CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_JVDI01000032	Serratia marcescens strain 532_SMAR 106_40395_877386, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000023	Serratia marcescens strain 532_SMAR 62_41018_912924, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000051	Serratia marcescens strain 532_SMAR 155_1848_38861, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000050	Serratia marcescens strain 532_SMAR 153_67198_1277272, whole genome shotgun sequence	0 crisprs	csa3	0	0	0
NZ_JVDI01000055	Serratia marcescens strain 532_SMAR 164_66261_1337834, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000053	Serratia marcescens strain 532_SMAR 161_13351_236442, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_JVDI01000007	Serratia marcescens strain 532_SMAR 14_22491_429794, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000046	Serratia marcescens strain 532_SMAR 145_238_4406, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000052	Serratia marcescens strain 532_SMAR 158_2984_62376, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000071	Serratia marcescens strain 532_SMAR 213_32586_606933, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000024	Serratia marcescens strain 532_SMAR 64_6137_130927, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000031	Serratia marcescens strain 532_SMAR 104_202_3649, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000067	Serratia marcescens strain 532_SMAR 189_236_6242, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000022	Serratia marcescens strain 532_SMAR 61_299781_6165447, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000075	Serratia marcescens strain 532_SMAR 223_1445_28374, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000003	Serratia marcescens strain 532_SMAR 7_295_5612, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000088	Serratia marcescens strain 532_SMAR 242_33584_763535_221_,27+,199+, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000065	Serratia marcescens strain 532_SMAR 185_2956_539042, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000044	Serratia marcescens strain 532_SMAR 142_3949_82665, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000004	Serratia marcescens strain 532_SMAR 9_671_14409, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000018	Serratia marcescens strain 532_SMAR 55_354_6667, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000039	Serratia marcescens strain 532_SMAR 128_170071_3188743, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000068	Serratia marcescens strain 532_SMAR 197_116976_2589334, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000064	Serratia marcescens strain 532_SMAR 184_36974_744583, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000082	Serratia marcescens strain 532_SMAR 236_205_4984_85+,211+,162_, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000019	Serratia marcescens strain 532_SMAR 56_399_7591, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000025	Serratia marcescens strain 532_SMAR 72_12394_319034, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000089	Serratia marcescens strain 532_SMAR 243_2074_304782_231+,98+, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000079	Serratia marcescens strain 532_SMAR 233_116388_2261040, whole genome shotgun sequence	0 crisprs	csa3	0	1	0
NZ_JVDI01000054	Serratia marcescens strain 532_SMAR 163_52021_1179654, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000083	Serratia marcescens strain 532_SMAR 237_2043_55927_109+,105_,232+, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000056	Serratia marcescens strain 532_SMAR 167_377_7084, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000077	Serratia marcescens strain 532_SMAR 228_346_4225, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000027	Serratia marcescens strain 532_SMAR 86_13614_273313, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000048	Serratia marcescens strain 532_SMAR 149_45749_803426, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000026	Serratia marcescens strain 532_SMAR 74_31814_607282, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000087	Serratia marcescens strain 532_SMAR 241_273680_6013115_119+,94+,196_, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_JVDI01000057	Serratia marcescens strain 532_SMAR 171_24011_504739, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_JVDI01000040	Serratia marcescens strain 532_SMAR 130_220552_4473282, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000060	Serratia marcescens strain 532_SMAR 176_12243_220666, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_JVDI01000012	Serratia marcescens strain 532_SMAR 24_223229_4278687, whole genome shotgun sequence	0 crisprs	DinG	0	0	0
NZ_JVDI01000028	Serratia marcescens strain 532_SMAR 95_247_3266, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000029	Serratia marcescens strain 532_SMAR 96_293_4193, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000066	Serratia marcescens strain 532_SMAR 188_46898_920281, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000038	Serratia marcescens strain 532_SMAR 127_4599_111202, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000008	Serratia marcescens strain 532_SMAR 15_64159_1224615, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000076	Serratia marcescens strain 532_SMAR 227_33944_693626, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000059	Serratia marcescens strain 532_SMAR 175_453_9982, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000085	Serratia marcescens strain 532_SMAR 239_65551_1398706_91_,75+, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000010	Serratia marcescens strain 532_SMAR 19_280545_5287259, whole genome shotgun sequence	0 crisprs	DinG	0	0	0
NZ_JVDI01000034	Serratia marcescens strain 532_SMAR 116_1633_33726, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000043	Serratia marcescens strain 532_SMAR 141_104830_1899821, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000063	Serratia marcescens strain 532_SMAR 183_168377_3549078, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000045	Serratia marcescens strain 532_SMAR 143_2120_49985, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000015	Serratia marcescens strain 532_SMAR 42_120018_2741528, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_JVDI01000030	Serratia marcescens strain 532_SMAR 101_16010_315416, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000069	Serratia marcescens strain 532_SMAR 198_51826_1025984, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000013	Serratia marcescens strain 532_SMAR 25_62401_1196902, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000005	Serratia marcescens strain 532_SMAR 10_37081_665027, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000042	Serratia marcescens strain 532_SMAR 136_79647_2121671, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000009	Serratia marcescens strain 532_SMAR 16_25628_603667, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000036	Serratia marcescens strain 532_SMAR 122_350835_7664473, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000073	Serratia marcescens strain 532_SMAR 218_280_2545, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000037	Serratia marcescens strain 532_SMAR 124_248261_5000165, whole genome shotgun sequence	1 crisprs	cas3	1	2	2
NZ_JVDI01000074	Serratia marcescens strain 532_SMAR 222_259_4088, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000061	Serratia marcescens strain 532_SMAR 177_8817_194694, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_JVDI01000047	Serratia marcescens strain 532_SMAR 146_9517_187203, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000041	Serratia marcescens strain 532_SMAR 133_482_8352, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000002	Serratia marcescens strain 532_SMAR 6_22170_447593, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000021	Serratia marcescens strain 532_SMAR 59_13744_233665, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000014	Serratia marcescens strain 532_SMAR 32_215_3656, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000033	Serratia marcescens strain 532_SMAR 110_150548_3115570, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000062	Serratia marcescens strain 532_SMAR 181_30519_716022, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000078	Serratia marcescens strain 532_SMAR 229_773_16379, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000058	Serratia marcescens strain 532_SMAR 172_200_2795, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000049	Serratia marcescens strain 532_SMAR 152_2013_43394, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000080	Serratia marcescens strain 532_SMAR 234_416_9268_37+,179+,111+, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000016	Serratia marcescens strain 532_SMAR 51_35501_769815, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000006	Serratia marcescens strain 532_SMAR 12_109667_1960017, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_JVDI01000081	Serratia marcescens strain 532_SMAR 235_1555_43100_49_,28_,108_, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000084	Serratia marcescens strain 532_SMAR 238_143258_2631397_63_,22+, whole genome shotgun sequence	0 crisprs	cas3,csa3	0	0	0
NZ_JVDI01000020	Serratia marcescens strain 532_SMAR 57_135600_3070521, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000011	Serratia marcescens strain 532_SMAR 20_377770_6725418, whole genome shotgun sequence	0 crisprs	csa3	0	0	0
NZ_JVDI01000035	Serratia marcescens strain 532_SMAR 117_5669_127848, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000017	Serratia marcescens strain 532_SMAR 52_49109_983424, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000070	Serratia marcescens strain 532_SMAR 206_158050_3005125, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_JVDI01000072	Serratia marcescens strain 532_SMAR 216_8125_140948, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000086	Serratia marcescens strain 532_SMAR 240_2005_303321_98_,56N,76+, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_JVDI01000001	Serratia marcescens strain 532_SMAR 5_74472_1389400, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

26105 : 35032

environmental_Halophage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049300707.1\|26105_28184_+	FUSC family protein	H9YQA8	environmental_Halophage	1.3e-52	71.9
WP_049300709.1\|28224_29442_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.7e-26	26.1
WP_016930347.1\|29573_30149_-	aminodeoxychorismate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.7e-69	62.8
WP_016930348.1\|30221_31745_-	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	2.5e-77	42.6
WP_016930349.1\|31896_32622_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_016930350.1\|32621_34307_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	9.8e-224	72.7
WP_015379288.1\|34462_35032_-	peptidylprolyl isomerase A	A0A1B1IVS0	uncultured_Mediterranean_phage	9.8e-11	32.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_JVDI01000070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146863 : 156241

Bacillus_phage(16.67%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049300520.1\|146863_148603_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	1.3e-16	24.0
WP_016928334.1\|148632_149358_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_002211347.1\|149463_149682_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_004928343.1\|149887_152167_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	8.7e-167	42.0
WP_004928347.1\|152194_152515_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	8.2e-15	42.7
WP_004928349.1\|152870_153092_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.1e-15	59.7
WP_033633459.1\|153179_155126_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	6.1e-36	37.3
WP_028127988.1\|155125_156241_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.2e-07	44.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_JVDI01000069

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

335 : 15069

Klebsiella_phage(35.71%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028127738.1\|335_647_+\|holin	phage holin family protein	F1C5D1	Cronobacter_phage	2.5e-40	81.0
WP_016926943.1\|643_1084_+	lysozyme	A0A0M5M782	Salmonella_phage	2.0e-43	63.4
WP_048796965.1\|1140_1530_+	hypothetical protein	NA	NA	NA	NA
WP_049300457.1\|1526_1919_+	HK97 gp10 family phage protein	Q7Y404	Yersinia_phage	3.6e-20	46.0
WP_016926946.1\|1960_2416_+\|tail	major tail shaft subunit	Q6UAX0	Klebsiella_phage	1.2e-56	74.8
WP_016926947.1\|2532_2898_+\|tail	phage tail protein	Q7Y401	Yersinia_phage	1.9e-23	44.2
WP_080353579.1\|2915_3137_+	hypothetical protein	Q6UAW9	Klebsiella_phage	1.9e-10	49.3
WP_049300458.1\|3129_5307_+\|tail	phage tail tape measure protein	Q6UAW7	Klebsiella_phage	8.7e-15	44.6
WP_019453671.1\|5306_5645_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	2.2e-34	60.9
WP_049300459.1\|5654_6407_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	8.5e-95	63.6
WP_049300460.1\|6416_7121_+	C40 family peptidase	K7PJV6	Enterobacteria_phage	1.2e-106	75.0
WP_143778336.1\|7160_7520_+	hypothetical protein	NA	NA	NA	NA
WP_049300461.1\|7576_8203_+\|tail	tail assembly protein	F1C572	Cronobacter_phage	7.4e-52	55.2
WP_049300462.1\|8256_11844_+	DUF1983 domain-containing protein	F1C571	Cronobacter_phage	0.0e+00	66.3
WP_049300463.1\|11893_13051_+\|tail	tail fiber domain-containing protein	A0A1V0E5M2	Salmonella_phage	3.3e-45	57.8
WP_075205920.1\|13047_15069_+\|tail	prophage tail fiber N-terminal domain-containing protein	A0A1I9SF20	Klebsiella_phage	2.0e-29	46.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_JVDI01000043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2565 : 68919

Tupanvirus(18.75%)

tRNA,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049300217.1\|2565_3984_+\|protease	serralysin family metalloprotease	NA	NA	NA	NA
WP_016928015.1\|4131_4341_-	hypothetical protein	NA	NA	NA	NA
WP_162835083.1\|4500_4653_+	hypothetical protein	NA	NA	NA	NA
WP_004931522.1\|5121_5514_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_049300218.1\|5518_6118_+	hypothetical protein	NA	NA	NA	NA
WP_004931517.1\|6172_6412_-	YebV family protein	NA	NA	NA	NA
WP_049300219.1\|6547_7480_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_193390231.1\|7500_9921_-	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_033640548.1\|9988_10753_-	molecular chaperone	NA	NA	NA	NA
WP_086013591.1\|10777_11326_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_049300220.1\|11331_11835_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_016928005.1\|11837_12377_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_049300221.1\|12651_14088_-	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_015377667.1\|14190_16821_-	PqiB family protein	NA	NA	NA	NA
WP_049300246.1\|16789_18037_-	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_049300222.1\|18292_18790_+	GAF domain-containing protein	NA	NA	NA	NA
WP_016928000.1\|18886_19597_+	RNA chaperone ProQ	Q2A0A1	Sodalis_phage	1.7e-07	40.0
WP_016927999.1\|19616_21665_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-85	34.0
WP_016927998.1\|21975_22860_+\|protease	protease HtpX	NA	NA	NA	NA
WP_049300223.1\|23199_23907_+	hypothetical protein	NA	NA	NA	NA
WP_049300224.1\|23997_25392_-	MFS transporter	NA	NA	NA	NA
WP_028128163.1\|25623_26415_+	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_033640530.1\|26461_27265_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_016927992.1\|27267_28131_-	2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
WP_033642858.1\|28132_29269_-	2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT	G3M9Y6	Bacillus_virus	4.4e-26	33.7
WP_016927990.1\|29265_30276_-	2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_048795867.1\|30451_31171_-	phosphonate utilization transcriptional regulator PhnR	NA	NA	NA	NA
WP_016927988.1\|31325_32429_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_049300226.1\|32438_33248_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_049300227.1\|33311_34703_-	L-cystine transporter	NA	NA	NA	NA
WP_049300228.1\|34884_35433_-	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	6.4e-07	35.8
WP_049300229.1\|35858_36524_-	hexitol phosphatase HxpB	NA	NA	NA	NA
WP_049300230.1\|36588_37869_-\|protease	protease	NA	NA	NA	NA
WP_004931453.1\|38054_38615_+	YniB family protein	NA	NA	NA	NA
WP_028128166.1\|38650_39520_-	fructosamine kinase family protein	NA	NA	NA	NA
WP_033640520.1\|39756_40611_-	metal ABC transporter permease	NA	NA	NA	NA
WP_049300231.1\|40610_41471_-	iron/manganese ABC transporter permease subunit YfeC	NA	NA	NA	NA
WP_049300232.1\|41470_42361_-	manganese/iron ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	4.2e-16	28.3
WP_162838158.1\|42357_43248_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016927977.1\|43433_43733_-	type V toxin-antitoxin system endoribonuclease antitoxin GhoS	NA	NA	NA	NA
WP_004931439.1\|43842_44508_+	transglycosylase SLT domain-containing protein	I6ZXX9	Escherichia_phage	1.0e-06	46.3
WP_033640515.1\|44815_45541_+	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_004931432.1\|45543_47325_+	GMC family oxidoreductase	NA	NA	NA	NA
WP_033640514.1\|47337_48675_+	cytochrome c	NA	NA	NA	NA
WP_028128168.1\|48932_50216_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_028128169.1\|50366_51500_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_170913123.1\|51537_52215_-	MarC family NAAT transporter	NA	NA	NA	NA
WP_050072186.1\|52331_52529_-	hypothetical protein	NA	NA	NA	NA
WP_049300234.1\|52775_53399_+	hypothetical protein	NA	NA	NA	NA
WP_025159696.1\|53617_55546_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.5e-132	37.7
WP_048233542.1\|55549_56101_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.6e-16	33.7
WP_004931418.1\|56199_56397_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004931417.1\|56440_56797_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_121626058.1\|56914_56959_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_004931416.1\|57219_58203_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	2.2e-34	38.9
WP_016927965.1\|58217_60605_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_004931414.1\|60609_60906_+	integration host factor subunit alpha	Q2A099	Sodalis_phage	4.3e-10	38.2
WP_016927962.1\|61457_61874_+	DUF2502 domain-containing protein	NA	NA	NA	NA
WP_016927961.1\|62053_63061_+	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	2.3e-10	22.9
WP_004931411.1\|63106_63658_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	7.5e-16	34.4
WP_049300235.1\|63663_64419_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	3.4e-11	30.4
WP_033640509.1\|64815_65970_+	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A0P0YLZ6	Yellowstone_lake_phycodnavirus	2.7e-23	28.4
WP_015377702.1\|65956_66937_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	B9UDL7	Salmonella_phage	3.1e-36	32.4
WP_033641428.1\|66936_68919_+	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	1.1e-21	25.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_JVDI01000036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

86323 : 124880

Erwinia_phage(43.24%)

integrase,tRNA,tail,lysis,portal,head,terminase,capsid,plate

attL 92953:93002|attR 124952:125001

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048325519.1\|86323_87337_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.7e-109	59.5
WP_001144069.1\|87662_87878_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_016930158.1\|88014_89763_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.5e-73	38.6
WP_004937194.1\|89920_91762_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.9e-34	33.3
WP_016930159.1\|91817_92261_-	ester cyclase	NA	NA	NA	NA
WP_016930160.1\|92287_92776_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
92953:93002	attL	NA	NA	NA	NA
WP_071998163.1\|93156_93387_-	DNA-binding transcriptional regulator	Q37973	Salmonella_virus	3.2e-21	64.5
WP_033649051.1\|93477_94626_-	phage late control D family protein	A0A218M4J7	Erwinia_phage	1.9e-125	63.4
WP_015379102.1\|94622_95108_-\|tail	phage tail protein	A0A0F7LDE8	Escherichia_phage	1.5e-47	65.7
WP_033649050.1\|95112_97959_-\|tail	phage tail tape measure protein	A0A0M3UL85	Salmonella_phage	7.9e-109	51.2
WP_023456045.1\|97951_98074_-\|tail	GpE family phage tail protein	Q6K1G8	Salmonella_virus	1.5e-09	72.5
WP_033639350.1\|98106_98388_-\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	5.3e-26	69.0
WP_023447563.1\|98442_98952_-\|tail	phage major tail tube protein	A0A218M4J0	Erwinia_phage	1.7e-70	76.2
WP_033649049.1\|98967_100137_-\|tail	phage tail sheath protein	F1BUU3	Erwinia_phage	3.1e-184	81.7
WP_033649048.1\|100413_100959_-\|tail	tail fiber assembly protein	A0A222YWC2	Escherichia_phage	2.0e-37	46.4
WP_106024918.1\|100960_103582_-\|tail	phage tail protein	Q858V4	Yersinia_virus	3.7e-60	54.1
WP_033649047.1\|103588_104122_-\|tail	phage tail protein I	Q858V5	Yersinia_virus	5.7e-77	76.0
WP_033649046.1\|104114_105023_-\|plate	baseplate assembly protein	A0A1J0I2M3	Salmonella_phage	8.1e-108	68.2
WP_033649045.1\|105027_105378_-	GPW/gp25 family protein	F1BUP4	Erwinia_phage	2.2e-37	67.2
WP_154231760.1\|105374_105515_-	hypothetical protein	NA	NA	NA	NA
WP_033649044.1\|105525_106155_-\|plate	phage baseplate assembly protein V	A0A0M4S6F6	Salmonella_phage	6.3e-75	72.8
WP_033649043.1\|106227_106674_-	phage virion morphogenesis protein	O80313	Escherichia_phage	4.6e-40	58.4
WP_033649042.1\|106660_107134_-\|tail	phage tail protein	F1BUP9	Erwinia_phage	3.4e-49	61.8
WP_033649041.1\|107229_107658_-\|lysis	LysB family phage lysis regulatory protein	O80310	Escherichia_phage	1.8e-09	35.8
WP_033649040.1\|107654_108167_-	lysozyme	A0A218M4K3	Erwinia_phage	5.7e-58	66.5
WP_031231709.1\|108150_108360_-	hypothetical protein	F1BUQ4	Erwinia_phage	1.2e-09	46.7
WP_015379118.1\|108364_108568_-\|tail	tail protein X	A0A0F7LCN2	Escherichia_phage	2.4e-20	68.7
WP_033639340.1\|108567_109056_-\|head	head completion/stabilization protein	F1BUQ6	Erwinia_phage	1.1e-39	54.3
WP_033649039.1\|109149_109809_-\|terminase	terminase endonuclease subunit	F1BUQ7	Erwinia_phage	5.2e-80	69.4
WP_033649038.1\|109811_111023_-\|capsid	phage major capsid protein, P2 family	F1BUQ8	Erwinia_phage	7.9e-159	78.5
WP_033649037.1\|111065_111881_-\|capsid	GPO family capsid scaffolding protein	S4TP53	Salmonella_phage	2.7e-70	53.1
WP_033649036.1\|112023_113796_+\|terminase	terminase ATPase subunit family protein	F1BUR2	Erwinia_phage	4.4e-291	82.0
WP_033649034.1\|113795_114830_+\|portal	phage portal protein	F1BUR7	Erwinia_phage	3.2e-161	79.5
WP_033633573.1\|114874_115216_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_071605322.1\|115215_115470_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_019843167.1\|115994_116567_-	flavin reductase	NA	NA	NA	NA
WP_033649106.1\|116695_117595_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_139818298.1\|117691_117889_-	hypothetical protein	NA	NA	NA	NA
WP_049299940.1\|117936_118167_-	hypothetical protein	NA	NA	NA	NA
WP_033649032.1\|118207_120421_-	replication endonuclease	S4TTC1	Salmonella_phage	4.7e-242	58.9
WP_033649031.1\|120417_120843_-	hypothetical protein	Q5G8V2	Enterobacteria_phage	6.0e-05	34.1
WP_015379131.1\|120832_121114_-	DUF5405 family protein	NA	NA	NA	NA
WP_023460307.1\|121236_121461_-	TraR/DksA C4-type zinc finger protein	Q6K1F5	Salmonella_virus	3.7e-14	56.9
WP_033649030.1\|121460_121754_-	DUF2732 family protein	NA	NA	NA	NA
WP_031221632.1\|121818_122121_-	hypothetical protein	NA	NA	NA	NA
WP_049279101.1\|122132_122312_-	DUF2724 domain-containing protein	F1BUS5	Erwinia_phage	1.1e-05	51.0
WP_033649029.1\|122322_122832_-	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	5.5e-45	53.6
WP_071998162.1\|122863_123127_-	hypothetical protein	A0A218M4I5	Erwinia_phage	4.8e-37	85.1
WP_033649028.1\|123258_123837_+	phage repressor protein CI	A0A218M4J1	Erwinia_phage	9.9e-59	55.3
WP_033649027.1\|123836_124880_+\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	1.0e-178	87.0
124952:125001	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_JVDI01000037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_JVDI01000037_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_JVDI01000037_1

200879-200971

Orphan

Consensus_repeat	Method
TGGGCCTGCTTCAGTTGCTCCAGTGCGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_JVDI01000037_1

>merge|NZ_JVDI01000037|1|200879-200971|CRISPRCasFinder
TGGGCCTGCTTCAGTTGCTCCAGTGCGTCGGCATGCTCCTTATCCTTAGCCTCTGCAGCTACTTGGGCCTGCTTCAGTTGCTCCAGTGCGTCG

>NZ_JVDI01000037|1|1|200879-200971|CRISPRCasFinder
TGGGCCTGCTTCAGTTGCTCCAGTGCGTCG	GCATGCTCCTTATCCTTAGCCTCTGCAGCTACT
TGGGCCTGCTTCAGTTGCTCCAGTGCGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_JVDI01000037.1\|WP_049300004.1\|202294_202732_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049299999.1\|195951_196338_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_043147357.1\|199974_200322_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_043147358.1\|199604_199973_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300002.1\|200416_200794_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300011.1\|209588_209780_+\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300001.1\|198441_199200_-\|Ig-domain-containing-protein	unknown	unknown	gnl\|CDD\|227779
NZ_JVDI01000037.1\|WP_043147348.1\|208038_208482_-\|DUF2280-domain-containing-protein	unknown	unknown	gnl\|CDD\|370794
NZ_JVDI01000037.1\|WP_043147361.1\|197715_198390_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_075205907.1\|196441_196858_-\|type-II-toxin-antitoxin-system-YafO-family-toxin	unknown	unknown	gnl\|CDD\|372840
NZ_JVDI01000037.1\|WP_043147359.1\|199224_199608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300005.1\|202735_204121_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370768
NZ_JVDI01000037.1\|WP_075205906.1\|195606_195939_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300007.1\|205106_206534_-\|DUF1073-domain-containing-protein	unknown	unknown	gnl\|CDD\|368870
NZ_JVDI01000037.1\|WP_049300009.1\|208513_209164_-\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300008.1\|206544_208035_-\|terminase	unknown	unknown	gnl\|CDD\|222858
NZ_JVDI01000037.1\|WP_049300003.1\|201207_202284_-\|phage-coat-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_049300010.1\|209379_209589_+\|hypothetical-protein	unknown	unknown	unknown
NZ_JVDI01000037.1\|WP_152903362.1\|204151_205039_-\|phage-head-morphogenesis-protein	unknown	unknown	gnl\|CDD\|309383
NZ_JVDI01000037.1\|WP_049300000.1\|196858_197437_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_JVDI01000037.1\|WP_043147348.1\|208038_208482_-\|DUF2280-domain-containing-protein	gnl\|CDD\|370794	pfam10045, DUF2280, Uncharacterized conserved protein (DUF2280). Members of this family of hypothetical bacterial proteins have no known function.	5.31638e-57
NZ_JVDI01000037.1\|WP_049300005.1\|202735_204121_-\|hypothetical-protein	gnl\|CDD\|370768	pfam09979, DUF2213, Uncharacterized protein conserved in bacteria (DUF2213). Members of this family of bacterial proteins comprise various hypothetical and phage-related proteins. The exact function of these proteins has not, as yet, been determined.	0.000233237
NZ_JVDI01000037.1\|WP_049300008.1\|206544_208035_-\|terminase	gnl\|CDD\|222858	PHA02533, 17, large terminase protein; Provisional.	5.2376e-05
NZ_JVDI01000037.1\|WP_049300007.1\|205106_206534_-\|DUF1073-domain-containing-protein	gnl\|CDD\|368870	pfam06381, DUF1073, Protein of unknown function (DUF1073). This family consists of several hypothetical bacterial proteins. The function of this family is unknown.	3.2071e-07
NZ_JVDI01000037.1\|WP_049300001.1\|198441_199200_-\|Ig-domain-containing-protein	gnl\|CDD\|227779	COG5492, COG5492, Bacterial surface proteins containing Ig-like domains [Cell motility and secretion].	1.90846e-11
NZ_JVDI01000037.1\|WP_152903362.1\|204151_205039_-\|phage-head-morphogenesis-protein	gnl\|CDD\|309383	pfam04233, Phage_Mu_F, Phage Mu protein F like protein. Members of this family are found in double-stranded DNA bacteriophages, and in some bacteria. A member of this family is required for viral head morphogenesis in bacteriophage SPP1. This family is possibly a minor head protein. This family may be related to the family TT_ORF1 (pfam02956).	1.051e-08
NZ_JVDI01000037.1\|WP_075205907.1\|196441_196858_-\|type-II-toxin-antitoxin-system-YafO-family-toxin	gnl\|CDD\|372840	pfam13957, YafO_toxin, Toxin YafO, type II toxin-antitoxin system. YafO is a toxin which inhibits protein synthesis. It acts as a ribosome-dependent mRNA interferase. It forms part of a type II toxin-antitoxin system, where the YafN protein acts as an antitoxin. This domain forms complexes with yafN antitoxins containing pfam02604.	2.10464e-18

>NZ_JVDI01000037.1|WP_049300002.1|200416_200794_-|hypothetical-protein
MAAQITAAQVKQQLSALGYSIPDFMIDAYLCKLDGIRQCLEASGYDDCDLMLIQVYAVTLMAITAFSQRIKSQSAPSGASRSFDYSGDIKTMRNTLAALDTAGCTAGLPIDVGTSVGFFDVVGGC
>NZ_JVDI01000037.1|WP_043147357.1|199974_200322_-|hypothetical-protein
MSAAANWSYTAVATVWKKLGMDDYGKSSFAEPIQIMCDYGGDATARLGDIGLEFVVKNTHWTEYADARQGDYILIGASSEPDPKKVDGADEVRHIIRYADTFDRIADDYAIITGV
>NZ_JVDI01000037.1|WP_043147358.1|199604_199973_-|hypothetical-protein
MGVKVKGIREAQATLDRLIGDIKGRRVVRAMQSALLIGGTQAALYTPIDTSTLLNSQYRDISVNGSRITGRVGYSANYAVYVHDPNIPQKFRRATAQKEFLTKGFEDTKAQIDRAIKKEMQL
>NZ_JVDI01000037.1|WP_043147359.1|199224_199608_-|hypothetical-protein
MTPAMHRRVRDYFVDAGLTSGFTTQMLRWRDTGKGEDKFIVFRPNGGSPVRNDLASEYLVLVDVIGAEGEDEEVDNAVQAIISHIQNNPMPNDCIGHIENVGGIPSPVSTTEGRLVYRLQFACLYGE
>NZ_JVDI01000037.1|WP_049300001.1|198441_199200_-|Ig-domain-containing-protein
MQGCSTDNSKLFGRGIVLEVALGCPDTVPAESEWQSLIAGTSKGFDFSPNTVTSDADDTKGYVENLVTNSDFTLSFEGEVRKRDKLDQFGVAKFVKYYNDEIQAGRQPTLWVREEYGPITFTGYMVITALSSDGGTNDIVTLSTEFKVADSDTIQVIDTPVDIPVTGITLTPTSGTVAAGATTTFNVVFAPANATDQSFTLVSSVPARATATANGLVVTVSAPSGATAGVANITAKTNDGNFTAVYAATVTA
>NZ_JVDI01000037.1|WP_043147361.1|197715_198390_-|hypothetical-protein
MTPLTEIGEMLISDASRDYFFRPSFGNMSRIGSPAEIVERFAELHTSEAPRLLSAAVAAYGEIPGWLLAYINSPSFSSSAIFAGMIVMQACCDDDISALVGELRPSKRGKRAFVFRRGSLPASDIIILGQSLITHGIIGKAKVRRLQRHETNSFVSEFSAFEYISAARNHFSMPRAEAEQLTMTEFQLLINAKYPDQKGFTAEEYDAVADEYMKKKARRQAKAA
>NZ_JVDI01000037.1|WP_049300000.1|196858_197437_-|hypothetical-protein
MILSITAMAAAFAPLLTEAQAEVHGAFKPLVSSECKKTVALSAVDAFQRCQQVQQHANKLQKIAEEGMEHLASVRDGSADARDFPAGYDATLDTLAVAATNCINLTRDMFETAESSAAWSGNYAMLKPVKKQMMRSLALLRSSASQIATEIRQANTVVDNGRLLADNTSNEDVVRLINKSHMMLGVDTPRWS
>NZ_JVDI01000037.1|WP_075205907.1|196441_196858_-|type-II-toxin-antitoxin-system-YafO-family-toxin
MIKVSITAELSDDETARHFAQMVARCLSNLPASPLLGCRGGFERNPNAMAAGIEKFHVRMPDEEAWPSHTPINRRTSNNFLVFARHFYDDNYFQILALVTPEAHQRIDAMLPRLIDLAENTFIEISERELDKLEHFTI
>NZ_JVDI01000037.1|WP_049299999.1|195951_196338_-|hypothetical-protein
MTEEEWLDGLRHLSPNMIIKTHFALQEKIKKHYKLRGTGKNLDKAIQLCIQQIALAPLTAEAMRKKHEDQWEELNALKRRHGLSERTWPFVLPAHHGYRQYAVILRRQKDFDKLAKIEAKRKLEGWAG
>NZ_JVDI01000037.1|WP_075205906.1|195606_195939_-|hypothetical-protein
MKKTLFLLALFVSPLAMSAEYKISIPTDSKAVYTVLGKGERDGLKTIITKREGSSGVSYSERAYDCVNRTVKYLGDGETLEQMKLSRADPNMSDIVPQSIADYVGNEACK
>NZ_JVDI01000037.1|WP_049300003.1|201207_202284_-|phage-coat-protein
MFYFSTKKATETRNLEANMSQFNELKLARNASAQAVADFIARTRVRGDAANAPALDAVNAVDDIKRLYRAYDQTVLAEFEPNTEFTLLNDLMPLSRSVRLEESVYEYARKGGRGWAHTSMSGQIGAALDAKSYTFDGTMVPIHDSGFKFNWRDPVFNKGSALSSLADAQAGSVDDVRRQYVDYIWEGFRDAAGNFIKFDDKTWKGLRHDERVAQVTLTINFATSTDPKAMRAAAIALRDVLKLQNYQYGQQTWYVSSEIMSNWEQYFDVNALRTVLEELKKLSGISDIKEDAELTGNEIVIIPLAAGVIAPVVGQAFGTVADPRQFYNSDYVWRTWGAAGLMVKQDINGHFSVIHASD
>NZ_JVDI01000037.1|WP_049300004.1|202294_202732_-|hypothetical-protein
MAKDGKHVIHAGGIFANPQLHREGAAAADTPPGTIGFFDNTTKKFTASVDGNEAAILYVANYDYLRCKTVDDVIKADDWVVTFHPTPGVFFNVPSAAGTYTKGQPLSIVNGRVKAAAEGESVRAYVEEDRAYTTAAGELLRVVIK
>NZ_JVDI01000037.1|WP_049300005.1|202735_204121_-|hypothetical-protein
MKRNRVNVLTVVNSASNITTETIDGKPHIVVRGITPVVDDIVMNRKLYPAAEIAKAYNTLERKPMPLGHPKIDGKHVSAGDVRAVNNYHVGAWLQDVQHVDGKVNGDMYVDRRYAEGSEKGKRLVNRLDEMIAGTNVEPIHISTGLLYSGIAANGESKGKKYNEIATNMVFDHVAVLLDEPGAGTPSEGVGIFVNADGDDQEVEIANLSEGVDCTREGLLNKTKFFFTNASNFSFDDIREAISNKLREGRSDDYWPWPESIWPDTFIYRDKTKFFRQKYLIDEDGKAVFVGEPVEVVRKPTEYEIKTNGEKDPMKELIINALQAAGKPTEGKSDAELMDAYNQLAAEKATAQKEGGEEIDPATGKPKKKEQASNSDEAPAWFKPFADDLAAVKSGLIANSDKEKGEMRAAVKAKFGMSDVAVNALDGDPLKELFAQCSTSIGLNGMLRQVNSSQTFSEMPE
>NZ_JVDI01000037.1|WP_152903362.1|204151_205039_-|phage-head-morphogenesis-protein
MFRDIESRYLGIKTTLRQLFDQRFTGRVLVGNSQRSHVLSGDTLYQVNAGTFVYDMNAQQLAALLEVIQTILDDYLLEGNGQDIWALQYISDEYRRGTLNAYTNLSAQSEVYASQTTLSALLSTPAYQNQVAAAFVSTYSDWKGVSDAVRADLANIIADAVGRGVNPRETMRVISKRLDVSMSKAKTIAQTEQVGALREAQWNETTWVQDRLGLRTKLLHLSALKPTTRAWHASRHGKLYTVEEVREWYSKDGNRFNCYCSQIPAVVDEKDNVVNIGLAKRLEEERAAWMTQQAA
>NZ_JVDI01000037.1|WP_049300007.1|205106_206534_-|DUF1073-domain-containing-protein
MSEQNSEVEFLVNALADAVAIGRQRSLYAGQMNGNTKRTKLWDEFGYPDTISFDLLYRAYRRNSAAHAGVHKTLDNCWSDYPTIIDGPLADKSTVSTEWEKTVTRLLKKHWSKIKDADRRNLVGRYSAIILQIKDSRPWSEPVDTALVERLGEDALVKMIPVWESQIKPGNYDIDTLSPTYGQPVNYIFNEQPVGDDGTYGNVRSVTVHPSRVIILAEGSEDDNMLSGIPLNEAGYNDLLDIEKTKGGSAEGFLKNASRQLGIHFDDKTDMKTIAQQAKDAGYKDLGEAMNEKIRKLNQGTDSALVTQSGTSSVLSVAAADPTPSWTVSANSYASTIGCPFNILFGKQTGNLASTEDRKEWAKKGNGRRGGWLSWLLTEVIQRWCDVGVVSQPTKGEITVDWSDLLAPGDSEKLENMSKMADVAYKTQQAFGASAVEPNEVRAAGELEPIEEPRQPDPTKKQVGKDPLNDESAET
>NZ_JVDI01000037.1|WP_049300008.1|206544_208035_-|terminase
MADLNKQFSELKKNLKNRFWRLNNLYFITDKSGKKVKFRMTPEQLEYFEGVHTRNIILKARQLGFTTLVCIVQLDAALFESAKCALIAHTLNDAKRLFREKVKYAYDNLPALIRKANPAKNDAVGELVFNNGGSLYVSTSFRGGTLRYLHVSEFGKICAKYPDKAREIVTGAFEAVSTDCFTTIESTAEGRAGYFFDYCQTAEKAQLQGKTLSNLDWKFFFFTWWKNPQYAIDPVESLPERLVDYFNELEAKHGVTLNERQKAWYLAKEKTLGDDMKREYPSIPAEAFQQSVEGAYYAKQFRWLYTNKRIGSLPDNSHLPVHTFWDIGVGDSTAIWFIREVGEEFHVIDYYENSGEGLRHYMKVLKDRGYEYGEHWGPHDIENREFGSDAKSRKELAREGYEIDGQVYSMTFKVVPKVGVDTGIESVREILPKCVFDDEKCAEGISHLEGYRKEWDDKRGCWKDKPLHDHTSHGSDGFRYFAVAKNNHKQVGAVFF
>NZ_JVDI01000037.1|WP_043147348.1|208038_208482_-|DUF2280-domain-containing-protein
MAALKPDVKAFIIQSLACFDTPTLVVESVQKEFGLKITRQQVESHDPTKVSGKSLAKKWVDLFHTTRERFKTEISDIPIANKAYRLRVLDRMATRTETMKNYALAAQIVEQAAKECGDAYTNKQKIETQHTIADEMAELLKEISSEA
>NZ_JVDI01000037.1|WP_049300009.1|208513_209164_-|hypothetical-protein
MAKTAQDENHDRRPYPPLRFIEDHQLTPYIGLVPANEVQEWMQRQIIDAAGSLFNPDHGHLADADLRFMWASSPFEKKGRHVLGQAEEVAMRAGGWQKARMEQQMHEWFGDVPKFIITLAADYCSQCSDAEFCALVEHELYHIAQATDDFGAPKFNKEGQPVLKLRGHDVEEFVGVVRRYGASVEVQELVEAANRPAEVAQLNIARACGNCMLRLA
>NZ_JVDI01000037.1|WP_049300010.1|209379_209589_+|hypothetical-protein
MTTIKAAYISKDQNWNDGTTTYWFDVNGETFGVVHGGESWNAKVVDCDGAPSDQYTVDQFNITEDMIAE
>NZ_JVDI01000037.1|WP_049300011.1|209588_209780_+|hypothetical-protein
MTLTDYIAAYFGGNKSAFARHMAVNPQQVTKWVADGWIVDNHTLYSPRRTVPENVSGGGSAEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_JVDI01000037_1	1.1\|200909\|33\|NZ_JVDI01000037\|CRISPRCasFinder	200909-200941	33	NC_048106	Synechococcus phage S-CBWM1, complete genome	63486-63518	8	0.758

1. spacer 1.1|200909|33|NZ_JVDI01000037|CRISPRCasFinder matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 8, identity: 0.758

gcatgctccttatccttagcctctgcagctact	CRISPR spacer
tcgtcctccttacccttagcctctgcggcgata	Protospacer
 *.* *******.*************.** *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

132225 : 139334

Mycoplasma_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025303913.1\|132225_133521_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.7e-34	37.1
WP_006327336.1\|133743_133944_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_004941417.1\|133976_134312_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_049299979.1\|134314_136165_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.6e-102	40.3
WP_043138098.1\|136197_136719_-	co-chaperone HscB	NA	NA	NA	NA
WP_004941410.1\|136781_137105_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.2e-21	46.7
WP_004941408.1\|137159_137546_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.2e-54	79.7
WP_016929764.1\|137570_138785_-	cysteine desulfurase	H7BUW1	unidentified_phage	1.6e-34	39.0
WP_004941404.1\|138839_139334_-	Fe-S cluster assembly transcriptional regulator IscR	M4M9K8	Vibrio_phage	7.0e-05	28.4

DBSCAN-SWA_2

186196 : 226999

Cronobacter_phage(36.36%)

head,integrase,holin,terminase,coat

attL 177480:177495|attR 231578:231593

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
177480:177495	attL	NA	NA	NA	NA
WP_152903360.1\|186196_188530_-	hypothetical protein	A0A2D1GNM3	Pseudomonas_phage	9.3e-31	27.5
WP_049299994.1\|188598_191076_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	6.3e-195	44.9
WP_009483962.1\|191062_191458_-	C40 family peptidase	F1C5F2	Cronobacter_phage	2.1e-36	54.8
WP_049299995.1\|191454_191925_-	hypothetical protein	R9TPR6	Aeromonas_phage	7.3e-28	41.0
WP_049299996.1\|191924_192401_-	hypothetical protein	F1C5F0	Cronobacter_phage	1.1e-42	55.6
WP_049299997.1\|192509_192674_+	hypothetical protein	NA	NA	NA	NA
WP_161801400.1\|192676_192844_-	hypothetical protein	NA	NA	NA	NA
WP_049299998.1\|192883_195541_-	tape measure protein	A0A291AXC6	Shigella_phage	5.9e-106	43.8
WP_075205906.1\|195606_195939_-	hypothetical protein	A0A222YZ97	Escherichia_phage	3.3e-27	58.2
WP_049299999.1\|195951_196338_-	hypothetical protein	NA	NA	NA	NA
WP_075205907.1\|196441_196858_-	type II toxin-antitoxin system YafO family toxin	A5VW62	Enterobacteria_phage	2.9e-20	37.9
WP_049300000.1\|196858_197437_-	hypothetical protein	NA	NA	NA	NA
WP_043147361.1\|197715_198390_-	hypothetical protein	G0ZNE7	Cronobacter_phage	3.3e-66	56.2
WP_049300001.1\|198441_199200_-	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	6.4e-82	73.0
WP_043147359.1\|199224_199608_-	hypothetical protein	G0ZNE4	Cronobacter_phage	5.4e-45	64.6
WP_043147358.1\|199604_199973_-	hypothetical protein	F1C5E3	Cronobacter_phage	1.8e-45	73.8
WP_043147357.1\|199974_200322_-	hypothetical protein	G0ZNE2	Cronobacter_phage	3.4e-30	60.3
WP_049300002.1\|200416_200794_-	hypothetical protein	F1C5E2	Cronobacter_phage	7.1e-50	80.2
WP_043147355.1\|200796_201198_-	hypothetical protein	NA	NA	NA	NA
WP_049300003.1\|201207_202284_-\|coat	phage coat protein	F1C5E1	Cronobacter_phage	1.4e-154	74.9
WP_049300004.1\|202294_202732_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.3e-42	64.1
WP_049300005.1\|202735_204121_-	hypothetical protein	F1C5D9	Cronobacter_phage	1.4e-156	60.6
WP_152903362.1\|204151_205039_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	2.8e-105	64.3
WP_049300007.1\|205106_206534_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	9.0e-170	64.5
WP_049300008.1\|206544_208035_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	1.3e-240	80.7
WP_043147348.1\|208038_208482_-	DUF2280 domain-containing protein	I6S1P9	Salmonella_phage	7.1e-49	72.4
WP_049300009.1\|208513_209164_-	hypothetical protein	I6S676	Salmonella_phage	1.9e-87	73.3
WP_049300010.1\|209379_209589_+	hypothetical protein	NA	NA	NA	NA
WP_049300011.1\|209588_209780_+	hypothetical protein	NA	NA	NA	NA
WP_049300012.1\|209832_210030_-	hypothetical protein	NA	NA	NA	NA
WP_049300013.1\|210147_210681_-	hypothetical protein	K7PHH7	Enterobacteria_phage	8.0e-31	49.0
WP_049300014.1\|210677_211118_-	lysozyme	A0A0M4R365	Salmonella_phage	5.0e-47	67.1
WP_049193441.1\|211104_211422_-\|holin	phage holin family protein	F1C5D1	Cronobacter_phage	5.1e-41	82.8
WP_049300015.1\|211685_212519_-	antitermination protein	K7PKS8	Enterobacteria_phage	1.2e-78	56.2
WP_049300016.1\|212515_212872_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	1.1e-44	71.2
WP_049300017.1\|212868_213843_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.0e-59	37.7
WP_193390227.1\|213842_214913_-	hypothetical protein	A0A1C9IHW0	Salmonella_phage	2.4e-34	55.3
WP_065426409.1\|214921_215098_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_049300044.1\|215100_215745_-	phage antirepressor KilAC domain-containing protein	A0A2I7RHG4	Vibrio_phage	1.1e-47	50.2
WP_161801401.1\|215932_216073_-	hypothetical protein	NA	NA	NA	NA
WP_049300019.1\|216081_216375_-	hypothetical protein	I6PCV6	Cronobacter_phage	2.1e-09	43.8
WP_071845069.1\|216430_216652_-	hypothetical protein	A0A088CE43	Shigella_phage	3.1e-21	68.1
WP_049300020.1\|216736_217510_+	hypothetical protein	A0A088CBP2	Shigella_phage	7.0e-84	58.2
WP_049300021.1\|218038_218521_+	hypothetical protein	NA	NA	NA	NA
WP_049300022.1\|218564_218939_+	hypothetical protein	A0A192YAH3	Morganella_phage	3.6e-46	70.1
WP_161801402.1\|219548_219692_+	hypothetical protein	NA	NA	NA	NA
WP_049300023.1\|219695_220535_+	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	4.0e-77	57.8
WP_053090362.1\|220518_220983_+	hypothetical protein	A0A222YY85	Escherichia_phage	1.2e-14	59.5
WP_049300024.1\|221158_221908_+	hypothetical protein	Q5QF30	Pseudomonas_virus	8.6e-63	52.5
WP_193390228.1\|221900_222101_+	stationary-phase-induced ribosome-associated protein	NA	NA	NA	NA
WP_049300025.1\|222097_222307_+	hypothetical protein	A0A220NQV0	Salmonella_phage	1.0e-10	52.0
WP_049300026.1\|222306_222813_+	hypothetical protein	NA	NA	NA	NA
WP_049300027.1\|222813_223071_+	hypothetical protein	A0A220NQU8	Salmonella_phage	1.2e-19	52.9
WP_080353564.1\|223152_223785_+	DUF551 domain-containing protein	K7P7E4	Enterobacteria_phage	2.0e-28	56.4
WP_049300028.1\|223774_224089_+	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	1.7e-25	64.7
WP_049300029.1\|224066_224285_+	hypothetical protein	NA	NA	NA	NA
WP_075205909.1\|224509_224704_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_049300030.1\|224700_225363_+	DNA methyltransferase	G8C7S6	Escherichia_phage	1.4e-88	74.4
WP_072265286.1\|225519_225792_+	excisionase Xis	H6WRW8	Salmonella_phage	4.4e-17	48.9
WP_049300047.1\|225769_226999_-\|integrase	site-specific integrase	H6WRW7	Salmonella_phage	9.1e-179	67.7
231578:231593	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_JVDI01000037.1|WP_049300010.1|209379_209589_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_JVDI01000037.1|WP_049300009.1|208513_209164_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_JVDI01000037.1|WP_049300010.1|209379_209589_+|hypothetical-protein

209379_209589_+

69 aa aa

AcrIF18.1

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3648\|WP_049300010.1\|AcrIF18.1\|I-F/I-E\|Verified\|Serratia-marcescens	1.0	1	1.0

NZ_JVDI01000037.1_209588_209780_+

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_JVDI01000037.1_209588_209780_+	WP_074032234.1	0.6	0.9682539682539683	0.8333333333333334

186196-226999

NZ_JVDI01000037.1|WP_049300009.1|208513_209164_-|hypothetical-protein

208513_209164_-

216 aa aa

NZ_JVDI01000037.1_209588_209780_+

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_JVDI01000037.1_209588_209780_+	WP_074032234.1	0.6	0.9682539682539683	0.8333333333333334

186196-226999

7. NZ_JVDI01000033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

142682 : 150527

Acanthocystis_turfacea_Chlorella_virus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033640923.1\|142682_143663_+	nitrilase family protein	M1HUK8	Acanthocystis_turfacea_Chlorella_virus	1.7e-10	29.5
WP_004939201.1\|143753_144272_-	outer membrane protein OmpX	A0A1B0VBR9	Salmonella_phage	1.1e-19	40.3
WP_004939202.1\|144672_145560_+	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_016928512.1\|145692_146160_+	YhcH/YjgK/YiaL family protein	NA	NA	NA	NA
WP_049299851.1\|146141_146693_-	(d)CMP kinase	A0A097BYE2	Leuconostoc_phage	1.3e-12	27.8
WP_016928514.1\|147050_147554_+	DNA starvation/stationary phase protection protein Dps	A0A222YTY5	Streptomyces_phage	8.1e-09	31.7
WP_016928515.1\|147696_147963_+	DksA/TraR family C4-type zinc finger protein	K4F9U1	Cronobacter_phage	3.0e-18	54.5
WP_019454486.1\|148302_149046_+	glutamine ABC transporter substrate-binding protein GlnH	E3T502	Cafeteria_roenbergensis_virus	9.9e-11	27.3
WP_004939229.1\|149148_149808_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_004939230.1\|149804_150527_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	1.5e-35	43.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_JVDI01000079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

58158 : 97493

Enterobacteria_phage(30.77%)

portal,integrase,head,tail,plate,terminase,capsid

attL 62402:62421|attR 98527:98546

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016928188.1\|58158_58797_+	dTMP kinase	W8D0J5	Erwinia_phage	2.8e-22	37.2
WP_033640744.1\|58796_59804_+	DNA polymerase III subunit delta'	A0A1U9WR94	Streptococcus_virus	4.9e-05	38.4
WP_049300576.1\|59823_60600_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_016928184.1\|60942_62376_+	PTS glucose transporter subunit IIBC	A0A2I7SAJ6	Vibrio_phage	1.8e-08	33.9
62402:62421	attL	NA	NA	NA	NA
WP_072062302.1\|62552_62801_-	ogr/Delta-like zinc finger family protein	A0A2I8TV89	Erwinia_phage	6.8e-09	46.7
WP_049300621.1\|62846_64001_-	phage late control D family protein	B9A7A9	Serratia_phage	2.9e-211	97.9
WP_049300577.1\|64152_65334_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7NV69	Enterobacteria_phage	2.1e-156	69.6
WP_048233361.1\|65334_65850_+\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	1.5e-53	62.4
WP_048233363.1\|65906_66206_+\|tail	tail protein	B9A7B2	Serratia_phage	1.5e-42	93.9
WP_072055827.1\|66214_66379_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	3.7e-11	62.2
WP_049300578.1\|66368_69323_+\|tail	phage tail tape measure protein	B9A7B3	Serratia_phage	5.8e-296	99.5
WP_049300579.1\|69337_69829_+\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	6.2e-54	61.7
WP_152903374.1\|69922_71011_-\|tail	phage tail protein	A0A1S6KZZ8	Salmonella_phage	2.7e-33	47.0
WP_049300581.1\|71017_71929_-	hypothetical protein	NA	NA	NA	NA
WP_049300582.1\|71925_74262_-	hypothetical protein	A0A2D1GNM3	Pseudomonas_phage	2.7e-38	26.0
WP_049300583.1\|74254_74869_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.6e-43	48.8
WP_049300584.1\|74861_75761_-\|plate	baseplate J/gp47 family protein	A0A0A7NPY5	Enterobacteria_phage	7.8e-95	62.9
WP_049300585.1\|75747_76116_-	GPW/gp25 family protein	A0A0A7NQ90	Enterobacteria_phage	2.8e-27	53.0
WP_049300586.1\|76112_76697_-\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	2.5e-62	62.1
WP_049300587.1\|76696_77335_-	phage virion morphogenesis protein	A0A0M4RCU1	Salmonella_phage	2.8e-46	49.3
WP_049200214.1\|77331_77793_-\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	1.4e-34	51.3
WP_193390236.1\|77789_78101_-	peptidase	Q8SBD8	Shigella_phage	4.3e-08	48.1
WP_193390237.1\|78314_78809_-	glycoside hydrolase family protein	A0A0M3LPQ1	Mannheimia_phage	3.3e-31	42.1
WP_049300589.1\|78865_79147_-	hypothetical protein	B9A7B8	Serratia_phage	8.2e-35	100.0
WP_033640714.1\|79137_79338_-\|tail	tail protein X	A0A0A7NV57	Enterobacteria_phage	6.1e-16	63.1
WP_049300590.1\|79337_79835_-\|head	head completion/stabilization protein	B9A7B7	Serratia_phage	1.2e-84	96.4
WP_049300591.1\|79938_80808_-\|terminase	terminase	B9A7B6	Serratia_phage	7.5e-119	96.5
WP_049300592.1\|80852_81899_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	2.5e-108	55.8
WP_049300593.1\|81938_82772_-\|capsid	GPO family capsid scaffolding protein	B9A7B4	Serratia_phage	2.8e-123	83.8
WP_049300594.1\|82931_84653_+	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	5.8e-224	64.6
WP_049300595.1\|84654_85710_+\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	9.0e-143	67.5
WP_049300596.1\|86122_87484_+	hypothetical protein	R9TRQ8	Vibrio_phage	7.8e-22	29.7
WP_049300597.1\|87975_88671_-	DNA adenine methylase	A0A0M4S5U3	Salmonella_phage	9.4e-72	60.0
WP_049300598.1\|88791_91332_-	replication endonuclease	A0A0A7NQ77	Enterobacteria_phage	2.1e-193	46.1
WP_049300599.1\|91328_92333_-	phosphoadenosine phosphosulfate reductase family protein	B7SYG0	Stenotrophomonas_phage	1.5e-62	41.4
WP_049300600.1\|92371_92635_-	DUF3850 domain-containing protein	Q7Y4B7	Escherichia_virus	1.6e-11	44.4
WP_049300601.1\|92628_93450_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S6L011	Salmonella_phage	2.9e-64	48.9
WP_049300602.1\|93453_93672_-	TraR/DksA family transcriptional regulator	Q6K1F5	Salmonella_virus	1.1e-13	54.2
WP_152903375.1\|93664_94219_-	hypothetical protein	NA	NA	NA	NA
WP_049300604.1\|94378_94576_-	hypothetical protein	NA	NA	NA	NA
WP_049300605.1\|94650_94959_-	hypothetical protein	NA	NA	NA	NA
WP_049300606.1\|95062_95326_-	hypothetical protein	NA	NA	NA	NA
WP_049300607.1\|95322_95571_-	hypothetical protein	NA	NA	NA	NA
WP_049300608.1\|95567_95780_-	DUF4761 family protein	A0A0M5M1I3	Salmonella_phage	1.7e-16	70.9
WP_049300609.1\|95791_96061_-	hypothetical protein	NA	NA	NA	NA
WP_049300610.1\|96148_96448_+	helix-turn-helix domain-containing protein	Q1JS45	Enterobacteria_phage	1.2e-20	49.5
WP_049300611.1\|96512_97493_+\|integrase	tyrosine-type recombinase/integrase	A0A0F7LA05	Escherichia_phage	1.8e-89	50.8
98527:98546	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage