556304_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|1556300_1558478_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|1558480_1560928_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|1560911_1561418_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|1561392_1561890_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|1562006_1562228_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|1562270_1563476_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|1563498_1563651_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|1563653_1565039_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|1565067_1565454_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|1565469_1565784_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_KI913070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

183 : 38495

Streptococcus_phage(60.0%)

terminase,portal,transposase,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001291561.1\|183_1401_-\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|1482_1686_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001845478.1\|1669_1921_+	hypothetical protein	NA	NA	NA	NA
WP_000857133.1\|2146_2377_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|2373_2796_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_013670292.1\|3024_3096_-	hypothetical protein	NA	NA	NA	NA
WP_001227347.1\|3300_3654_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_011058338.1\|3713_3899_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_002414694.1\|3999_5919_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A2K5B2A5	Erysipelothrix_phage	0.0e+00	99.7
WP_012386611.1\|5934_6021_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224320.1\|6295_7231_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_000769868.1\|7227_8229_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|8225_10403_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|10405_12853_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|12836_13343_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|13317_13815_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|13931_14153_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|14195_15401_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|15423_15576_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|15578_16964_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|16992_17379_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|17394_17709_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_001825268.1\|17731_17851_-	hypothetical protein	NA	NA	NA	NA
WP_002381741.1\|18138_18384_-	hypothetical protein	NA	NA	NA	NA
WP_002357053.1\|18482_18683_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-24	80.3
WP_010784601.1\|19535_20795_-	LysM peptidoglycan-binding domain-containing protein	C9E2L1	Enterococcus_phage	2.5e-208	89.2
WP_002378446.1\|20807_21188_-\|holin	holin	A0A097QQ04	Enterococcus_phage	1.1e-61	100.0
WP_002368228.1\|21198_21321_-	XkdX family protein	NA	NA	NA	NA
WP_002363385.1\|21322_21718_-	hypothetical protein	NA	NA	NA	NA
WP_002363384.1\|21736_22189_-	hypothetical protein	C0LZY6	Enterococcus_phage	3.3e-17	40.3
WP_002363383.1\|22205_22946_-	hypothetical protein	A0A1X9IGH6	Lactococcus_phage	1.2e-27	34.6
WP_033624668.1\|22951_24397_-	peptidase M23	A0A1S5SA59	Streptococcus_phage	8.2e-70	36.5
WP_002363380.1\|24396_25119_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	6.0e-37	37.6
WP_033624669.1\|25115_29570_-\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	4.9e-89	48.7
WP_002364305.1\|29556_29862_-	hypothetical protein	NA	NA	NA	NA
WP_002409775.1\|29930_30329_-	hypothetical protein	NA	NA	NA	NA
WP_010784604.1\|30391_30700_-	hypothetical protein	C9E2K1	Enterococcus_phage	2.2e-09	53.3
WP_025194241.1\|30702_31308_-\|tail	phage major tail protein, TP901-1 family	A0A1X9IGH1	Lactococcus_phage	1.3e-21	35.6
WP_023042479.1\|31326_31719_-	hypothetical protein	NA	NA	NA	NA
WP_010816898.1\|31715_32054_-	hypothetical protein	A0A1X9IGH0	Lactococcus_phage	1.9e-14	40.0
WP_002378454.1\|32050_32326_-	hypothetical protein	NA	NA	NA	NA
WP_002363369.1\|32322_32655_-	hypothetical protein	A0A097BY74	Leuconostoc_phage	3.1e-09	38.9
WP_002363368.1\|32725_33622_-	hypothetical protein	U3PDP8	Lactobacillus_phage	3.3e-69	49.8
WP_002378456.1\|33635_34289_-	hypothetical protein	NA	NA	NA	NA
WP_033593778.1\|34393_35320_-	hypothetical protein	A0A097QPZ9	Enterococcus_phage	1.8e-131	98.4
WP_010784607.1\|35312_36797_-\|portal	phage portal protein	A0A097QPZ5	Enterococcus_phage	3.8e-139	99.6
WP_002369892.1\|36796_38080_-\|terminase	PBSX family phage terminase large subunit	Q9AZ91	Lactobacillus_prophage	6.0e-157	65.5
WP_002364295.1\|38060_38495_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-44	64.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_KI913082

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_KI913082.1|WP_033624761.1|35085_35700_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_KI913082.1|WP_002401839.1|35713_36043_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_KI913082.1|WP_033624761.1|35085_35700_+|hypothetical-protein

35085_35700_+

204 aa aa

AcrIIA16

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3632\|WP_025188019.1\|AcrIIA16\|II-A\|Verified\|Enterococcus-faecalis	0.9852941176470589	1	1.0

HTH_49

Identity	Hit_domain_coverage
NA	NA

NZ_KI913082.1|WP_002401839.1|35713_36043_+|hypothetical-protein

35713_36043_+

109 aa aa

AcrIIA17

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3633\|WP_002401839.1\|AcrIIA17\|II-A\|Verified\|Enterococcus-faecalis	1.0	1	1.0

HTH_49

Identity	Hit_domain_coverage
NA	NA