CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number	Anti-CRISPR protein number
NZ_JTRJ01000134	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_136, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000024	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_24, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000106	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_107, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000158	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_162, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000017	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_17, whole genome shotgun sequence	0 crisprs	cas3	0	0
NZ_JTRJ01000042	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_42, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000086	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_86, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000111	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_112, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000148	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_151, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000046	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_46, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000140	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_143, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000149	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_152, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000161	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_165, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000068	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_68, whole genome shotgun sequence	0 crisprs	DinG,DEDDh	0	0
NZ_JTRJ01000018	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_18, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000114	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_115, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000117	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_118, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000098	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_99, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000157	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_160, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000007	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_7, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000137	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_140, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000039	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_39, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000083	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_83, whole genome shotgun sequence	0 crisprs	csa3	0	0
NZ_JTRJ01000027	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_27, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000013	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_13, whole genome shotgun sequence	0 crisprs	DinG	0	0
NZ_JTRJ01000109	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_110, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000056	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_56, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000092	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_92, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000073	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_73, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000045	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_45, whole genome shotgun sequence	0 crisprs	cas3	0	0
NZ_JTRJ01000151	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_154, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000135	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_137, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000060	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_60, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000035	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_35, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000049	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_49, whole genome shotgun sequence	1 crisprs	NA	0	0
NZ_JTRJ01000118	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_119, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000121	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_122, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000131	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_132, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000020	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_20, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000108	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_109, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000123	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_124, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000093	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_93, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000136	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_139, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000105	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_106, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000044	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_44, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000067	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_67, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000064	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_64, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000023	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_23, whole genome shotgun sequence	0 crisprs	DEDDh	0	0
NZ_JTRJ01000063	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_63, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000164	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_168, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000094	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_94, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000167	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_171, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000122	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_123, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000071	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_71, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000077	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_77, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000130	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_131, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000038	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_38, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000104	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_105, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000124	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_125, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000057	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_57, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000091	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_91, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000061	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_61, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000146	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_149, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000153	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_156, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000132	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_133, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000047	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_47, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000010	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_10, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000041	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_41, whole genome shotgun sequence	0 crisprs	csa3	1	0
NZ_JTRJ01000152	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_155, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000052	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_52, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000030	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_30, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000089	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_89, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000037	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_37, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000085	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_85, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000107	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_108, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000128	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_129, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000084	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_84, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000008	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_8, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000009	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_9, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000170	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_175, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000147	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_150, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000110	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_111, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000029	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_29, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000005	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_5, whole genome shotgun sequence	0 crisprs	PD-DExK,DEDDh	0	0
NZ_JTRJ01000058	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_58, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000070	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_70, whole genome shotgun sequence	0 crisprs	RT,PD-DExK,csa3	0	0
NZ_JTRJ01000138	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_141, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000129	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_130, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000074	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_74, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000163	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_167, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000125	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_126, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000062	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_62, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000112	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_113, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000143	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_146, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000141	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_144, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000090	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_90, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000133	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_135, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000015	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_15, whole genome shotgun sequence	0 crisprs	DEDDh	0	0
NZ_JTRJ01000116	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_117, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000101	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_102, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000059	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_59, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000081	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_81, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000127	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_128, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000113	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_114, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000119	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_120, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000160	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_164, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000088	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_88, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000150	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_153, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000076	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_76, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000171	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_176, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000034	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_34, whole genome shotgun sequence	0 crisprs	DEDDh	0	0
NZ_JTRJ01000033	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_33, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000026	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_26, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000097	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_98, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000040	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_40, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000003	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_3, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000072	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_72, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000006	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_6, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000048	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_48, whole genome shotgun sequence	0 crisprs	csa3	0	0
NZ_JTRJ01000066	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_66, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000099	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_100, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000102	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_103, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000032	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_32, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000155	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_158, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000011	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_11, whole genome shotgun sequence	0 crisprs	NA	3	1
NZ_JTRJ01000014	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_14, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000025	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_25, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000087	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_87, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000115	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_116, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000043	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_43, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000036	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_36, whole genome shotgun sequence	0 crisprs	csa3	0	0
NZ_JTRJ01000069	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_69, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000139	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_142, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000095	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_96, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000172	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_177, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000079	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_79, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000016	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_16, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000156	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_159, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000173	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_178, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000019	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_19, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000154	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_157, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000144	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_147, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000028	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_28, whole genome shotgun sequence	0 crisprs	RT,csa3	0	0
NZ_JTRJ01000177	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_192, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000103	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_104, whole genome shotgun sequence	0 crisprs	NA	1	0
NZ_JTRJ01000126	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_127, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000142	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_145, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000174	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_180, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000021	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_21, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000075	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_75, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000162	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_166, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000165	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_169, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000031	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_31, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000012	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_12, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000176	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_185, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000004	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_4, whole genome shotgun sequence	1 crisprs	NA	0	0
NZ_JTRJ01000096	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_97, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000002	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_2, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000159	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_163, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000054	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_54, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000078	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_78, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000080	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_80, whole genome shotgun sequence	0 crisprs	DEDDh	0	0
NZ_JTRJ01000022	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_22, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000082	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_82, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000175	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_181, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000100	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_101, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000051	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_51, whole genome shotgun sequence	0 crisprs	WYL	0	0
NZ_JTRJ01000120	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_121, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000050	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_50, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000053	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_53, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000168	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_172, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000065	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_65, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000169	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_173, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000145	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_148, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000001	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_1, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000055	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_55, whole genome shotgun sequence	0 crisprs	NA	0	0
NZ_JTRJ01000166	Pseudomonas aeruginosa strain AZPAE14932 AZPAE14932_contig_170, whole genome shotgun sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

308 : 5340

Pseudomonas_phage(75.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023981191.1\|308_695_+	helix-turn-helix transcriptional regulator	A0A1B0YZX7	Pseudomonas_phage	8.9e-64	97.6
WP_023981192.1\|705_954_+	hypothetical protein	A0A0U3TGX2	Pseudomonas_phage	4.2e-35	93.9
WP_023981193.1\|1167_1842_+	hypothetical protein	A0A173GCD0	Salmonella_phage	2.4e-08	28.8
WP_012613688.1\|1841_2144_+	hypothetical protein	A0A0U4ISH7	Pseudomonas_phage	2.8e-41	98.0
WP_023981194.1\|2207_3647_+	DNA cytosine methyltransferase	A0A2I7QRH3	Vibrio_phage	1.2e-100	46.0
WP_023981195.1\|3643_4180_+	DUF4406 domain-containing protein	A0A0U4IBL4	Pseudomonas_phage	1.2e-95	93.2
WP_023981196.1\|4185_4542_-	hypothetical protein	NA	NA	NA	NA
WP_023981197.1\|4658_5009_+	hypothetical protein	H2BD40	Pseudomonas_phage	1.1e-57	89.7
WP_023981198.1\|5091_5340_+	hypothetical protein	H2BD39	Pseudomonas_phage	3.7e-39	95.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_JTRJ01000011

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

107 : 9660

Pseudomonas_phage(50.0%)

integrase

attL 1877:1891|attR 14551:14565

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078452301.1\|107_1379_+	hypothetical protein	A0A125RNQ8	Pseudomonas_phage	1.6e-48	51.3
WP_023981200.1\|1378_1552_+	hypothetical protein	NA	NA	NA	NA
WP_023981201.1\|1544_2036_+	hypothetical protein	A0A1B0YZW8	Pseudomonas_phage	2.4e-21	50.7
1877:1891	attL	NA	NA	NA	NA
WP_023981202.1\|2032_2446_+	hypothetical protein	A0A218M341	Acidovorax_phage	3.4e-05	62.9
WP_031691834.1\|2490_2814_+	hypothetical protein	A0A0U4JVQ0	Pseudomonas_phage	1.1e-48	89.7
WP_023981203.1\|3208_4375_+\|integrase	site-specific integrase	A0A1B0Z061	Pseudomonas_phage	3.1e-221	98.7
WP_003092090.1\|4556_5474_+	ornithine carbamoyltransferase	M1HGA5	Paramecium_bursaria_Chlorella_virus	2.0e-21	27.6
WP_003092092.1\|5478_6561_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	8.4e-19	35.9
WP_003092094.1\|6667_7447_+	peroxide stress protein YaaA	NA	NA	NA	NA
WP_003110461.1\|8349_9660_+	GDP-mannose 6-dehydrogenase	A0A127AXI2	Bacillus_phage	8.3e-45	32.9
14551:14565	attR	NA	NA	NA	NA

DBSCAN-SWA_2

97091 : 106120

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092260.1\|97091_98132_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5
WP_003092262.1\|98265_98772_-	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
WP_023092575.1\|98919_99927_+	TolB family protein	NA	NA	NA	NA
WP_003122151.1\|100052_102620_+	DNA mismatch repair protein MutS	E5RUN9	Heterocapsa_circularisquama_DNA_virus	1.4e-19	21.4
WP_003092272.1\|102686_103010_+	ferredoxin family protein	NA	NA	NA	NA
WP_003113871.1\|103436_104441_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.0e-34	34.8
WP_023092574.1\|104545_105439_-	peptidoglycan DD-metalloendopeptidase family protein	A0A076G6R1	Bacillus_phage	1.0e-06	34.3
WP_003098558.1\|105484_106120_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3

DBSCAN-SWA_3

118186 : 175193

Pseudomonas_phage(86.84%)

terminase,tRNA,holin,protease,portal,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023092573.1\|118186_119515_-\|tRNA	tRNA lysidine(34) synthetase TilS	M1IB95	Acanthocystis_turfacea_Chlorella_virus	5.9e-06	24.1
WP_003109333.1\|119584_120535_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_003098578.1\|120684_124206_-	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	1.7e-198	37.7
WP_003092370.1\|124335_125751_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_003092371.1\|125967_126573_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.4e-31	43.2
WP_003092372.1\|126572_127709_-	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_003092373.1\|127712_128489_-	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_003092375.1\|128485_128926_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_003098585.1\|128971_130033_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003098586.1\|130032_130539_-	OmpH family outer membrane protein	NA	NA	NA	NA
WP_003098590.1\|130589_132974_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_009313536.1\|133044_134397_-\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
WP_003109337.1\|134422_135613_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_003092388.1\|135609_136425_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003113863.1\|136418_137174_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.2e-19	38.8
WP_003092390.1\|137189_137747_-	ribosome recycling factor	NA	NA	NA	NA
WP_003092391.1\|137749_138487_-	UMP kinase	NA	NA	NA	NA
WP_003092393.1\|138685_139555_-	elongation factor Ts	NA	NA	NA	NA
WP_003092394.1\|139685_140426_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003092395.1\|140690_141476_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003113862.1\|141642_144345_+	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_003092403.1\|144362_145571_+	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_023980103.1\|145672_147418_-	Na+/H+ antiporter	NA	NA	NA	NA
WP_003092416.1\|147655_148015_+	hypothetical protein	NA	NA	NA	NA
WP_003109342.1\|148336_148630_+	hypothetical protein	NA	NA	NA	NA
WP_003092421.1\|148644_148998_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_023109386.1\|149477_149750_-	hypothetical protein	A0A0U4JEI3	Pseudomonas_phage	4.5e-46	97.8
WP_034059262.1\|149817_150492_+	SOS response-associated peptidase	A0A2K8I970	Pseudomonas_phage	1.2e-119	90.1
WP_033949757.1\|150602_150857_+	hypothetical protein	L7P7Y7	Pseudomonas_phage	4.5e-40	95.2
WP_153575361.1\|151059_151233_+	hypothetical protein	NA	NA	NA	NA
WP_023110601.1\|151489_151804_-	hypothetical protein	A0A0U4K5I1	Pseudomonas_phage	5.0e-49	89.3
WP_021204795.1\|152383_152665_-	hypothetical protein	A0A0A0YR51	Pseudomonas_phage	3.9e-45	97.8
WP_034059265.1\|152664_153225_-	hypothetical protein	A0A1B0YZW5	Pseudomonas_phage	5.0e-100	99.5
WP_034059266.1\|153229_153421_-	hypothetical protein	A0A1B0Z2L3	Pseudomonas_phage	1.6e-29	98.4
WP_034059268.1\|153413_154001_-	hypothetical protein	A0A0U4B0K9	Pseudomonas_phage	1.9e-102	94.4
WP_034059269.1\|154030_155689_-	hypothetical protein	A0A0U4IJ51	Pseudomonas_phage	0.0e+00	98.4
WP_021205047.1\|155685_156090_-	hypothetical protein	A0A0U4B0P9	Pseudomonas_phage	1.2e-66	99.3
WP_034059272.1\|156100_156646_-	hypothetical protein	A0A1B0YZV4	Pseudomonas_phage	3.7e-100	99.4
WP_034059274.1\|156645_157056_-	hypothetical protein	A0A1B0YZV0	Pseudomonas_phage	3.2e-64	93.4
WP_034059276.1\|157058_158756_-	hypothetical protein	A0A1W6JTA3	Pseudomonas_phage	0.0e+00	96.6
WP_016852557.1\|158755_159277_-	hypothetical protein	A0A1W6JT98	Pseudomonas_phage	3.7e-97	98.3
WP_034059278.1\|159316_161800_-	tape measure protein	A0A1B0YZV6	Pseudomonas_phage	0.0e+00	96.1
WP_033985253.1\|161902_162205_-	hypothetical protein	A0A0A0YWD4	Pseudomonas_phage	1.8e-48	100.0
WP_071534543.1\|162266_162908_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	A0A1W6JT76	Pseudomonas_phage	9.7e-116	99.5
WP_034059280.1\|162989_163742_-	hypothetical protein	A0A1B0YZT8	Pseudomonas_phage	5.3e-137	99.2
WP_015980908.1\|163743_163938_-	hypothetical protein	A0A1W6JT79	Pseudomonas_phage	1.5e-27	98.4
WP_015980907.1\|163941_164412_-	hypothetical protein	A0A1W6JT75	Pseudomonas_phage	3.1e-87	99.4
WP_034059282.1\|164408_164738_-	hypothetical protein	A0A1B0YZU3	Pseudomonas_phage	5.2e-57	99.1
WP_034059284.1\|164734_165052_-	DUF2190 family protein	A0A1W6JT93	Pseudomonas_phage	6.8e-46	92.4
WP_034059287.1\|165118_167209_-\|protease	Clp protease ClpP	A0A1W6JT88	Pseudomonas_phage	1.6e-271	73.0
WP_034059290.1\|167183_168830_-\|portal	phage portal protein	A0A0A0YUB7	Pseudomonas_phage	1.4e-214	68.3
WP_034059292.1\|168826_169045_-	hypothetical protein	S5MBY8	Escherichia_phage	7.1e-10	48.6
WP_034059294.1\|169041_171018_-\|terminase	phage terminase large subunit family protein	A0A1B0Z2K0	Pseudomonas_phage	0.0e+00	86.2
WP_023083814.1\|170989_171535_-\|terminase	terminase small subunit	A0A1B0Z033	Pseudomonas_phage	3.4e-85	86.7
WP_034059297.1\|171654_172398_-	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	1.6e-133	98.8
WP_034010592.1\|172394_172865_-\|lysis	lysis protein	A0A1B0Z001	Pseudomonas_phage	2.6e-73	93.6
WP_034059300.1\|172861_173104_-	hypothetical protein	A0A0H5AWC3	Pseudomonas_phage	8.4e-20	53.2
WP_034059303.1\|173100_173718_-	glycoside hydrolase family 19 protein	A0A1W6JTC9	Pseudomonas_phage	2.2e-104	90.7
WP_003129668.1\|173714_174047_-\|holin	phage holin, lambda family	A0A1B0YZZ1	Pseudomonas_phage	5.1e-44	100.0
WP_034059306.1\|174184_174859_-	hypothetical protein	A0A1B0YZZ3	Pseudomonas_phage	6.9e-120	99.6
WP_021205615.1\|174896_175193_-	hypothetical protein	A0A1B0YZZ2	Pseudomonas_phage	4.3e-42	86.7

Anti-CRISPR protein detection

Acr_ID: NZ_JTRJ01000011.1|WP_153575361.1|151059_151233_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_JTRJ01000011.1|WP_153575361.1|151059_151233_+|hypothetical-protein

151059_151233_+

57 aa aa

AcrIC4

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3670\|WP_153575361.1\|AcrIC4\|I-C\|Verified\|Pseudomonas-aeruginosa	1.0	1	1.0

118186-175193

3. NZ_JTRJ01000033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12031 : 47054

Pseudomonas_phage(50.0%)

plate,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023092357.1\|12031_13510_+	anthranilate synthase component I	S4VNU7	Pandoravirus	1.5e-39	30.5
WP_023092358.1\|13827_14142_-	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_023092359.1\|14241_15012_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.0e-71	59.1
WP_023092361.1\|15469_15670_+	TraR/DksA C4-type zinc finger protein	Q9ZXI6	Pseudomonas_virus	3.9e-07	48.4
WP_023092362.1\|15717_16077_+	hypothetical protein	NA	NA	NA	NA
WP_073647038.1\|16439_16889_+\|holin	holin	B5TK61	Pseudomonas_phage	6.5e-26	53.3
WP_021263056.1\|16910_17426_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	6.3e-33	43.4
WP_003121844.1\|17422_17980_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	6.0e-45	70.3
WP_003085143.1\|18132_18459_+	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
WP_023092363.1\|18455_19343_+\|plate	baseplate J/gp47 family protein	S4TNY7	Salmonella_phage	1.6e-87	59.5
WP_023092364.1\|19335_19869_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	1.1e-61	64.0
WP_023092365.1\|19870_21988_+\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	1.9e-224	52.7
WP_016852415.1\|21995_22436_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	1.4e-33	51.7
WP_023092366.1\|22478_23639_+\|tail	phage tail sheath family protein	Q38068	Phage_PS17	4.5e-188	83.2
WP_023092367.1\|23651_24155_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.4e-64	73.5
WP_003085178.1\|24169_24514_+\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	3.8e-18	46.7
WP_023092368.1\|24683_26921_+\|tail	phage tail length determinator protein	NA	NA	NA	NA
WP_023092369.1\|26930_27803_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
WP_003101635.1\|27777_27984_+\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_023092370.1\|28041_29031_+	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.7e-106	55.8
WP_003117966.1\|29063_29693_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	4.2e-87	78.5
WP_023092371.1\|29689_30052_+	hypothetical protein	J7HXL1	Pseudomonas_phage	3.8e-08	37.8
WP_003137395.1\|30048_30306_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	6.4e-18	64.6
WP_003113190.1\|30621_31116_+	hypothetical protein	Q9MCA5	Pseudomonas_phage	4.8e-54	62.4
WP_004352265.1\|31127_31475_+\|tail	phage tail assembly chaperone family protein, TAC	NA	NA	NA	NA
WP_003113188.1\|31504_31759_+	hypothetical protein	Q9MCA3	Pseudomonas_phage	1.7e-10	45.1
WP_023092372.1\|31805_33644_+\|tail	phage tail tape measure protein	A0A1B0VMG8	Pseudomonas_phage	1.3e-32	37.8
WP_003113186.1\|33636_33978_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	1.1e-09	36.4
WP_003118922.1\|33985_34681_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	1.5e-69	50.2
WP_003129219.1\|34683_35454_+	C40 family peptidase	A0A2D1GNP8	Pseudomonas_phage	5.5e-81	55.6
WP_003117974.1\|35508_36111_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	6.5e-53	57.3
WP_023092373.1\|36169_39784_+\|tail	phage tail protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	54.7
WP_031627675.1\|40019_40808_+	hypothetical protein	A0A059VF40	Pseudomonas_phage	2.2e-08	29.6
WP_009315198.1\|40831_41923_+	hypothetical protein	A0A0S2SY45	Pseudomonas_phage	2.1e-46	36.6
WP_023085656.1\|41922_42258_+	hypothetical protein	A0A0E3T8S9	Pseudomonas_phage	6.2e-21	50.5
WP_003118928.1\|42238_42469_+	hypothetical protein	A0A1W6JT87	Pseudomonas_phage	6.7e-19	65.3
WP_009315200.1\|42564_43617_+	hypothetical protein	A0A0H5AXZ9	Pseudomonas_phage	2.7e-62	52.5
WP_003113177.1\|43616_43919_+	hypothetical protein	A0A0H5B141	Pseudomonas_phage	4.4e-34	71.0
WP_003113176.1\|43915_44146_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	8.2e-25	71.6
WP_023092374.1\|44564_45170_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.6e-75	65.8
WP_003085203.1\|45171_46221_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003085205.1\|46217_47054_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_JTRJ01000004

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_JTRJ01000004_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_JTRJ01000004_1

87351-87448

Orphan

Consensus_repeat	Method
GAACGACGAAGCCTCGACAGGATGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_JTRJ01000004_1

>merge|NZ_JTRJ01000004|1|87351-87448|CRISPRCasFinder
GAACGACGAAGCCTCGACAGGATGTCAGCTCGGCCTTACCCAAGACGCCGAACCGCATGCGTTTTTCAATGCGAACGACGAGGCCTCGACAGGATGTC

>NZ_JTRJ01000004|1|1|87351-87448|CRISPRCasFinder
GAACGACGAAGCCTCGACAGGATGTC	AGCTCGGCCTTACCCAAGACGCCGAACCGCATGCGTTTTTCAATGC
GAACGACGAGGCCTCGACAGGATGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_JTRJ01000004.1\|WP_023092802.1\|95359_97375_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_JTRJ01000004.1\|WP_073668207.1\|80345_81134_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274513
NZ_JTRJ01000004.1\|WP_003110563.1\|91890_92538_-\|YihA-family-ribosome-biogenesis-GTP-binding-protein	unknown	unknown	gnl\|CDD\|234770
NZ_JTRJ01000004.1\|WP_003096987.1\|86592_87282_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223287
NZ_JTRJ01000004.1\|WP_003096975.1\|94484_95363_+\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|226098
NZ_JTRJ01000004.1\|WP_003102836.1\|97492_98086_+\|MarC-family-protein	unknown	unknown	gnl\|CDD\|170674
NZ_JTRJ01000004.1\|WP_003096992.1\|82765_83269_-\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|223806
NZ_JTRJ01000004.1\|WP_003097004.1\|78454_79132_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_JTRJ01000004.1\|WP_003136457.1\|84371_86576_+\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	unknown	unknown	gnl\|CDD\|274168
NZ_JTRJ01000004.1\|WP_003096990.1\|83338_84262_+\|zinc-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226908
NZ_JTRJ01000004.1\|WP_003097002.1\|79131_80139_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236863
NZ_JTRJ01000004.1\|WP_003096976.1\|93833_94469_+\|thiol:disulfide-interchange-protein-DsbA	unknown	unknown	gnl\|CDD\|239317
NZ_JTRJ01000004.1\|WP_003096979.1\|92721_93015_+\|cytochrome-c5-family-protein	unknown	unknown	gnl\|CDD\|225784
NZ_JTRJ01000004.1\|WP_003110565.1\|87533_88484_-\|homoserine-kinase	unknown	unknown	gnl\|CDD\|235369
NZ_JTRJ01000004.1\|WP_019485144.1\|88885_91627_+\|DNA-polymerase-I	unknown	unknown	gnl\|CDD\|235591
NZ_JTRJ01000004.1\|WP_003099732.1\|81956_82766_-\|zinc-ABC-transporter-ATP-binding-protein-ZnuC	unknown	unknown	gnl\|CDD\|181939
NZ_JTRJ01000004.1\|WP_003096984.1\|88517_88808_-\|DUF2782-domain-containing-protein	unknown	unknown	gnl\|CDD\|378588
NZ_JTRJ01000004.1\|WP_003102831.1\|93060_93666_+\|cytochrome-c4	unknown	unknown	gnl\|CDD\|225418
NZ_JTRJ01000004.1\|WP_023092804.1\|77595_78378_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270315
NZ_JTRJ01000004.1\|WP_003096998.1\|81175_81964_-\|zinc-ABC-transporter-permease-subunit-ZnuB	unknown	unknown	gnl\|CDD\|181938

Protein	Function_ID	Function_description	E-value
NZ_JTRJ01000004.1\|WP_023092802.1\|95359_97375_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	6.6769e-62
NZ_JTRJ01000004.1\|WP_073668207.1\|80345_81134_-\|hypothetical-protein	gnl\|CDD\|274513	TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). [Protein fate, Protein and peptide secretion and trafficking].	0.000523404
NZ_JTRJ01000004.1\|WP_003110563.1\|91890_92538_-\|YihA-family-ribosome-biogenesis-GTP-binding-protein	gnl\|CDD\|234770	PRK00454, engB, GTP-binding protein YsxC; Reviewed.	6.809e-107
NZ_JTRJ01000004.1\|WP_003096987.1\|86592_87282_+\|hypothetical-protein	gnl\|CDD\|223287	COG0209, NrdA, Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism].	5.19108e-14
NZ_JTRJ01000004.1\|WP_003096975.1\|94484_95363_+\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|226098	COG3568, ElsH, Metal-dependent hydrolase [General function prediction only].	1.23885e-61
NZ_JTRJ01000004.1\|WP_003102836.1\|97492_98086_+\|MarC-family-protein	gnl\|CDD\|170674	PRK10739, PRK10739, YhgN family NAAT transporter.	4.81982e-48
NZ_JTRJ01000004.1\|WP_003096992.1\|82765_83269_-\|transcriptional-repressor	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	1.3923e-42
NZ_JTRJ01000004.1\|WP_003097004.1\|78454_79132_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	1.33335e-106
NZ_JTRJ01000004.1\|WP_003136457.1\|84371_86576_+\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	gnl\|CDD\|274168	TIGR02504, ribonucleotide_reductase, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent. This model represents a group of adenosylcobalamin(B12)-dependent ribonucleotide reductases (Class II RNRs) related to the characterized species from Pyrococcus, Thermoplasma, Corynebacterium, and Deinococcus. RNR's are responsible for the conversion of the ribose sugar of RNA into the deoxyribose sugar of DNA. This is the rate-limiting step of DNA biosynthesis. This model identifies genes in a wide range of deeply branching bacteria. All are structurally related to the class I (non-heme iron dependent) RNRs. In most species this gene is known as NrdJ, while in mycobacteria it is called NrdZ. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_JTRJ01000004.1\|WP_003096990.1\|83338_84262_+\|zinc-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226908	COG4531, ZnuA, ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism].	6.04072e-157
NZ_JTRJ01000004.1\|WP_003097002.1\|79131_80139_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	0
NZ_JTRJ01000004.1\|WP_003096976.1\|93833_94469_+\|thiol:disulfide-interchange-protein-DsbA	gnl\|CDD\|239317	cd03019, DsbA_DsbA, DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.	1.63388e-70
NZ_JTRJ01000004.1\|WP_003096979.1\|92721_93015_+\|cytochrome-c5-family-protein	gnl\|CDD\|225784	COG3245, CycB, Cytochrome c5 [Energy production and conversion].	1.51706e-36
NZ_JTRJ01000004.1\|WP_003110565.1\|87533_88484_-\|homoserine-kinase	gnl\|CDD\|235369	PRK05231, PRK05231, homoserine kinase; Provisional.	3.62502e-167
NZ_JTRJ01000004.1\|WP_019485144.1\|88885_91627_+\|DNA-polymerase-I	gnl\|CDD\|235591	PRK05755, PRK05755, DNA polymerase I; Provisional.	0
NZ_JTRJ01000004.1\|WP_003099732.1\|81956_82766_-\|zinc-ABC-transporter-ATP-binding-protein-ZnuC	gnl\|CDD\|181939	PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed.	8.54289e-114
NZ_JTRJ01000004.1\|WP_003096984.1\|88517_88808_-\|DUF2782-domain-containing-protein	gnl\|CDD\|378588	pfam11191, DUF2782, Protein of unknown function (DUF2782). This is a bacterial family of proteins whose function is unknown.	3.76643e-30
NZ_JTRJ01000004.1\|WP_003102831.1\|93060_93666_+\|cytochrome-c4	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	1.5355e-43
NZ_JTRJ01000004.1\|WP_023092804.1\|77595_78378_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270315	cd13597, PBP2_lipoprotein_Tp32, The substrate-binding domain of the 32-kilodalton lipoprotein (Tp32) from Treponema pallidum binds L-methionine; the type 2 periplasmic-binding protein fold. This group includes the lipoprotein Tp32, a periplasmic component of a methionine uptake transporter system, and its closely related homologs. The Tp32 has both structural and sequential homology to the MetQ family of substrate-binding protein, and thus it belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea.	8.54061e-133
NZ_JTRJ01000004.1\|WP_003096998.1\|81175_81964_-\|zinc-ABC-transporter-permease-subunit-ZnuB	gnl\|CDD\|181938	PRK09543, znuB, zinc ABC transporter permease subunit ZnuB.	7.07263e-93

>NZ_JTRJ01000004.1|WP_003096987.1|86592_87282_+|hypothetical-protein
MSAVKITQKIKGFKVVNEAEEQALAAAAEAASVVQMDETLERPDTLIGATYKIKSPLFEHALYVTINDMVLNAGTAHEQRRPFEIFINSKNMDHFQWIVALTRIMSAVFRKGGDCTFLVEELKAVFDPRGGYLKKGGIYMPSIVAEIGGVLERHLTAIGLLRGPELDEEQRLFLAEKRAAYEAAQGTSKVEPGEGFPAGAQLCGKCNSMAVVQMDGCATCLNCGHSKCG
>NZ_JTRJ01000004.1|WP_003136457.1|84371_86576_+|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase
MLRTVAGFGRPNNHREVNQRMAKTDARSPRTERGTIALQDASQDIWDKKYRLKSKDGTPVDASVDGTWQRVARALADVEDKASREHWYGRFLWALRNGAIPAGRIISNAGALGHKPATSTINCTVSGTIQDSMDHILEKVHEAGLTLKAGCGIGYEFSTLRPRGAYVSGAGAYTSGPLSFMDIYDKMCFTVSSAGGRRGAQMGTFDVSHPDVREFIRAKREDGRLRQFNLSLLITDQFMQAVEQDADWPLVFPVHVKERDEIDLDDPNAVVWREWPIQDDYVQRADGLVACKVYGQVRARHLWDMIMVSTYDYAEPGFILIDRVNELNNNWWCEAIRATNPCGEQPLPPYGSCLLGSVNLTCFVEQPFGDEARFDWDRFREVVRVFTRMLDNVVEINGLPLEQQRQEILGKRRHGMGFLGLGSTLTLLKLRYGSPEACVFTEEVAREMALVGWEVALELAREKGPAPILAQDYEVTAEMLRKRPEMAADGYKAGDRIRGSVLHAKYSRYMQRVAEHAPELIEALAETGARFTHHSSIAPTGTISLSLANNASNGIEPSFAHHYSRNLIREGRKTKEKVEVYSYELLAYRTLVNAQALPDSDDPARRLPDYFITADSVTPAQHVDIQAAAQKWVDSSISKTANVPTDYPFEDFKDIYRYAWHQGLKGCTTFRFNPEAFQGVLVKESDLEKTRYRFELEDGSVVEFKGNEQVEYDGEIHTAANLFDALKEGYYGKY
>NZ_JTRJ01000004.1|WP_003096990.1|83338_84262_+|zinc-ABC-transporter-substrate-binding-protein
MTLRPFALLSACFALFLLASPARAEVSVLTSIKPLQLVAAAIQDGVGQPDVLLPPGASPHQYALRPSDVRRLREVQLFYWIGPDLENFLPKVLAGRQGTSVAVQDLPGMHLRKFVNFEEEEHAGHDEHDHDHRPGMLDAHLWLLPANARTIAARMAEDLAQVDPANAGRYRANLKAFEERLGGLDGKLRERLGKLAGKPFFVFHEAFDYFEEAYGLRHTGVFAVSAEVQPGARHVAAMRAQLKAAGPACIFSEPPLRPRLADTLSEGLPVRLAELDDLGVNVSVDANGYENLLNNLAGEFAGCLEKL
>NZ_JTRJ01000004.1|WP_003096992.1|82765_83269_-|transcriptional-repressor
MYKIAPKTPLACQPHDHSQCVSTALAEADALCARQGVRLTELRRRVLELVWQSHKPLGAYDILAVLSETDGRRAAPPTVYRALDFLQENGLVHRIASLNAFVGCNNPEHSHQGQFLICRTCHTAIELEQPDISRAIVAGANSVGFAVESQTVEVVGLCGTCRDQKDA
>NZ_JTRJ01000004.1|WP_003099732.1|81956_82766_-|zinc-ABC-transporter-ATP-binding-protein-ZnuC
MDNALVRLTQVGVSFNGQAVLSDVDLAIEPGQIVTLIGPNGAGKTTLVRSVLGLLKPHVGEVWRRPRLTIGYMPQKLHVDATLPLSVLRFLRLVPGVRREQALAALREVGAAHVLERPLQSISGGELQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYRLIGKLRDRYGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGQDARSLAIYHHHHDHAHDLHGEVVKAGPGALPPGTRFTPVHKHGPDCNHG
>NZ_JTRJ01000004.1|WP_003096998.1|81175_81964_-|zinc-ABC-transporter-permease-subunit-ZnuB
MADFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAVTVGCVLLAVLLVTLQQRQPLAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLLAVSASDLLWIIAGSALVLALICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAGPSIVVSAAGLFLLSFVLPRRTV
>NZ_JTRJ01000004.1|WP_073668207.1|80345_81134_-|hypothetical-protein
MSSFFRLLSVLAAALLVSACQGNASSQPTPVVAPQAQPADPYAELQETLAAGKLEQAEQQWLALRSAAASDERVEAFRRQLAEAYMQRGETALRQGDLNTATSALGHARGLMPKAPALTAGLDGAINRAKVDPARAEQARRMQQAARQQMQQIIQTPPGGELKPLPGAPHLLDPQAASSAVPLPMLDGTGQGGLGAVLDAVAADVVAYRCRVHIEVRRDSDYPLVSDQLLARVKKLSPDFDLHLSHVVQADKPTRLILTPRN
>NZ_JTRJ01000004.1|WP_003097002.1|79131_80139_-|methionine-ABC-transporter-ATP-binding-protein
MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFVFEAERVDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGRIDRIKDTPYGQLTLALVGGDLEAAMSQLNAADVHVEVLR
>NZ_JTRJ01000004.1|WP_003097004.1|78454_79132_-|ABC-transporter-permease
MDFFETMSFANIDWYEIWLASVDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSLVVNILRSLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKGIIEATQAMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVMLLILVQILQTVGDKLVVHFSRK
>NZ_JTRJ01000004.1|WP_023092804.1|77595_78378_-|ABC-transporter-substrate-binding-protein
MKKLLAAFSAVAALGLTAAQAAETLTVAATPVPHAEILNVVKPLLAKEGVDLKVKEFTDYVQPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIIDNPKNIKIRELEAATLPRVLTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHSAEVKQFIQEKYKGAVVPAF
>NZ_JTRJ01000004.1|WP_003110565.1|87533_88484_-|homoserine-kinase
MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQDLPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEVGDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAERPALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNADGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQDVLIHDPAEFEMRLAQRQNVEIHLPFAL
>NZ_JTRJ01000004.1|WP_003096984.1|88517_88808_-|DUF2782-domain-containing-protein
MRTLNRLMLAGLLAFAPLVAMAADDDAPSGEPDVTIRQEGDKTIQEYRVNGFLYAIKVVPKHGKPYFLVRADGSDGNFIRSDQPDKLIPQWEIFSW
>NZ_JTRJ01000004.1|WP_019485144.1|88885_91627_+|DNA-polymerase-I
MSQAPLVLVDGSSYLYRAFHALPPLTTSTGKPTGAVKGVLNMLLSLRKQYPDSPFAVVFDAKGPTFRDELFAEYKANRPSMPDDLRVQVEPLHASVRALGLPLLCVEGVEADDVIGTLARSSAAAGRPVVISTGDKDMAQLVDGHITLVNTMTGSRLDVDGVKEKFGVGPELIIDFLALMGDKVDNIPGVPGVGEKTALGLLTGVGGGLEVLYASLDKVPELPIRGAKGLPAKLEENREQAFLSYQLATIKTDVELDVEIDKLYPGEPQREALIALYRELEFKNWLDDLLREAKEAGENGEAETPIQAEVDYDVVLDQAGFDAWLKKLEEAELIAFDTETTSIDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAVLRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAYDTMLESYVLDSTATRHDMDSLALKYLGHSTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVALERQAYDLAGQEFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAHLAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINFGLIYGMSAFGLAKQIGVERKEAQAYIDRYFARYPGVLAYMERTRAQAAEQGFVETLFGRRLYLPEIHSKNGAMRKAAERTAINAPMQGTAADIMKRAMVAVDNWLQESGLDARVILQVHDELVLEVREDLVEQVCEGIRPLMSGAATLDVPLVVEAGVGSNWDEAH
>NZ_JTRJ01000004.1|WP_003110563.1|91890_92538_-|YihA-family-ribosome-biogenesis-GTP-binding-protein
MSEKNPIVGLCQKASFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFALDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQGWGDVATLQLFSAPKRQGVDEAQMVLAQWLGLLDEDQEAFEEA
>NZ_JTRJ01000004.1|WP_003096979.1|92721_93015_+|cytochrome-c5-family-protein
MKKLLLAATVVAVAVTAQAAQDPEAVFNRTCGACHDGQLPMAPKKGDHAAWEPRLAKGMPTLVQHVTNGFNAMPPRGLCTDCSAEDYQATIQWMVKK
>NZ_JTRJ01000004.1|WP_003102831.1|93060_93666_+|cytochrome-c4
MNKLLVSLLLTLGLTGLAHAAGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDGKRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRGGKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRTNDGDTKIMQSIAAKLSNKDIAAISSYIQGLH
>NZ_JTRJ01000004.1|WP_003096976.1|93833_94469_+|thiol:disulfide-interchange-protein-DsbA
MRNLILTAMLAMASLFGMAAQADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
>NZ_JTRJ01000004.1|WP_003096975.1|94484_95363_+|endonuclease/exonuclease/phosphatase-family-protein
MLRRWQREPRVAGSCDPRVNPSCDDSRELPDDGRLRLLSFNIQVGISTERYRHYLTRGWQHLLPHAGRATNLKRIGELLADYDLVALQEADGGSLRSGYVNQVEHLAQLGAFPYWYQQLNRNLGRIAQHSNGLLSRWRPTLLEDHPLPGPPGRGAIFVRFGEGADALVVVMMHLALGARTRTRQLAYIRELIGDYRHQVLMGDMNTHAVDLLENSPLRDLGLMAPQVEATFPSWRPQRNLDHILLSSDLALERVDVLDQPISDHLPVSVEIRLPDNLRDKALVVRGDAGSPP
>NZ_JTRJ01000004.1|WP_023092802.1|95359_97375_+|diguanylate-cyclase
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELREILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALNLPRELRKPLKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESETAAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPARTVAAIESAPAGWVGVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEDAGAEPSPAMPADVESAPEAPATPVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERIDGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVLDNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVSGRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDGGDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPATSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEVVFERADQALYRAKRAGRDRLEVA
>NZ_JTRJ01000004.1|WP_003102836.1|97492_98086_+|MarC-family-protein
MDMFGVAVLIFLVTDPFGNIAVFLAALKGVAPGRRLRVAFRELAFALGLLLLFLTLGEHILSGLGLSREATGIAGGIILFVIAMRLIFPSPQGLLGEVPDGEPLLVPLATPAVAGPSALAMLITLRTTFDGPLWELYLAVVLAWAATALILLQAAFLQRFLGPRGLTAIERLAGMLLIMLSVDMLLDNLRSVLHIAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_JTRJ01000026

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

61892 : 99684

Pseudomonas_virus(85.0%)

lysis,head,integrase,plate,tail,terminase,holin,portal,capsid

attL 65284:65329|attR 101724:101769

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023092726.1\|61892_62873_-\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_023092725.1\|63801_65121_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	6.3e-69	39.8
65284:65329	attL	NA	NA	NA	NA
WP_034059486.1\|65440_66589_-\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	4.1e-72	40.5
WP_023114959.1\|66585_66798_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_023114958.1\|66794_66983_-	hypothetical protein	Q38017	Pseudomonas_virus	7.0e-06	76.5
WP_034033458.1\|66993_68679_-	DNA methyltransferase	L7TH64	Pseudomonas_virus	2.8e-287	90.8
WP_003098417.1\|68982_69189_-	TraR/DksA family transcriptional regulator	Q9ZXI6	Pseudomonas_virus	7.3e-33	100.0
WP_003098415.1\|69200_69554_-	hypothetical protein	Q9ZXI7	Pseudomonas_virus	3.8e-61	97.4
WP_031757146.1\|69613_69886_-	hypothetical protein	NA	NA	NA	NA
WP_034033456.1\|69930_72651_-	toprim domain-containing protein	Q9ZXI8	Pseudomonas_virus	0.0e+00	96.9
WP_003098410.1\|72647_72881_-	hypothetical protein	Q9ZXI9	Pseudomonas_virus	7.8e-39	100.0
WP_023096288.1\|72952_73303_-	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	1.1e-09	36.4
WP_003098408.1\|73299_73593_-	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	1.1e-50	99.0
WP_175547114.1\|73589_74060_-	hypothetical protein	Q9ZXJ2	Pseudomonas_virus	2.7e-75	97.4
WP_031643139.1\|74089_74302_-	hypothetical protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.9e-07	46.8
WP_031643138.1\|74386_74743_+	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	2.3e-10	36.0
WP_023096284.1\|75060_75411_+	hypothetical protein	Q9ZXJ5	Pseudomonas_virus	2.9e-53	89.6
WP_031633861.1\|75464_75998_-	hypothetical protein	NA	NA	NA	NA
WP_073673145.1\|76120_76660_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023116820.1\|76881_78159_-	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	5.7e-232	96.9
WP_003098399.1\|78155_78596_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	1.8e-76	99.3
WP_023114949.1\|78601_81349_-\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	0.0e+00	94.1
WP_003098394.1\|81338_81458_-\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	1.8e-15	100.0
WP_023083449.1\|81466_81796_-\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	5.3e-49	96.3
WP_034059490.1\|81850_82366_-\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	1.8e-88	93.6
WP_023114947.1\|82422_83598_-\|tail	phage tail sheath protein	Q9ZXK4	Pseudomonas_virus	2.3e-219	98.5
WP_023114946.1\|83688_84153_-	hypothetical protein	Q9ZXK5	Pseudomonas_virus	2.3e-42	60.7
WP_015967199.1\|86508_87045_-\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	1.4e-99	100.0
WP_015967198.1\|87044_87959_-\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	3.3e-165	100.0
WP_034059497.1\|87955_88300_-	GPW/gp25 family protein	Q9ZXK9	Pseudomonas_virus	4.6e-56	97.4
WP_034059500.1\|88296_88869_-\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	4.6e-93	98.9
WP_034059522.1\|88930_89707_-	NYN domain-containing protein	NA	NA	NA	NA
WP_034059503.1\|89787_90252_-	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	2.3e-66	88.7
WP_034059506.1\|90244_90781_-\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	2.7e-95	98.9
WP_034059508.1\|90858_91320_-\|lysis	LysB family phage lysis regulatory protein	Q9ZXL5	Pseudomonas_virus	2.1e-72	98.7
WP_033937622.1\|91316_92123_-	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	1.3e-149	98.1
WP_034059510.1\|92119_92392_-\|holin	phage holin family protein	Q9ZXL7	Pseudomonas_virus	4.5e-38	97.8
WP_003098379.1\|92393_92747_-	hypothetical protein	Q9ZXL8	Pseudomonas_virus	6.0e-59	100.0
WP_003098378.1\|92771_92984_-\|tail	tail protein X	Q9ZXL9	Pseudomonas_virus	4.9e-32	94.1
WP_033937624.1\|92983_93445_-\|head	head completion/stabilization protein	Q9ZXM1	Pseudomonas_virus	1.8e-79	97.4
WP_034059511.1\|93548_94250_-\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	1.2e-122	98.7
WP_034059513.1\|94255_95272_-\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	3.8e-191	99.1
WP_015967183.1\|95307_96129_-\|capsid	GPO family capsid scaffolding protein	Q9ZXM4	Pseudomonas_virus	8.9e-130	100.0
WP_034059525.1\|96284_98045_+\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	0.0e+00	99.7
WP_034059515.1\|98044_99112_+\|portal	phage portal protein	Q9ZXM6	Pseudomonas_virus	3.5e-195	97.4
WP_073673146.1\|99084_99684_-	hypothetical protein	A0A2D1GNI4	Pseudomonas_phage	6.7e-42	44.2
101724:101769	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_JTRJ01000049

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_JTRJ01000049_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_JTRJ01000049_1

9608-9721

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_JTRJ01000049_1

>merge|NZ_JTRJ01000049|1|9608-9721|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>NZ_JTRJ01000049|1|1|9608-9721|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_JTRJ01000049.1\|WP_023443543.1\|17371_18070_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|226274
NZ_JTRJ01000049.1\|WP_003084299.1\|4898_6002_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_JTRJ01000049.1\|WP_003084333.1\|18911_19406_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
NZ_JTRJ01000049.1\|WP_003110707.1\|16570_17323_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JTRJ01000049.1\|WP_003084301.1\|6420_7518_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_JTRJ01000049.1\|WP_003084308.1\|10784_13172_-\|N-acylhomoserine-lactone-acylase-HacB	unknown	unknown	gnl\|CDD\|225241
NZ_JTRJ01000049.1\|WP_003084303.1\|7572_8727_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_JTRJ01000049.1\|WP_003084285.1\|1195_1948_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_JTRJ01000049.1\|WP_023443544.1\|15531_16551_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_JTRJ01000049.1\|WP_003084339.1\|19410_20103_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_JTRJ01000049.1\|WP_023108702.1\|14921_15533_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239267
NZ_JTRJ01000049.1\|WP_033945754.1\|0_917_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_JTRJ01000049.1\|WP_003084297.1\|3412_4783_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
NZ_JTRJ01000049.1\|WP_003110710.1\|14313_14817_-\|transcriptional-regulator	unknown	unknown	unknown
NZ_JTRJ01000049.1\|WP_003084290.1\|1988_3347_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_JTRJ01000049.1\|WP_009315025.1\|18091_18646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JTRJ01000049.1\|WP_003110711.1\|13282_14335_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890

Protein	Function_ID	Function_description	E-value
NZ_JTRJ01000049.1\|WP_003084299.1\|4898_6002_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_JTRJ01000049.1\|WP_003084339.1\|19410_20103_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	3.29364e-79
NZ_JTRJ01000049.1\|WP_023443543.1\|17371_18070_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	2.59121e-76
NZ_JTRJ01000049.1\|WP_003084301.1\|6420_7518_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_JTRJ01000049.1\|WP_003084308.1\|10784_13172_-\|N-acylhomoserine-lactone-acylase-HacB	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
NZ_JTRJ01000049.1\|WP_003084303.1\|7572_8727_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
NZ_JTRJ01000049.1\|WP_003084285.1\|1195_1948_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	3.1783e-108
NZ_JTRJ01000049.1\|WP_023443544.1\|15531_16551_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	4.06647e-56
NZ_JTRJ01000049.1\|WP_023108702.1\|14921_15533_-\|hypothetical-protein	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.00631985
NZ_JTRJ01000049.1\|WP_033945754.1\|0_917_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.45414e-89
NZ_JTRJ01000049.1\|WP_003084297.1\|3412_4783_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
NZ_JTRJ01000049.1\|WP_003084333.1\|18911_19406_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	1.65548e-66
NZ_JTRJ01000049.1\|WP_003084290.1\|1988_3347_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
NZ_JTRJ01000049.1\|WP_003110711.1\|13282_14335_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.34355e-32

>NZ_JTRJ01000049.1|WP_003084303.1|7572_8727_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>NZ_JTRJ01000049.1|WP_003084301.1|6420_7518_+|polyamine-ABC-transporter-substrate-binding-protein
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>NZ_JTRJ01000049.1|WP_003084299.1|4898_6002_+|polyamine-ABC-transporter-substrate-binding-protein
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>NZ_JTRJ01000049.1|WP_003084297.1|3412_4783_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>NZ_JTRJ01000049.1|WP_003084290.1|1988_3347_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>NZ_JTRJ01000049.1|WP_003084285.1|1195_1948_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACGKRAGQR
>NZ_JTRJ01000049.1|WP_033945754.1|0_917_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPA
>NZ_JTRJ01000049.1|WP_003084308.1|10784_13172_-|N-acylhomoserine-lactone-acylase-HacB
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLIAEKVNPDNPNQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWKGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWWDDRRTERRETRADIVRAAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLKRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>NZ_JTRJ01000049.1|WP_003110711.1|13282_14335_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHGVLTRHAEEQTRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>NZ_JTRJ01000049.1|WP_003110710.1|14313_14817_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLRLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>NZ_JTRJ01000049.1|WP_023108702.1|14921_15533_-|hypothetical-protein
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWNRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>NZ_JTRJ01000049.1|WP_023443544.1|15531_16551_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSHHPRLQARLGSMAVDGRRLAVQAWLLPESRGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>NZ_JTRJ01000049.1|WP_003110707.1|16570_17323_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDTELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAH
>NZ_JTRJ01000049.1|WP_023443543.1|17371_18070_+|2OG-Fe(II)-oxygenase
MGRYCRHAADRLSRHRDGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDNLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>NZ_JTRJ01000049.1|WP_009315025.1|18091_18646_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKVGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>NZ_JTRJ01000049.1|WP_003084333.1|18911_19406_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG
>NZ_JTRJ01000049.1|WP_003084339.1|19410_20103_-|amino-acid-ABC-transporter-permease
MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLILGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALENRLTAPLRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_JTRJ01000019

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

73290 : 80746

Pseudomonas_phage(100.0%)

coat,integrase

attL 72934:72964|attR 84283:84313

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
72934:72964	attL	NA	NA	NA	NA
WP_023090792.1\|73290_74286_-\|integrase	tyrosine-type recombinase/integrase	Q56VN7	Pseudomonas_phage	2.8e-93	52.9
WP_003115206.1\|74285_75578_-	hypothetical protein	Q56VN8	Pseudomonas_phage	2.8e-247	94.2
WP_023092200.1\|75807_77082_-	zonular occludens toxin family protein	Q56VN9	Pseudomonas_phage	1.1e-200	87.5
WP_034059404.1\|77085_77442_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	3.9e-58	99.2
WP_049875594.1\|77446_78727_-	hypothetical protein	Q56VP1	Pseudomonas_phage	2.1e-48	56.7
WP_003125072.1\|78874_79123_-\|coat	phage coat protein B	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
WP_003115979.1\|79135_79387_-	hypothetical protein	NA	NA	NA	NA
WP_003115097.1\|79508_79943_-	hypothetical protein	Q56VP5	Pseudomonas_phage	1.2e-61	98.6
WP_023092202.1\|80458_80746_-	DUF5447 family protein	Q56VP7	Pseudomonas_phage	3.7e-51	95.6
84283:84313	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_JTRJ01000007

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

167396 : 173582

Powai_lake_megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092811.1\|167396_167828_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.2e-22	41.7
WP_003092814.1\|168071_168272_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003092818.1\|168297_168636_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003092822.1\|168642_170502_-	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	2.2e-107	40.3
WP_003092824.1\|170544_171066_-	co-chaperone HscB	NA	NA	NA	NA
WP_003100617.1\|171073_171397_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.8e-24	50.5
WP_003092829.1\|171424_171811_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	79.8
WP_003092832.1\|171846_173061_-	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	2.6e-32	36.9
WP_003092836.1\|173090_173582_-	Fe-S cluster assembly transcriptional regulator IscR	M4M9K8	Vibrio_phage	2.2e-06	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

9. NZ_JTRJ01000041

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

145471 : 153133

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003094072.1\|145471_146230_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	7.7e-11	28.6
WP_009315950.1\|146338_147073_+	HugZ family protein	NA	NA	NA	NA
WP_003094066.1\|147141_147609_+	membrane protein FxsA	NA	NA	NA	NA
WP_003094064.1\|147804_148098_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	7.5e-15	49.5
WP_003094059.1\|148148_149792_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.2e-175	64.2
WP_023092845.1\|149847_150534_-	hypothetical protein	NA	NA	NA	NA
WP_003094051.1\|150763_151147_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.7e-36	69.9
WP_003094048.1\|151166_151496_+	DUF190 domain-containing protein	A0A2H4J2R0	uncultured_Caudovirales_phage	2.2e-23	47.6
WP_003094044.1\|151438_152233_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003094039.1\|152449_153133_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-28	33.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

10. NZ_JTRJ01000057

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

348 : 24175

Pseudomonas_phage(93.94%)

portal,protease,tail,holin,terminase,capsid,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023981169.1\|348_660_+	DUF4258 domain-containing protein	A0A0P0IE58	Acinetobacter_phage	1.4e-11	37.2
WP_023118775.1\|677_1112_+	transcriptional regulator	A0A0P0IRJ4	Acinetobacter_phage	5.0e-23	38.9
WP_031278684.1\|1172_1445_-	hypothetical protein	A0A0U4JEI3	Pseudomonas_phage	3.4e-46	97.8
WP_031278687.1\|1490_1805_-	hypothetical protein	A0A0U4K5I1	Pseudomonas_phage	1.4e-51	93.3
WP_023981173.1\|2384_2666_-	hypothetical protein	A0A1W6JTD4	Pseudomonas_phage	1.5e-44	97.8
WP_023981174.1\|2666_3227_-	hypothetical protein	A0A1W6JT84	Pseudomonas_phage	4.2e-99	98.9
WP_023092534.1\|3231_3423_-	hypothetical protein	A0A1B0Z2L3	Pseudomonas_phage	8.6e-28	96.8
WP_023093253.1\|3415_4003_-	hypothetical protein	A0A1W6JT86	Pseudomonas_phage	2.8e-101	94.4
WP_023981175.1\|4032_5691_-	hypothetical protein	A0A0A0YRR5	Pseudomonas_phage	0.0e+00	97.4
WP_023092531.1\|5687_6092_-	hypothetical protein	A0A0U4B0P9	Pseudomonas_phage	7.6e-66	98.5
WP_023092530.1\|6102_6648_-	hypothetical protein	A0A1W6JT85	Pseudomonas_phage	1.7e-100	100.0
WP_023093251.1\|6647_7058_-	hypothetical protein	A0A1W6JT78	Pseudomonas_phage	2.5e-56	95.6
WP_023981176.1\|7060_8764_-	hypothetical protein	A0A0U4JP39	Pseudomonas_phage	2.6e-301	92.8
WP_003098501.1\|8765_9269_-	hypothetical protein	A0A0U4IIK1	Pseudomonas_phage	1.8e-93	100.0
WP_023981177.1\|9278_11420_-	tape measure protein	A0A0U3TH20	Pseudomonas_phage	0.0e+00	98.7
WP_124128807.1\|11418_11598_+	hypothetical protein	NA	NA	NA	NA
WP_023092526.1\|11603_11969_-	hypothetical protein	A0A0U4KLC4	Pseudomonas_phage	3.1e-58	98.3
WP_023092525.1\|12024_12810_-	hypothetical protein	A0A0U4ISK2	Pseudomonas_phage	1.4e-140	94.6
WP_023981179.1\|12833_13271_-	hypothetical protein	A0A0U4IBQ1	Pseudomonas_phage	1.0e-71	94.5
WP_034059777.1\|13283_13877_-	hypothetical protein	A0A0U4J906	Pseudomonas_phage	4.8e-101	97.5
WP_023981180.1\|13873_14425_-	hypothetical protein	NA	NA	NA	NA
WP_023092522.1\|14434_14617_-	hypothetical protein	A0A0U4K5G7	Pseudomonas_phage	9.1e-11	55.9
WP_023092521.1\|14639_14960_-\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	4.1e-30	57.1
WP_023092520.1\|14952_15231_-	hypothetical protein	A0A2D1GNQ9	Pseudomonas_phage	4.2e-15	40.9
WP_023092519.1\|15276_16479_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	9.9e-178	76.8
WP_023092518.1\|16489_17143_-\|head,protease	HK97 family phage prohead protease	A0A2D1GNL2	Pseudomonas_phage	2.6e-100	82.6
WP_023092517.1\|17120_18344_-\|portal	phage portal protein	A0A2D1GNU4	Pseudomonas_phage	1.9e-189	81.0
WP_023127397.1\|18343_20071_-\|terminase	terminase large subunit	A0A2D1GNU5	Pseudomonas_phage	5.4e-270	76.3
WP_014602593.1\|20074_20557_-\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	1.4e-61	74.4
WP_023981182.1\|20638_21043_-	HNH endonuclease	A0A0U4B0J6	Pseudomonas_phage	3.7e-28	52.7
WP_171889767.1\|21179_21611_-	hypothetical protein	A0A0U4JX95	Pseudomonas_phage	3.0e-52	86.2
WP_023981184.1\|21628_22246_-	glycoside hydrolase family 19 protein	A0A0U4JP23	Pseudomonas_phage	2.1e-107	93.6
WP_023981185.1\|22242_22575_-\|holin	phage holin, lambda family	A0A1B0YZZ1	Pseudomonas_phage	2.0e-43	99.1
WP_071537902.1\|22754_23294_-	DUF4124 domain-containing protein	A0A1B0Z2K9	Pseudomonas_phage	8.3e-76	83.2
WP_023981186.1\|23502_23877_-	hypothetical protein	NA	NA	NA	NA
WP_023981187.1\|23878_24175_-	hypothetical protein	A0A1B0YZZ2	Pseudomonas_phage	1.5e-47	94.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage