CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LODH01000045	Pseudomonas aeruginosa strain 105777 LT17_contig000045, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000078	Pseudomonas aeruginosa strain 105777 LT17_contig000079, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000004	Pseudomonas aeruginosa strain 105777 LT17_contig000004, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000087	Pseudomonas aeruginosa strain 105777 LT17_contig000088, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000075	Pseudomonas aeruginosa strain 105777 LT17_contig000076, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000032	Pseudomonas aeruginosa strain 105777 LT17_contig000032, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000031	Pseudomonas aeruginosa strain 105777 LT17_contig000031, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000038	Pseudomonas aeruginosa strain 105777 LT17_contig000038, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000042	Pseudomonas aeruginosa strain 105777 LT17_contig000042, whole genome shotgun sequence	0 crisprs	WYL	0	0	0	0
NZ_LODH01000054	Pseudomonas aeruginosa strain 105777 LT17_contig000054, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_LODH01000065	Pseudomonas aeruginosa strain 105777 LT17_contig000066, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000066	Pseudomonas aeruginosa strain 105777 LT17_contig000067, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000029	Pseudomonas aeruginosa strain 105777 LT17_contig000029, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000005	Pseudomonas aeruginosa strain 105777 LT17_contig000005, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000084	Pseudomonas aeruginosa strain 105777 LT17_contig000085, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000074	Pseudomonas aeruginosa strain 105777 LT17_contig000075, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000086	Pseudomonas aeruginosa strain 105777 LT17_contig000087, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000023	Pseudomonas aeruginosa strain 105777 LT17_contig000023, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000019	Pseudomonas aeruginosa strain 105777 LT17_contig000019, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000085	Pseudomonas aeruginosa strain 105777 LT17_contig000086, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000079	Pseudomonas aeruginosa strain 105777 LT17_contig000080, whole genome shotgun sequence	0 crisprs	NA	0	0	1	1
NZ_LODH01000097	Pseudomonas aeruginosa strain 105777 LT17_contig000098, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000001	Pseudomonas aeruginosa strain 105777 LT17_contig000001, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000072	Pseudomonas aeruginosa strain 105777 LT17_contig000073, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000055	Pseudomonas aeruginosa strain 105777 LT17_contig000056, whole genome shotgun sequence	0 crisprs	RT,csa3	0	0	1	0
NZ_LODH01000017	Pseudomonas aeruginosa strain 105777 LT17_contig000017, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000070	Pseudomonas aeruginosa strain 105777 LT17_contig000071, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000018	Pseudomonas aeruginosa strain 105777 LT17_contig000018, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	1	0
NZ_LODH01000060	Pseudomonas aeruginosa strain 105777 LT17_contig000061, whole genome shotgun sequence	0 crisprs	WYL	0	0	0	0
NZ_LODH01000039	Pseudomonas aeruginosa strain 105777 LT17_contig000039, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000024	Pseudomonas aeruginosa strain 105777 LT17_contig000024, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000094	Pseudomonas aeruginosa strain 105777 LT17_contig000095, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000077	Pseudomonas aeruginosa strain 105777 LT17_contig000078, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000008	Pseudomonas aeruginosa strain 105777 LT17_contig000008, whole genome shotgun sequence	1 crisprs	NA	5	0	0	0
NZ_LODH01000089	Pseudomonas aeruginosa strain 105777 LT17_contig000090, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000047	Pseudomonas aeruginosa strain 105777 LT17_contig000047, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000036	Pseudomonas aeruginosa strain 105777 LT17_contig000036, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_LODH01000012	Pseudomonas aeruginosa strain 105777 LT17_contig000012, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_LODH01000105	Pseudomonas aeruginosa strain 105777 LT17_contig000106, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000076	Pseudomonas aeruginosa strain 105777 LT17_contig000077, whole genome shotgun sequence	1 crisprs	NA	0	2	0	0
NZ_LODH01000082	Pseudomonas aeruginosa strain 105777 LT17_contig000083, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000081	Pseudomonas aeruginosa strain 105777 LT17_contig000082, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000080	Pseudomonas aeruginosa strain 105777 LT17_contig000081, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000091	Pseudomonas aeruginosa strain 105777 LT17_contig000092, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000100	Pseudomonas aeruginosa strain 105777 LT17_contig000101, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000090	Pseudomonas aeruginosa strain 105777 LT17_contig000091, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000014	Pseudomonas aeruginosa strain 105777 LT17_contig000014, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000053	Pseudomonas aeruginosa strain 105777 LT17_contig000053, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	1	0
NZ_LODH01000010	Pseudomonas aeruginosa strain 105777 LT17_contig000010, whole genome shotgun sequence	0 crisprs	NA	0	0	2	0
NZ_LODH01000020	Pseudomonas aeruginosa strain 105777 LT17_contig000020, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000064	Pseudomonas aeruginosa strain 105777 LT17_contig000065, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000058	Pseudomonas aeruginosa strain 105777 LT17_contig000059, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000026	Pseudomonas aeruginosa strain 105777 LT17_contig000026, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000063	Pseudomonas aeruginosa strain 105777 LT17_contig000064, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000099	Pseudomonas aeruginosa strain 105777 LT17_contig000100, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000044	Pseudomonas aeruginosa strain 105777 LT17_contig000044, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000048	Pseudomonas aeruginosa strain 105777 LT17_contig000048, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000028	Pseudomonas aeruginosa strain 105777 LT17_contig000028, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000069	Pseudomonas aeruginosa strain 105777 LT17_contig000070, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000062	Pseudomonas aeruginosa strain 105777 LT17_contig000063, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000088	Pseudomonas aeruginosa strain 105777 LT17_contig000089, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_LODH01000096	Pseudomonas aeruginosa strain 105777 LT17_contig000097, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000009	Pseudomonas aeruginosa strain 105777 LT17_contig000009, whole genome shotgun sequence	0 crisprs	DEDDh,DinG	0	0	0	0
NZ_LODH01000043	Pseudomonas aeruginosa strain 105777 LT17_contig000043, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000061	Pseudomonas aeruginosa strain 105777 LT17_contig000062, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000022	Pseudomonas aeruginosa strain 105777 LT17_contig000022, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000092	Pseudomonas aeruginosa strain 105777 LT17_contig000093, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000083	Pseudomonas aeruginosa strain 105777 LT17_contig000084, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000033	Pseudomonas aeruginosa strain 105777 LT17_contig000033, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000104	Pseudomonas aeruginosa strain 105777 LT17_contig000105, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000003	Pseudomonas aeruginosa strain 105777 LT17_contig000003, whole genome shotgun sequence	0 crisprs	NA	0	0	1	0
NZ_LODH01000059	Pseudomonas aeruginosa strain 105777 LT17_contig000060, whole genome shotgun sequence	1 crisprs	NA	0	1	1	0
NZ_LODH01000068	Pseudomonas aeruginosa strain 105777 LT17_contig000069, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000101	Pseudomonas aeruginosa strain 105777 LT17_contig000102, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000006	Pseudomonas aeruginosa strain 105777 LT17_contig000006, whole genome shotgun sequence	0 crisprs	WYL	0	0	0	0
NZ_LODH01000021	Pseudomonas aeruginosa strain 105777 LT17_contig000021, whole genome shotgun sequence	0 crisprs	RT	0	0	0	0
NZ_LODH01000057	Pseudomonas aeruginosa strain 105777 LT17_contig000058, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000041	Pseudomonas aeruginosa strain 105777 LT17_contig000041, whole genome shotgun sequence	0 crisprs	NA	0	0	1	1
NZ_LODH01000093	Pseudomonas aeruginosa strain 105777 LT17_contig000094, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000056	Pseudomonas aeruginosa strain 105777 LT17_contig000057, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000103	Pseudomonas aeruginosa strain 105777 LT17_contig000104, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000049	Pseudomonas aeruginosa strain 105777 LT17_contig000049, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000007	Pseudomonas aeruginosa strain 105777 LT17_contig000007, whole genome shotgun sequence	0 crisprs	DinG	0	0	0	0
NZ_LODH01000102	Pseudomonas aeruginosa strain 105777 LT17_contig000103, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000073	Pseudomonas aeruginosa strain 105777 LT17_contig000074, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000025	Pseudomonas aeruginosa strain 105777 LT17_contig000025, whole genome shotgun sequence	1 crisprs	DEDDh,cas3	1	3	0	0
NZ_LODH01000027	Pseudomonas aeruginosa strain 105777 LT17_contig000027, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000071	Pseudomonas aeruginosa strain 105777 LT17_contig000072, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000046	Pseudomonas aeruginosa strain 105777 LT17_contig000046, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000050	Pseudomonas aeruginosa strain 105777 LT17_contig000050, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000034	Pseudomonas aeruginosa strain 105777 LT17_contig000034, whole genome shotgun sequence	0 crisprs	csa3	0	0	0	0
NZ_LODH01000015	Pseudomonas aeruginosa strain 105777 LT17_contig000015, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000030	Pseudomonas aeruginosa strain 105777 LT17_contig000030, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000040	Pseudomonas aeruginosa strain 105777 LT17_contig000040, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000016	Pseudomonas aeruginosa strain 105777 LT17_contig000016, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000051	Pseudomonas aeruginosa strain 105777 LT17_contig000051, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000002	Pseudomonas aeruginosa strain 105777 LT17_contig000002, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000011	Pseudomonas aeruginosa strain 105777 LT17_contig000011, whole genome shotgun sequence	0 crisprs	cas3,WYL	0	0	1	0
NZ_LODH01000013	Pseudomonas aeruginosa strain 105777 LT17_contig000013, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0	0
NZ_LODH01000095	Pseudomonas aeruginosa strain 105777 LT17_contig000096, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000037	Pseudomonas aeruginosa strain 105777 LT17_contig000037, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000067	Pseudomonas aeruginosa strain 105777 LT17_contig000068, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000052	Pseudomonas aeruginosa strain 105777 LT17_contig000052, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000098	Pseudomonas aeruginosa strain 105777 LT17_contig000099, whole genome shotgun sequence	0 crisprs	NA	0	0	0	0
NZ_LODH01000035	Pseudomonas aeruginosa strain 105777 LT17_contig000035, whole genome shotgun sequence	0 crisprs	NA	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

122 : 36820

uncultured_Caudovirales_phage(25.0%)

plate,tail,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061363335.1\|122_1325_-\|tRNA	tyrosine--tRNA ligase	A0A1S6UA79	Serratia_phage	4.2e-27	28.5
WP_079761888.1\|1609_2953_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	6.1e-19	45.3
WP_061363337.1\|2955_4047_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_003085254.1\|4100_4451_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	3.0e-26	53.2
WP_003142819.1\|4528_4951_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_003085249.1\|4951_5671_-	hypothetical protein	NA	NA	NA	NA
WP_003101649.1\|5670_6705_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_003142818.1\|6995_7418_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_003117983.1\|7434_8403_+	nitronate monooxygenase	NA	NA	NA	NA
WP_003459458.1\|8524_9601_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_010793480.1\|9661_10462_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	2.7e-06	24.5
WP_003101642.1\|10501_11983_-	AAA family ATPase	U5XJW0	Phormidium_phage	6.7e-67	33.5
WP_003085225.1\|12061_12400_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_003085224.1\|12499_13147_+	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_003101641.1\|13201_13996_-	adenosylmethionine decarboxylase	NA	NA	NA	NA
WP_003085219.1\|14315_14738_-	OsmC family protein	NA	NA	NA	NA
WP_003085214.1\|15009_15654_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_003085205.1\|15715_16552_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9
WP_003085203.1\|16548_17598_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003101640.1\|17599_18205_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.0e-75	65.8
WP_031800321.1\|18552_18810_-	hypothetical protein	A0A125RNP3	Pseudomonas_phage	1.1e-17	63.4
WP_004355109.1\|18806_19169_-	hypothetical protein	J7HXL1	Pseudomonas_phage	5.9e-09	38.7
WP_061363338.1\|19165_19795_-	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	7.1e-87	78.0
WP_061363339.1\|19827_20817_-	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.1e-105	55.5
WP_003101635.1\|20874_21081_-	hypothetical protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_023464273.1\|21055_21928_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.5e-74	51.7
WP_061363340.1\|21937_24175_-	hypothetical protein	NA	NA	NA	NA
WP_003085178.1\|24344_24689_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	3.8e-18	46.7
WP_061363341.1\|24703_25207_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.8e-64	72.8
WP_061363342.1\|25219_26380_-\|tail	phage tail sheath family protein	Q38068	Phage_PS17	1.6e-188	83.2
WP_003085172.1\|26422_26863_-	hypothetical protein	Q9ZXK5	Pseudomonas_virus	3.0e-31	51.0
WP_061363343.1\|26871_28980_-\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	3.2e-224	52.0
WP_023109604.1\|28981_29515_-\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.3e-61	63.4
WP_003085151.1\|29507_30395_-	bacteriophage protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
WP_003085143.1\|30391_30718_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
WP_003085141.1\|30870_31428_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
WP_061363344.1\|31424_31940_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	7.0e-32	42.9
WP_003118908.1\|31961_32411_-	hypothetical protein	B5TK61	Pseudomonas_phage	5.0e-26	53.3
WP_061363345.1\|32774_33134_-	hypothetical protein	NA	NA	NA	NA
WP_003085132.1\|33181_33382_-	repressor PtrB	Q9ZXI6	Pseudomonas_virus	3.6e-08	50.0
WP_016252929.1\|33584_33755_+	hypothetical protein	NA	NA	NA	NA
WP_034037257.1\|33839_34610_+	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	2.3e-71	59.1
WP_003113203.1\|34709_35024_+	transcription regulatory protein PrtN	NA	NA	NA	NA
WP_003142794.1\|35341_36820_-	anthranilate synthase component I	S4VNU7	Pandoravirus	9.0e-40	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LODH01000010

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

55662 : 59082

Pseudomonas_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019486208.1\|55662_56175_+	hypothetical protein	A0A0U1VYP0	Pseudomonas_phage	9.2e-93	92.9
WP_015975466.1\|56178_56445_-	hypothetical protein	A0A0U1W088	Pseudomonas_phage	8.3e-45	100.0
WP_071536920.1\|56483_57113_-	DUF4124 domain-containing protein	A0A2K8IBL8	Pseudomonas_phage	3.2e-55	61.7
WP_015975464.1\|57188_57782_-	DUF1737 domain-containing protein	A0A0U1VYP2	Pseudomonas_phage	2.4e-76	100.0
WP_061362837.1\|57792_58311_-	hypothetical protein	A0A0U1UNS0	Pseudomonas_phage	5.9e-71	98.8
WP_010793290.1\|58307_58841_-	glycoside hydrolase family protein	A0A0U1UNS2	Pseudomonas_phage	1.9e-101	99.4
WP_015975423.1\|58824_59082_-\|holin	holin	A0A0U1UNM6	Pseudomonas_phage	2.1e-37	100.0

DBSCAN-SWA_2

73107 : 101062

Pseudomonas_phage(75.0%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061362841.1\|73107_75000_-	hypothetical protein	L7THA5	Pseudomonas_virus	2.0e-180	98.0
WP_061362849.1\|75000_75606_-	hypothetical protein	Q5QF56	Pseudomonas_virus	7.1e-108	99.0
WP_061362842.1\|76156_78754_-	hypothetical protein	A0A0U1W0G7	Pseudomonas_phage	0.0e+00	98.3
WP_010793297.1\|78758_79349_-	hypothetical protein	A0A0U1VYN6	Pseudomonas_phage	8.1e-101	99.0
WP_061362843.1\|79416_80607_-	hypothetical protein	L7TKU2	Pseudomonas_virus	5.8e-223	98.5
WP_061362844.1\|80606_83570_-	hypothetical protein	A0A0U1W084	Pseudomonas_phage	0.0e+00	98.9
WP_023082379.1\|83572_84430_-	hypothetical protein	L7TJQ4	Pseudomonas_virus	4.0e-157	99.6
WP_010793300.1\|84429_84855_-	hypothetical protein	A0A2K8HN63	Pseudomonas_phage	5.9e-85	100.0
WP_004349209.1\|84878_85286_-	hypothetical protein	A0A0U1UNR7	Pseudomonas_phage	8.7e-70	100.0
WP_004349207.1\|85266_85473_-	hypothetical protein	A0A0U1SXT5	Pseudomonas_phage	1.3e-29	100.0
WP_004354925.1\|85469_86147_-	hypothetical protein	A0A0U1UNR8	Pseudomonas_phage	8.7e-131	100.0
WP_004354927.1\|86143_87016_-	hypothetical protein	A0A0U1UNM5	Pseudomonas_phage	8.2e-166	100.0
WP_010793302.1\|87080_87560_-	hypothetical protein	A0A2K8HNV7	Pseudomonas_phage	6.4e-80	100.0
WP_004349199.1\|87618_88911_-	DUF4043 family protein	A0A2K8IBP1	Pseudomonas_phage	2.2e-252	100.0
WP_044262436.1\|88923_90054_-	hypothetical protein	Q5QF43	Pseudomonas_virus	1.9e-178	97.9
WP_010793305.1\|90200_92519_-	hypothetical protein	A0A2K8HKC3	Pseudomonas_phage	0.0e+00	100.0
WP_019486226.1\|92528_93812_-\|terminase	PBSX family phage terminase large subunit	A0A2K8HZU7	Pseudomonas_phage	1.4e-259	99.8
WP_031628376.1\|93808_94375_-	hypothetical protein	L7TIB4	Pseudomonas_virus	8.6e-100	98.9
WP_061362845.1\|94425_94917_-	hypothetical protein	L7TKS9	Pseudomonas_virus	2.4e-82	99.4
WP_061362846.1\|94995_95622_-	ninG protein	A0A0U1VZM0	Pseudomonas_phage	1.6e-110	97.6
WP_010793309.1\|95677_96229_-	hypothetical protein	A0A2K8I9A9	Pseudomonas_phage	7.6e-101	100.0
WP_061362847.1\|96221_97079_-	hypothetical protein	A0A0U1UNR3	Pseudomonas_phage	1.3e-147	99.3
WP_038835448.1\|97065_98046_-	hypothetical protein	A0A0U1UNR4	Pseudomonas_phage	1.3e-146	91.7
WP_010793312.1\|98148_98349_-	hypothetical protein	A0A0U1UNM4	Pseudomonas_phage	2.8e-29	100.0
WP_019486233.1\|98457_99243_+	helix-turn-helix domain-containing protein	A0A0U1SXS9	Pseudomonas_phage	4.1e-148	100.0
WP_010793314.1\|99295_99565_-	DUF1654 domain-containing protein	A0A0U1VYM6	Pseudomonas_phage	7.8e-43	100.0
WP_015975440.1\|100442_100655_+	hypothetical protein	A0A0U1VYM8	Pseudomonas_phage	4.0e-34	100.0
WP_061362848.1\|100690_101062_+	carbon storage regulator CsrA	A0A0U1UNS3	Pseudomonas_phage	5.2e-61	98.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_LODH01000020

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7396

Pseudomonas_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061363009.1\|0_3809_-\|tail	phage tail tape measure protein	A0A0S4L7E6	Pseudomonas_phage	0.0e+00	94.2
WP_003152203.1\|4035_4542_-	hypothetical protein	J9STK7	Pseudomonas_phage	1.3e-86	96.4
WP_003094267.1\|4543_5296_-	hypothetical protein	A0A0S4L1I6	Pseudomonas_phage	4.6e-141	100.0
WP_003152202.1\|5299_5509_-	hypothetical protein	A0A0S4L313	Pseudomonas_phage	3.8e-29	94.2
WP_003152201.1\|5505_5961_-	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	2.3e-79	97.4
WP_031630681.1\|5962_6472_-	DUF1320 domain-containing protein	J9SN75	Pseudomonas_phage	3.3e-90	97.6
WP_031630683.1\|6479_6767_-	hypothetical protein	A0A0S4L5D5	Pseudomonas_phage	5.4e-26	64.8
WP_031630684.1\|6766_7396_-	hypothetical protein	Q5ZQX6	Pseudomonas_phage	2.2e-96	90.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_LODH01000007

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_LODH01000004

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

153189 : 177745

Pseudomonas_phage(96.55%)

transposase,integrase

attL 158596:158611|attR 172238:172253

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010792375.1\|153189_154800_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-18	33.0
WP_003162651.1\|154801_155818_-	ABC transporter permease	NA	NA	NA	NA
WP_015975359.1\|156825_157188_-	transcriptional regulator	Q5ZR15	Pseudomonas_phage	2.3e-61	100.0
WP_023089283.1\|157190_157754_-	regulatory protein GemA	Q5ZR14	Pseudomonas_phage	2.8e-98	98.4
WP_033940195.1\|157740_158208_-	hypothetical protein	J9STM8	Pseudomonas_phage	1.7e-61	85.2
WP_033940197.1\|158207_158399_-	hypothetical protein	J9RW45	Pseudomonas_phage	4.3e-27	96.8
WP_003094188.1\|158400_159090_-	DUF2786 domain-containing protein	Q5ZR11	Pseudomonas_phage	1.3e-126	100.0
158596:158611	attL	NA	NA	NA	NA
WP_023089286.1\|159091_159709_-	DUF3164 family protein	A0A0A1IVF8	Pseudomonas_phage	9.2e-47	45.9
WP_015975362.1\|159701_159902_-	hypothetical protein	Q5ZR09	Pseudomonas_phage	1.3e-31	100.0
WP_052156535.1\|159894_160269_-	hypothetical protein	Q5ZR08	Pseudomonas_phage	5.7e-68	99.2
WP_015975364.1\|160268_160550_-	hypothetical protein	Q5ZR07	Pseudomonas_phage	8.7e-45	100.0
WP_033940199.1\|160546_160888_-	hypothetical protein	Q5ZR06	Pseudomonas_phage	6.4e-58	99.1
WP_023089289.1\|160889_162062_-	AAA family ATPase	Q5ZR05	Pseudomonas_phage	1.8e-184	85.9
WP_043502560.1\|162061_163843_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q5ZR04	Pseudomonas_phage	0.0e+00	99.8
WP_023089291.1\|163845_164772_-	DUF3102 domain-containing protein	Q5ZR03	Pseudomonas_phage	9.0e-163	99.7
WP_023089292.1\|164782_165091_-	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	3.5e-47	98.0
WP_003127832.1\|165083_165569_-	hypothetical protein	Q5ZR01	Pseudomonas_phage	7.4e-92	100.0
WP_021204956.1\|165692_165917_+	hypothetical protein	NA	NA	NA	NA
WP_015649411.1\|166199_166409_-	DNA-binding protein	Q5ZQZ9	Pseudomonas_phage	1.2e-30	100.0
WP_061362700.1\|166470_166908_+	helix-turn-helix transcriptional regulator	Q5ZQZ8	Pseudomonas_phage	8.6e-23	44.1
WP_021204954.1\|166911_167544_+	hypothetical protein	NA	NA	NA	NA
WP_079278801.1\|168319_168577_+	hypothetical protein	Q5ZQZ2	Pseudomonas_phage	7.2e-38	100.0
WP_033940233.1\|168702_169311_+	transglycosylase SLT domain-containing protein	Q5ZQZ1	Pseudomonas_phage	2.4e-116	99.5
WP_033940196.1\|169506_170118_+	hypothetical protein	Q5ZQY9	Pseudomonas_phage	3.8e-101	98.0
WP_015975380.1\|170121_170511_+	hypothetical protein	Q5ZQY8	Pseudomonas_phage	7.6e-63	100.0
WP_015975381.1\|170500_170809_+	hypothetical protein	Q5ZQY7	Pseudomonas_phage	2.3e-54	100.0
WP_061362701.1\|170814_171387_+	DUF3486 family protein	Q5ZQY6	Pseudomonas_phage	8.7e-92	98.4
WP_033940204.1\|171386_172847_+	hypothetical protein	Q5ZQY5	Pseudomonas_phage	9.8e-289	99.4
172238:172253	attR	NA	NA	NA	NA
WP_033940206.1\|172846_174325_+	DUF935 family protein	Q5ZQY4	Pseudomonas_phage	1.6e-283	99.0
WP_023089300.1\|174324_175581_+	hypothetical protein	Q5ZQY3	Pseudomonas_phage	7.2e-240	99.0
WP_015975387.1\|175704_176277_+	phage virion morphogenesis protein	Q5ZQY1	Pseudomonas_phage	4.8e-106	100.0
WP_079381926.1\|176566_177745_+	peptidase	Q5ZQY0	Pseudomonas_phage	4.1e-168	96.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_LODH01000070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_LODH01000025

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LODH01000025_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LODH01000025_1

436487-436755

Orphan

I-F

Consensus_repeat	Method
TTTCTTAGCTGCCTATACGGCAGTGAAC	PILER-CR
TTTCTTAGCTGCCTATACGGCAGTGAAC	CRISPRCasFinder
TTTCTTAGCTGCCTATACGGCAGTGAAC	CRT

4 spacers

The CRISPR arrays of NZ_LODH01000025_1

>merge|NZ_LODH01000025|1|436487-436755|PILER-CR,CRISPRCasFinder,CRT
TTTCTTAGCTGCCTATACGGCAGTGAACAACCGGGCGCGGCCGCGGGTCGGCAACGTCGATTTCTTAGCTGCCTATACGGCAGTGAACGCAGATCGCAGCGCTCACCGACGTCTCTACCGTTTCTTAGCTGCCTATACGGCAGTGAACAACTGCCGGTGCCGGATCGTCGCCTTGACGGATTTCTTAGCTGCCTATACGGCAGTGAACAGACAAGAAAAACCGGTCGATGCGGGTTGTGATTTTCTTAGCTGCCTATACGGCAGTGAAC

>NZ_LODH01000025|1|1|436487-436755|PILER-CR
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACCGGGCGCGGCCGCGGGTCGGCAACGTCGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	GCAGATCGCAGCGCTCACCGACGTCTCTACCG
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACTGCCGGTGCCGGATCGTCGCCTTGACGGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	AGACAAGAAAAACCGGTCGATGCGGGTTGTGAT
TTTCTTAGCTGCCTATACGGCAGTGAAC

>NZ_LODH01000025|1|1|436487-436755|CRISPRCasFinder
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACCGGGCGCGGCCGCGGGTCGGCAACGTCGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	GCAGATCGCAGCGCTCACCGACGTCTCTACCG
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACTGCCGGTGCCGGATCGTCGCCTTGACGGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	AGACAAGAAAAACCGGTCGATGCGGGTTGTGAT
TTTCTTAGCTGCCTATACGGCAGTGAAC

>NZ_LODH01000025|1|1|436487-436755|CRT
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACCGGGCGCGGCCGCGGGTCGGCAACGTCGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	GCAGATCGCAGCGCTCACCGACGTCTCTACCG
TTTCTTAGCTGCCTATACGGCAGTGAAC	AACTGCCGGTGCCGGATCGTCGCCTTGACGGA
TTTCTTAGCTGCCTATACGGCAGTGAAC	AGACAAGAAAAACCGGTCGATGCGGGTTGTGAT
TTTCTTAGCTGCCTATACGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LODH01000025.1\|WP_061363109.1\|440249_440720_-\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
NZ_LODH01000025.1\|WP_003113065.1\|437024_437339_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003119370.1\|446291_446621_+\|GlpM-family-protein	unknown	unknown	gnl\|CDD\|284382
NZ_LODH01000025.1\|WP_010895658.1\|435556_435670_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003092152.1\|433127_433766_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182177
NZ_LODH01000025.1\|WP_153506273.1\|436088_436250_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003092161.1\|438701_440186_-\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|198361
NZ_LODH01000025.1\|WP_003092150.1\|431584_432763_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_LODH01000025.1\|WP_003098462.1\|446637_447624_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_LODH01000025.1\|WP_003098460.1\|444620_446159_+\|glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237027
NZ_LODH01000025.1\|WP_003092159.1\|437720_438506_-\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_LODH01000025.1\|WP_022579712.1\|435785_435899_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003104346.1\|431400_431577_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003122160.1\|430350_431274_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380391
NZ_LODH01000025.1\|WP_061363110.1\|440984_441824_+\|aquaporin	unknown	unknown	gnl\|CDD\|238204
NZ_LODH01000025.1\|WP_003092155.1\|434124_434655_+\|cytochrome-b	unknown	unknown	gnl\|CDD\|225580
NZ_LODH01000025.1\|WP_003092168.1\|441863_443381_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NZ_LODH01000025.1\|WP_061363108.1\|434754_435177_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000025.1\|WP_003092153.1\|433744_433942_-\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|238219
NZ_LODH01000025.1\|WP_003092173.1\|443586_444342_+\|DeoR/GlpR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182827

Protein	Function_ID	Function_description	E-value
NZ_LODH01000025.1\|WP_003092161.1\|438701_440186_-\|glycerol-kinase-GlpK	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
NZ_LODH01000025.1\|WP_061363109.1\|440249_440720_-\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	1.89774e-79
NZ_LODH01000025.1\|WP_003119370.1\|446291_446621_+\|GlpM-family-protein	gnl\|CDD\|284382	pfam06942, GlpM, GlpM protein. This family consists of several bacterial GlpM membrane proteins. GlpM is a hydrophobic protein containing 109 amino acids. It is thought that GlpM may play a role in alginate biosynthesis in Pseudomonas aeruginosa.	2.61005e-48
NZ_LODH01000025.1\|WP_003092173.1\|443586_444342_+\|DeoR/GlpR-family-transcriptional-regulator	gnl\|CDD\|182827	PRK10906, PRK10906, DeoR/GlpR family transcriptional regulator.	6.60771e-110
NZ_LODH01000025.1\|WP_003092152.1\|433127_433766_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|182177	PRK09975, PRK09975, DNA-binding transcriptional regulator EnvR; Provisional.	8.64954e-35
NZ_LODH01000025.1\|WP_003092168.1\|441863_443381_+\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NZ_LODH01000025.1\|WP_003092150.1\|431584_432763_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.83676e-119
NZ_LODH01000025.1\|WP_003098460.1\|444620_446159_+\|glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237027	PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed.	0
NZ_LODH01000025.1\|WP_003092159.1\|437720_438506_-\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	3.55636e-94
NZ_LODH01000025.1\|WP_003122160.1\|430350_431274_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380391	cd06986, cupin_MmsR-like_N, AraC/XylS family transcriptional regulators similar to MmsR, N-terminal cupin domain. This family contains bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included is MmsR, a bacterial transcriptional regulator thought to positively regulate the expression of the mmsAB operon. The mmsAB operon contains two structural genes involved in valine metabolism: mmsA which encodes methylmalonate-semialdehyde dehydrogenase, and mmsB which encodes 3-hydroxyisobutyrate dehydrogenase. The cupin domain of members of this subfamily does not contain a metal binding site.	3.4378e-23
NZ_LODH01000025.1\|WP_061363110.1\|440984_441824_+\|aquaporin	gnl\|CDD\|238204	cd00333, MIP, Major intrinsic protein (MIP) superfamily. Members of the MIP superfamily function as membrane channels that selectively transport water, small neutral molecules, and ions out of and between cells. The channel proteins share a common fold: the N-terminal cytosolic portion followed by six transmembrane helices, which might have arisen through gene duplication. On the basis of sequence similarity and functional characteristics, the superfamily can be subdivided into two major groups: water-selective channels called aquaporins (AQPs) and glycerol uptake facilitators (GlpFs). AQPs are found in all three kingdoms of life, while GlpFs have been characterized only within microorganisms.	2.5216e-74
NZ_LODH01000025.1\|WP_003092155.1\|434124_434655_+\|cytochrome-b	gnl\|CDD\|225580	COG3038, CybB, Cytochrome B561 [Energy production and conversion].	2.18545e-52
NZ_LODH01000025.1\|WP_003092153.1\|433744_433942_-\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	8.29036e-11
NZ_LODH01000025.1\|WP_003098462.1\|446637_447624_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	4.15496e-24

>NZ_LODH01000025.1|WP_153506273.1|436088_436250_-|hypothetical-protein
MAACRREQRCSEGTPAEKRLGPDAGASLLVPFGRLQKELAWEGETRGQGRHRK
>NZ_LODH01000025.1|WP_022579712.1|435785_435899_-|hypothetical-protein
MPSEWQGESFGRLQKELAWKGETRGQGKHDKQLEQQT
>NZ_LODH01000025.1|WP_010895658.1|435556_435670_-|hypothetical-protein
MPSEWQGESFGRLQKELAWKVETRGQGKHDKQLEQQT
>NZ_LODH01000025.1|WP_061363108.1|434754_435177_+|hypothetical-protein
MFPILRPLLHTAALACALPALAADPQPASGGWAQPDPAPIGYAVLNVSRERVESGTACDIGLYVHDELVGNLQPGASLALNLQPGAVDVRLAPNGPGDACRNGMTILAGQTLTLRAGEIRNLRITLGAGGFYLAPVADGY
>NZ_LODH01000025.1|WP_003092155.1|434124_434655_+|cytochrome-b
MSIRRYSPSQIALHWLSAVAVLLIIALPYGADFFAGLLGGKGNVFTLHKSLGVAVLLLTLTRLALRRVQGVPDTLEGNPDWQRAAAKAGHFLLYAVLIVMPLSGMLAGKRPLDLFWLVQIGPFDLPEAFKAFAGGTHVTVQYLLFALILGHAAAAIWHHRVQKDDVLRAMLPQRGA
>NZ_LODH01000025.1|WP_003092153.1|433744_433942_-|heavy-metal-associated-domain-containing-protein
MQVFKVQGMTCGHCVRAITHAVQAKDSAADVQVDLGAGEVRVASRLDSTQVLEAIREEGYGAELA
>NZ_LODH01000025.1|WP_003092152.1|433127_433766_+|TetR-family-transcriptional-regulator
MRRTKEDSEKTRTAILLAAEELFLEKGVSHTSLEQIARAAGVTRGAVYWHFQNKAHLFNEMLNQVRLPPEQLTERLSGCDGSDPLRSLYDLCLEAVQSLLTQEKKRRILTILMQRCEFTEELREAQERNNAFVQMFIELCEQLFARDECRVRLHPGMTPRIASRALHALILGLFNDWLRDPRLFDPDTDAEHLLEPMFRGLVRDWGQASSAP
>NZ_LODH01000025.1|WP_003092150.1|431584_432763_-|multidrug-effflux-MFS-transporter
MNLRILLILGALSAFGPLAIDFYLPSFPTLAKAFATDVEHVQLSLAAYFAGLSIGQLLYGPVADRYGRRLPLLVGVSIFTLASAACALAPSLEWLIAARFVQALGGCAGMVISRAVVRDLCDPIGAAKAFSQLMLVMGLAPILAPVAGGLLLDWQGWQSIFVCLTLFAALAGLGVALWLPETIPADGERPPLSGALGQYRRLFADRLFLAYGLSGGVAMAGMFAYIAGSPYVFIQLYGIPAEHYGWLFGSNAAGFIVMAQVNARLLRYRGPAFWLRRIIWGYLACGLALLGIASLQPATLWPLLVPLFGCVASLGCIIPNASACAMAGQGQHAGSASALMGSLQFSVAAGASALVGVLHDGTAIPMTLVIAVCGAVATLLAWQTGRLERQAA
>NZ_LODH01000025.1|WP_003104346.1|431400_431577_+|hypothetical-protein
MNILVRPSQTPKGQCWQVCLDQQAVNFRSESEARRFVDRLEARLRAPHVLPELKQRTA
>NZ_LODH01000025.1|WP_003122160.1|430350_431274_+|AraC-family-transcriptional-regulator
MDYIAEPATDMSHTSDWPLPADSLRLPIPAALLEKLAVHPLSRDLYPTSLGHYRRARDHRMSRERHDEHLLIYCSEGQGLLRVREGEAWREYRVGSGDLLWLPPGMAHDYAADDRQPWTIFWTHLRGDSATWLQHSAGYRDTPLRHWGLQHALLGGFEQLLEVRHSGYRFQHFLLAASRLRSLLCQLPLLRPLREGSLDLDGLHAYMREHLHARLELERLAAFCNLSKFHFVSRYKAITGRTPIQHFLHLKIEYACQLLDSSDQSVARVGQAVGYDDSYYFSRLFSKVMGLSPSAYRQRVRQGEGGA
>NZ_LODH01000025.1|WP_003113065.1|437024_437339_-|hypothetical-protein
MAKPNDTSNPEVTESSPRFVPLLPTSQADMCPRSATLYVDTHALPTHLFDNAKVRLRSAINILAMTRLLDEKEEPGGTLAYINGALLSLLSDALSEIEAGHPSL
>NZ_LODH01000025.1|WP_003092159.1|437720_438506_-|PhzF-family-phenazine-biosynthesis-protein
MQLEFHQVDAFSSRPFSGNPAVVYRLDAWLADELMQMIATEHNLSETAFVVREGEAWRIRWFTPSVEVALCGHATLAAAHVLFEVYDEPGERLEFISRSGALRVNREDERLVLDFPAQYPSEVGSTVELEQALGLPPVDVLGSTDKLLVLLESEEAVRACRPDFAALARLPWRGVIVTARGLQKDFVSRFFAPAMGVDEDPVTGSAHCSLIPYWAQRLNKLSLTAQQCSARGGELWCRLEGERVSIAGHAVLVASGRIRLS
>NZ_LODH01000025.1|WP_003092161.1|438701_440186_-|glycerol-kinase-GlpK
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCRDALARKGLRAADIAAIGITNQRETTLVWDAASGDLIHPAIVWQDRRTADYCAELKAAGHEANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRTDATNASRTLLFNIHSQDWDEELLALFEIPRSLLPEVLDCAAEFGVSEPSLLGAAIPVLGMAGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAVEGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARGAIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWVMQFLTDILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFAAHMAEERRGELYAGWQNAVRRVRSEA
>NZ_LODH01000025.1|WP_061363109.1|440249_440720_-|Cys-tRNA(Pro)-deacylase
MTPAIDLLKKARVEHKVLSYSHDPKAPSYGLEAAEKLGLDPQRVFKTLLAATEKGELLVAVVPVIGSLDLKALAHAAGAKKADMADPQAAQRATGYLVGGISPLGQKKRLRTFIDESARQYPSIHVSAGRRGLEVELAAEVLAQLTQGSFAAIGRE
>NZ_LODH01000025.1|WP_061363110.1|440984_441824_+|aquaporin
MTTAAPTPSLFGQCLAEFLGTALLIFFGTGCVAALKVAGASFGLWEISIIWGIGVSMAIYLSAGVSGAHLNPAVSIALWLFAGFEGRKLPFYITAQVAGAFCAAALVYTLYSSLFIEFEQAQNIVRGSQDSLALASVFSTYPHPALSVGQAFLVEVVITAILMALIMALTDDGNGLPRGPLAPLLIGLLIAVIGSAMGPLTGFAMNPARDFGPKLMTYLAGWGPIAFTGGREIPYFLVPIFAPILGACLGAGGYRVLIARHLPSAAAPAEAEPEKVRAS
>NZ_LODH01000025.1|WP_003092168.1|441863_443381_+|glycerol-kinase-GlpK
MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDPMEIWATQSSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSAAICAQLKRDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGARERARNGDLLFGTIDTWLIWKLTEGKVHVTDYTNASRTMLFNIHSLDWDARMLEVLDIPRSMLPEVRNSSEVYGNARIGGVGGGELPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRGEVGYALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYWDPYARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLRALRVDGGAVANNFLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKSKAVIERVFEPECDEPRREKLYAGWKKAVERTRGWDDGEL
>NZ_LODH01000025.1|WP_003092173.1|443586_444342_+|DeoR/GlpR-family-transcriptional-regulator
MNLPPRQQSIIEEVRERGYLSIEEMAQMFAVTPQTIRRDINQLAEQGLLRRYHGGAAYDSSIENTAYTMRADQMRDEKQRIAEAVASLVPDNASLFINIGTTTEAIARALLNHRNLKIITNNLHVAATLSAKEDFEVLVAGGTVRSDGGIVGQAAVDFIQQFRVDFALVGISGIDEDGSLLDFDYQEVRVSQAIIDNARQVFLAADSSKFGRNAVVRLGPISLVNRVISDSPPPAAIARLMAQHKVHLDLV
>NZ_LODH01000025.1|WP_003098460.1|444620_446159_+|glycerol-3-phosphate-dehydrogenase
MSQAHTPSAPLAEVYDVAVVGGGINGVGIAADAAGRGLSVFLCEQHDLAQHTSSASSKLIHGGLRYLEHYEFRLVREALAEREVLLAKAPHIVKPLRFVLPHRPHLRPAWMIRAGLFLYDHLGKREKLPASRGLRFTGSSPLKAEIRRGFEYSDCAVDDARLVVLNAISAREHGAHVHTRTRCVSARRSKGLWHLHLERSDGSLYSIRARALVNAAGPWVARFIQDDLKQKSPYGIRLIQGSHIIVPKLYEGEHAYILQNEDRRIVFAIPYLDRFTMIGTTDREYQGDPAKVAISEEETAYLLQVVNAHFKQQLAAADILHSFAGVRPLCDDESDEPSAITRDYTLSLSAGNGEPPLLSVFGGKLTTYRKLAESALTQLQPFFANLGPAWTAKAPLPGGEQMQSVEALTEQLANRYAWLDRELALRWARTYGTRVWRLLDGVNGEADLGEHLGGGLYAREVDYLCKHEWAQDAEDILWRRSKLGLFLSPSQQVRLGQYLQSEHPHRPRVHAA
>NZ_LODH01000025.1|WP_003119370.1|446291_446621_+|GlpM-family-protein
MFKALIGAAVVVLLAVLSKTRNYYIAGLVPLFPTFALIAHYIVGKGRSLDDLKTTIVFGMWSIIPYFVYLAALYLLVERFRLETSLALAALAWLVAASVLVGLWVRLHA
>NZ_LODH01000025.1|WP_003098462.1|446637_447624_-|alpha/beta-hydrolase
MRAFIFLAALLCSLSSFAAARCDARVPTETVELGDVRLAYQSIGRDSDPALLLVMGLGGQLIHWPDEVVSALCEQGFRVIRYDNRDVGLSAWNVPVPSSRLTYEVVRYRLGLPVSAPYTLTDMAGDALHLLDALDIPQAHVLGASMGGMIAQHIADMAPQRLLSLTLVMTSSGAEGLPAPSESLLRLLARREAASREQAVEQQADLLAALGSPEVRDDRQQLLLQAARSYDRAFNPEGVQRQLLAILAEPSRVPLLNRLQVPTLVIHGTADPLLPVMHGVHVAAHIRGSELKLIPGLAHRFQEAFKEPLLAAVVPYLKAHRQASVVQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LODH01000025_1	1.4\|436695\|33\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436695-436727	33	NZ_LODH01000014.1	40117-40149	2	0.939

1. spacer 1.4|436695|33|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to position: 40117-40149, mismatch: 2, identity: 0.939

agacaagaaaaaccggtcgatgcgggttgtgat	CRISPR spacer
agacaagaaaaaccgctcgatgcgcgttgtgat	Protospacer
*************** ******** ********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK034952	Pseudomonas phage Dobby, complete genome	32388-32419	0	1.0
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511042	Pseudomonas phage CF126, partial genome	9365-9396	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511040	Pseudomonas phage CF63, partial genome	55856-55887	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511051	Pseudomonas phage BR181, partial genome	54933-54964	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	KC900378	Pseudomonas phage LKA5, complete genome	7930-7961	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NC_003278	Pseudomonas phage phiCTX, complete genome	31683-31714	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511041	Pseudomonas phage CF69, partial genome	9393-9424	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511049	Pseudomonas phage BR326, partial genome	54933-54964	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511045	Pseudomonas phage BR208, partial genome	54933-54964	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511044	Pseudomonas phage BR197, partial genome	9393-9424	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511050	Pseudomonas phage BR150, partial genome	9321-9352	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511048	Pseudomonas phage BR320, partial genome	9321-9352	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	KM389401	UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00001 genomic sequence	4844-4875	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511046	Pseudomonas phage BR313, partial genome	54933-54964	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	Y13918	Pseudomonas aeruginosa phage phi CTX DNA, complete genome	31683-31714	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	AB008550	Pseudomonas phage phiCTX DNA, complete genome	31683-31714	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NC_042342	Pseudomonas virus H66, complete genome	8813-8844	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511047	Pseudomonas phage BR319, partial genome	9497-9528	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511043	Pseudomonas phage BR228, partial genome	5442-5473	1	0.969
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	MK511039	Pseudomonas phage CF24, partial genome	9393-9424	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	MK511036	Pseudomonas phage BR327, partial genome	17529-17560	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	JQ762257	Pseudomonas phage MP42, complete genome	17491-17522	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	KM389243	UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00002 genomic sequence	7555-7586	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	MK511018	Pseudomonas phage CF28, partial genome	17561-17592	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	LT608331	Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A	17102-17133	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NC_026601	Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome	17534-17565	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NC_030918	Pseudomonas phage JBD93, complete genome	16691-16722	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	EU272037	Pseudomonas phage MP38, complete genome	17707-17738	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	JX434032	Pseudomonas phage JBD30, complete genome	17530-17561	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	KU199708	Pseudomonas phage JBD69, complete genome	17513-17544	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	DQ631426	Pseudomonas phage DMS3, complete genome	17086-17117	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	JX434031	Pseudomonas phage JBD24, complete genome	17379-17410	1	0.969
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NC_009818	Pseudomonas phage MP22, complete genome	16164-16195	2	0.938
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	JX434033	Pseudomonas phage JBD88a, complete genome	16153-16184	2	0.938
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	KU199707	Pseudomonas phage JBD16C, partial genome	16130-16161	2	0.938
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NC_041851	Pseudomonas phage F_HA0480sp/Pa1651, complete genome	17074-17105	2	0.938
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	DQ873690	Phage MP22, complete genome	16164-16195	2	0.938
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	MG707188	Pseudomonas phage TC7, partial genome	14616-14647	3	0.906
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NC_031091	Pseudomonas phage MD8, complete genome	29222-29253	4	0.875
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NC_030931	Pseudomonas phage phi2, complete genome	5548-5579	4	0.875
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	309134-309165	7	0.781
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1498691-1498722	8	0.75
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NZ_CP049358	Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence	53473-53504	9	0.719
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	431527-431558	9	0.719
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	MT889371	Microbacterium phage DelaGarza, complete genome	20639-20670	9	0.719
NZ_LODH01000025_1	1.1\|436515\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436515-436546	32	NZ_KF418775	Burkholderia pseudomallei strain MSHR1950 plasmid pBPSE01, complete sequence	101470-101501	10	0.688
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	79780-79811	10	0.688
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	78090-78121	10	0.688
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	367786-367817	10	0.688
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1123676-1123707	11	0.656
NZ_LODH01000025_1	1.2\|436575\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436575-436606	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	1339050-1339081	11	0.656
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NC_018583	Gordonia sp. KTR9 plasmid pGKT3, complete sequence	37659-37690	11	0.656
NZ_LODH01000025_1	1.3\|436635\|32\|NZ_LODH01000025\|PILER-CR,CRISPRCasFinder,CRT	436635-436666	32	NZ_CP047236	Gordonia sp. JH63 plasmid pJH63-1, complete sequence	120365-120396	11	0.656

1. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK034952 (Pseudomonas phage Dobby, complete genome) position: , mismatch: 0, identity: 1.0

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcggccgcgggtcggcaacgtcga	Protospacer
********************************

2. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511042 (Pseudomonas phage CF126, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

3. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

4. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511051 (Pseudomonas phage BR181, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

5. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to KC900378 (Pseudomonas phage LKA5, complete genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

6. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_003278 (Pseudomonas phage phiCTX, complete genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgtccgcgggtcggcaacgtcga	Protospacer
*********** ********************

7. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511041 (Pseudomonas phage CF69, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

8. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511049 (Pseudomonas phage BR326, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

9. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511045 (Pseudomonas phage BR208, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

10. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511044 (Pseudomonas phage BR197, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

11. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511050 (Pseudomonas phage BR150, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

12. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511048 (Pseudomonas phage BR320, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

13. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to KM389401 (UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00001 genomic sequence) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgtccgcgggtcggcaacgtcga	Protospacer
*********** ********************

14. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511046 (Pseudomonas phage BR313, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

15. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to Y13918 (Pseudomonas aeruginosa phage phi CTX DNA, complete genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgtccgcgggtcggcaacgtcga	Protospacer
*********** ********************

16. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to AB008550 (Pseudomonas phage phiCTX DNA, complete genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgtccgcgggtcggcaacgtcga	Protospacer
*********** ********************

17. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_042342 (Pseudomonas virus H66, complete genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

18. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511047 (Pseudomonas phage BR319, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

19. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511043 (Pseudomonas phage BR228, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

20. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511039 (Pseudomonas phage CF24, partial genome) position: , mismatch: 1, identity: 0.969

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
aaccgggcgcgcccgcgggtcggcaacgtcga	Protospacer
*********** ********************

21. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511036 (Pseudomonas phage BR327, partial genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

22. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to JQ762257 (Pseudomonas phage MP42, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

23. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to KM389243 (UNVERIFIED: Pseudomonas phage F_TK1932sp/Pa1651 clone contig00002 genomic sequence) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

24. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MK511018 (Pseudomonas phage CF28, partial genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

25. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to LT608331 (Pseudomonas phage vB_PaeS_PcyII-40_PfII40a isolate PfII40A_reads genome assembly, chromosome: PFII40A) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

26. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_026601 (Pseudomonas phage vB_PaeS_PAO1_Ab30, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

27. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_030918 (Pseudomonas phage JBD93, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

28. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to EU272037 (Pseudomonas phage MP38, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

29. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to JX434032 (Pseudomonas phage JBD30, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

30. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to KU199708 (Pseudomonas phage JBD69, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

31. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to DQ631426 (Pseudomonas phage DMS3, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

32. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to JX434031 (Pseudomonas phage JBD24, complete genome) position: , mismatch: 1, identity: 0.969

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacgga	Protospacer
********************.***********

33. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_009818 (Pseudomonas phage MP22, complete genome) position: , mismatch: 2, identity: 0.938

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacggt	Protospacer
********************.**********

34. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to JX434033 (Pseudomonas phage JBD88a, complete genome) position: , mismatch: 2, identity: 0.938

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacggt	Protospacer
********************.**********

35. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to KU199707 (Pseudomonas phage JBD16C, partial genome) position: , mismatch: 2, identity: 0.938

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacggt	Protospacer
********************.**********

36. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_041851 (Pseudomonas phage F_HA0480sp/Pa1651, complete genome) position: , mismatch: 2, identity: 0.938

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacggt	Protospacer
********************.**********

37. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to DQ873690 (Phage MP22, complete genome) position: , mismatch: 2, identity: 0.938

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
aactgccggtgccggatcgttgccttgacggt	Protospacer
********************.**********

38. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 3, identity: 0.906

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
gcagatcgcggtgctcaccgacgtctctactg	Protospacer
*********.*.******************.*

39. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_031091 (Pseudomonas phage MD8, complete genome) position: , mismatch: 4, identity: 0.875

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
aaagatcgccgcactcaccgacgtctctaccg	Protospacer
. ******* **.*******************

40. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 4, identity: 0.875

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
acggatcgccgccctcaccgacgtctctaccg	Protospacer
.*.****** ** *******************

41. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 7, identity: 0.781

--aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
ttgacc--gcccggccgctggtcggcaacgtcac	Protospacer
  .***  ** ******* *************.

42. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 8, identity: 0.75

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
gcatatcgcagcgctcaccgtcgcatgcctcg	Protospacer
*** **************** **. * . .**

43. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049358 (Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
gaggcggcgcggcggcgggtcggccacggcct	Protospacer
.*   ******** ********** *** *

44. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 9, identity: 0.719

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
gaagatggtcggcggcaggtcggcaacgtcga	Protospacer
.*  . *  **** **.***************

45. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to MT889371 (Microbacterium phage DelaGarza, complete genome) position: , mismatch: 9, identity: 0.719

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
gcagatcgccacgctcaccgacgacctcgtgg	Protospacer
********* .************ *..... *

46. spacer 1.1|436515|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KF418775 (Burkholderia pseudomallei strain MSHR1950 plasmid pBPSE01, complete sequence) position: , mismatch: 10, identity: 0.688

aaccgggcgcggccgcgggtcggcaacgtcga	CRISPR spacer
gaccgggcgcggccgcgcgccggcctggattg	Protospacer
.**************** *.****   * . .

47. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 10, identity: 0.688

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
ccagatcgccacgctcaccgacgtgagctggg	Protospacer
 ******** .*************   .   *

48. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 10, identity: 0.688

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
ccagatcgccacgctcaccgacgtgagctggg	Protospacer
 ******** .*************   .   *

49. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
ggcgatgcgtgcgggatcgtcgccatgacggg	Protospacer
..* ..  **** *********** ******.

50. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 11, identity: 0.656

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
aactgtcgcagcgatcaccgacgcctctcaac	Protospacer
.   .******** *********.****

51. spacer 1.2|436575|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 11, identity: 0.656

gcagatcgcagcgctcaccgacgtctctaccg	CRISPR spacer
aactgtcgcagcgatcaccgacgcctctcaac	Protospacer
.   .******** *********.****

52. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NC_018583 (Gordonia sp. KTR9 plasmid pGKT3, complete sequence) position: , mismatch: 11, identity: 0.656

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
tgggcgtagtgcaggatcgtcgcctggacggc	Protospacer
 .    ..**** ************ *****

53. spacer 1.3|436635|32|NZ_LODH01000025|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047236 (Gordonia sp. JH63 plasmid pJH63-1, complete sequence) position: , mismatch: 11, identity: 0.656

aactgccggtgccggatcgtcgccttgacgga	CRISPR spacer
tgggcgtagtgcaggatcgtcgcctggacggc	Protospacer
 .    ..**** ************ *****

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_LODH01000018

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

545481 : 553388

Pseudomonas_phage(100.0%)

capsid,integrase

attL 545428:545454|attR 555396:555422

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
545428:545454	attL	NA	NA	NA	NA
WP_061362987.1\|545481_546522_-\|integrase	tyrosine-type recombinase/integrase	Q56VN7	Pseudomonas_phage	1.1e-103	56.7
WP_058143884.1\|546521_547814_-	hypothetical protein	Q56VN8	Pseudomonas_phage	4.5e-253	96.8
WP_061362988.1\|548042_549317_-	hypothetical protein	Q56VN9	Pseudomonas_phage	1.1e-200	87.5
WP_003114150.1\|549320_549677_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
WP_079761850.1\|549681_550944_-	attachment protein	Q56VP1	Pseudomonas_phage	2.5e-46	55.1
WP_061362990.1\|551079_551328_-\|capsid	capsid protein	Q56VP2	Pseudomonas_phage	1.2e-32	92.7
WP_003115979.1\|551340_551592_-	hypothetical protein	NA	NA	NA	NA
WP_003115130.1\|551604_551697_-	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
WP_061362991.1\|551713_552148_-	hypothetical protein	Q56VP5	Pseudomonas_phage	4.2e-62	96.5
WP_061362992.1\|552282_552660_-	hypothetical protein	Q56VP6	Pseudomonas_phage	1.8e-61	97.6
WP_031627909.1\|552663_552954_-	hypothetical protein	Q56VP7	Pseudomonas_phage	6.2e-54	95.8
WP_061362993.1\|552957_553170_-	hypothetical protein	Q56VP8	Pseudomonas_phage	4.9e-32	94.3
WP_023084915.1\|553172_553388_-	hypothetical protein	Q56VP9	Pseudomonas_phage	6.3e-35	94.4
555396:555422	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

9. NZ_LODH01000044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

66 : 7728

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061363270.1\|66_696_+	hypothetical protein	Q5ZQX6	Pseudomonas_phage	2.3e-101	93.3
WP_031642933.1\|701_1214_+	DUF1320 domain-containing protein	Q5ZQX5	Pseudomonas_phage	3.8e-94	99.4
WP_015975394.1\|1215_1680_+	hypothetical protein	Q5ZQX4	Pseudomonas_phage	4.9e-85	100.0
WP_033863125.1\|1676_1883_+	hypothetical protein	Q5ZQX3	Pseudomonas_phage	4.2e-28	95.6
WP_061363271.1\|1886_2639_+	hypothetical protein	Q5ZQX2	Pseudomonas_phage	1.9e-139	99.6
WP_061363272.1\|2641_3148_+	hypothetical protein	Q5ZQX1	Pseudomonas_phage	2.8e-89	97.0
WP_023118174.1\|3144_3297_+	hypothetical protein	Q5ZQX0	Pseudomonas_phage	1.5e-14	95.3
WP_015975400.1\|3432_3618_+	Com family DNA-binding transcriptional regulator	Q5ZQW8	Pseudomonas_phage	2.6e-29	100.0
WP_043502526.1\|3587_4382_+	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	4.5e-155	99.6
WP_061363273.1\|4462_7728_+	tape measure protein	Q5ZQW6	Pseudomonas_phage	0.0e+00	95.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

10. NZ_LODH01000038

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

148990 : 184562

Pseudomonas_phage(63.27%)

integrase,protease,transposase,terminase,head

attL 141602:141618|attR 176244:176260

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
141602:141618	attL	NA	NA	NA	NA
WP_010791926.1\|148990_149713_-	helix-turn-helix transcriptional regulator	A0A125RN88	Pseudomonas_phage	8.4e-132	100.0
WP_010791925.1\|149862_150207_+	hypothetical protein	A0A125RN89	Pseudomonas_phage	1.3e-58	100.0
WP_004365132.1\|150209_150644_+	hypothetical protein	I6P8D5	Pseudomonas_phage	2.3e-76	100.0
WP_031757302.1\|150643_150970_+	hypothetical protein	A0A125RN91	Pseudomonas_phage	2.9e-52	100.0
WP_010791924.1\|150966_151377_+	hypothetical protein	I6PBC7	Pseudomonas_phage	8.8e-62	100.0
WP_061363229.1\|151369_153442_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A125RN93	Pseudomonas_phage	0.0e+00	99.9
WP_061363230.1\|153438_154206_+	ATP-binding protein	L7P7S8	Pseudomonas_phage	4.3e-134	99.2
WP_033995146.1\|154202_154838_+	hypothetical protein	A0A1C6ZDI9	Pseudomonas_phage	2.5e-119	99.1
WP_061363233.1\|155857_156169_+	hypothetical protein	H6V800	Pseudomonas_virus	9.0e-51	99.0
WP_003094486.1\|156185_156704_+	host-nuclease inhibitor protein Gam	L7P7T1	Pseudomonas_phage	1.1e-90	100.0
WP_010791918.1\|156705_156987_+	hypothetical protein	A0A1C6ZDJ8	Pseudomonas_phage	9.3e-47	100.0
WP_015994787.1\|156988_157297_+	hypothetical protein	B7SDX7	Pseudomonas_virus	8.4e-49	100.0
WP_016068556.1\|157299_157581_+	hypothetical protein	A0A0U5KRI9	unidentified_phage	3.6e-46	100.0
WP_003094506.1\|157582_157789_+	hypothetical protein	A0A0A1IWY9	Pseudomonas_phage	2.2e-29	100.0
WP_010791915.1\|157791_158061_+	hypothetical protein	B7SDX9	Pseudomonas_virus	8.4e-45	100.0
WP_003099427.1\|158131_158428_+	hypothetical protein	L7P7Y1	Pseudomonas_phage	1.2e-44	100.0
WP_003099430.1\|158424_158832_+	regulatory protein GemA	I6PBV8	Pseudomonas_phage	7.9e-71	100.0
WP_010791914.1\|158818_159268_+	hypothetical protein	B7SDY2	Pseudomonas_virus	1.2e-80	100.0
WP_010791913.1\|159371_159719_+	hypothetical protein	B7SDY3	Pseudomonas_virus	2.0e-59	100.0
WP_012613779.1\|159711_160134_+	hypothetical protein	L7P7S9	Pseudomonas_phage	1.5e-72	100.0
WP_015994790.1\|160133_160550_+	virion protein	L7P7L2	Pseudomonas_phage	1.6e-74	100.0
WP_015994791.1\|160549_160792_+	hypothetical protein	B7SDY6	Pseudomonas_virus	2.6e-37	100.0
WP_044727365.1\|160788_161190_+	hypothetical protein	A0A0U5KQ39	unidentified_phage	4.9e-65	99.2
WP_003094538.1\|161300_161489_+	hypothetical protein	A0A0A1IVG3	Pseudomonas_phage	1.0e-25	100.0
WP_058162373.1\|161497_161998_+	DUF1804 family protein	A0A1C6ZDN3	Pseudomonas_phage	1.1e-82	99.4
WP_023465135.1\|161999_162536_-	hypothetical protein	Q6TM77	Pseudomonas_phage	1.3e-92	93.8
WP_058162372.1\|162534_164190_+\|terminase	phage terminase large subunit	A0A076FR23	Pseudomonas_phage	0.0e+00	98.9
WP_058162371.1\|164201_165788_+	DUF935 domain-containing protein	H6V8N7	Pseudomonas_phage	9.0e-304	99.2
WP_058162370.1\|165787_167074_+\|head	phage head morphogenesis protein	A0A0U5G7H2	unidentified_phage	1.5e-245	99.8
WP_033997460.1\|167073_167541_+	phage virion morphogenesis protein	H1ZZE4	Pseudomonas_virus	1.5e-78	100.0
WP_058162369.1\|167494_167716_+	winged helix-turn-helix domain-containing protein	X4Y6Q3	Pseudomonas_phage	3.2e-26	95.2
WP_058162368.1\|167934_169041_+\|protease	protease	H1ZZE8	Pseudomonas_virus	3.0e-205	99.2
WP_012613793.1\|169050_169449_+	hypothetical protein	A0A0U5KRP3	unidentified_phage	1.4e-67	100.0
WP_061363234.1\|169476_170385_+\|head	head protein	X4YFQ4	Pseudomonas_phage	1.6e-167	97.7
WP_031643702.1\|170396_170699_+	hypothetical protein	L7P7V5	Pseudomonas_phage	2.6e-47	99.0
WP_022580022.1\|170934_171351_+	DUF1320 domain-containing protein	A0A0U5KQ53	unidentified_phage	7.6e-61	100.0
WP_012613797.1\|171347_171827_+	hypothetical protein	L7P7M0	Pseudomonas_phage	1.3e-88	100.0
WP_003099460.1\|171814_171994_+	hypothetical protein	A0A0U5G7J8	unidentified_phage	2.9e-25	100.0
WP_061363235.1\|172026_172797_+	hypothetical protein	Q6TM61	Pseudomonas_phage	8.9e-140	98.8
WP_031670574.1\|172800_173295_+	hypothetical protein	I6PCB2	Pseudomonas_phage	3.0e-88	99.4
WP_061363236.1\|173445_177150_+	tape measure protein	B7SE05	Pseudomonas_virus	0.0e+00	98.9
176244:176260	attR	NA	NA	NA	NA
WP_061363237.1\|177156_178113_+	hypothetical protein	A0SMQ2	Pseudomonas_virus	1.6e-183	95.9
WP_061363238.1\|178114_179038_+	hypothetical protein	B7SE07	Pseudomonas_virus	1.2e-170	90.6
WP_061363239.1\|179037_180741_+	hypothetical protein	L7P802	Pseudomonas_phage	0.0e+00	95.6
WP_061363240.1\|180730_181552_+	DUF2163 domain-containing protein	I6PBD5	Pseudomonas_phage	5.2e-154	98.4
WP_061363241.1\|181560_181800_+	hypothetical protein	I6P9F0	Pseudomonas_phage	4.4e-37	97.5
WP_004367213.1\|181796_182015_+	hypothetical protein	I6P9E8	Pseudomonas_phage	3.4e-36	100.0
WP_061363242.1\|182004_184212_+	hypothetical protein	I6PCB1	Pseudomonas_phage	0.0e+00	97.1
WP_153971262.1\|184208_184562_+	DUF2793 domain-containing protein	A0SMQ9	Pseudomonas_virus	2.5e-65	97.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

11. NZ_LODH01000015

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

12. NZ_LODH01000030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

13. NZ_LODH01000008

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LODH01000008_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LODH01000008_1

85-408

Orphan

Consensus_repeat	Method
CNTGGNNGAGTGNTNCGGGCCGCANCACCCAGCTNNCCG	CRT

5 spacers

The CRISPR arrays of NZ_LODH01000008_1

>merge|NZ_LODH01000008|1|85-408|CRT
CTTGGCAGAGTGGTGCGGGCCGCACCACCCAGCTCACCGTCGGCGCCGAGGCCAGGACCTGGCAGAGTGTTGCGGGCCGCAACACCCAGCTTGCCGCCGGCGCCGAGGCCAGGACCTGGTGGAGTGTTGCGGGCCGCAACACCCAGTTTGCCGGCGGCGCTGAGGTCGATCCTTGGCAGAGTGGTGCGGGCCGCACCACCCAGCTCACCGTCGGCGCCGAGGCCAGGACCTGGCAGAGTGTTTCGGGCCGCAACACCCAGCTTGCCGCCGGCGCCGAGGCCAGGACCTGGTGGAGTGGTTCCAGTGGAAACACTCATCTTGCCG

>NZ_LODH01000008|1|1|85-408|CRT
CTTGGCAGAGTGGTGCGGGCCGCACCACCCAGCTCACCG	TCGGCGCCGAGGCCAGGA
CCTGGCAGAGTGTTGCGGGCCGCAACACCCAGCTTGCCG	CCGGCGCCGAGGCCAGGA
CCTGGTGGAGTGTTGCGGGCCGCAACACCCAGTTTGCCG	GCGGCGCTGAGGTCGATC
CTTGGCAGAGTGGTGCGGGCCGCACCACCCAGCTCACCG	TCGGCGCCGAGGCCAGGA
CCTGGCAGAGTGTTTCGGGCCGCAACACCCAGCTTGCCG	CCGGCGCCGAGGCCAGGA
CCTGGTGGAGTGGTTCCAGTGGAAACACTCATCTTGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LODH01000008.1\|WP_003103841.1\|6015_6249_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000008.1\|WP_003134081.1\|6728_6986_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000008.1\|WP_023098069.1\|2223_2991_-\|DUF2857-domain-containing-protein	unknown	unknown	gnl\|CDD\|378591
NZ_LODH01000008.1\|WP_023123982.1\|7499_7685_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000008.1\|WP_003111972.1\|4748_4997_-\|Arc-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|367702
NZ_LODH01000008.1\|WP_003141385.1\|6982_7510_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000008.1\|WP_033983907.1\|4999_6016_-\|nucleoid-associated-protein-YejK	unknown	unknown	gnl\|CDD\|178993
NZ_LODH01000008.1\|WP_003134082.1\|6241_6736_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000008.1\|WP_052152987.1\|3018_4752_-\|ParB-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|213858
NZ_LODH01000008.1\|WP_023103384.1\|901_2227_-\|hypothetical-protein	unknown	unknown	unknown

>NZ_LODH01000008.1|WP_023103384.1|901_2227_-|hypothetical-protein
MRLSRFPISTLLDSASGHLEAHLYKKRLAAESGEPLAQQYSGIIFSGNPHETVPRRLLLDKRLTPLERNCWQVFRLLINDDGLTAFPTYEQLRPYLGMQPGKIASRETIAKALTVLRLTRWLSLGRRLRNDLNGQVQGNVYILHDEPVSPAEALELDTDYMQLLSQSTGHGNRAIREIGQIIWREFRDDPDVGRRLPTHLEKLEGRLNHQQWAIDSQLEADPAAEFGIRTLSDLPHSTPSSDAELSEISSKQCALPLSSDAEPRQNPPSTPLVRMPNSYSTYTYKQDSVCKKPVQPRAREEAHPNWQDLLHALEAEQRIQAVSALRRVSEDLRLPIIEQWQHRCAGGTVSNPFGYLMTLIQRAVQGKFNASWAPEEPAERTIPATERPIRAPAPSSPIAPTQPQVQHRGDTRTGSEVLSRLKDLIRPRHGSSVPSERGDEP
>NZ_LODH01000008.1|WP_023098069.1|2223_2991_-|DUF2857-domain-containing-protein
MSKSLINEAVLTQVLNHLRNGQLRRCAEMGLRPEILAQLQQPAVMSILTNTPVSWVDVRVNIDVMEKILATAERSAQEDLQIERALKLGATTTMIQSFFGLSPEDTATKRLMLEIHPRRGRWRQLDEQIERQIWFRWEHLMHENQVRLEDSMELLDIAMILTEEINAGIEQDSPEFISLAIVWSLIQSWLKDGLYPSGKSSQSQAGLQKSQSTLYLASVSSHLPHSAPSATTQVNAETERQQLLNLVQSEGDTAP
>NZ_LODH01000008.1|WP_052152987.1|3018_4752_-|ParB-N-terminal-domain-containing-protein
MSMAKINPQDLKDRLLAPGFTAPPVLEQLSDPISDTPMRLTLHDVLPWHDNPRTTRNPKYDELKESIRHRGLDTPPPVTRRPGEDKYRIRNGGNTRLEILNELYKETGDERYFSFDCLFKPWDKQRGEIIALTGHLAENDLKGELKFIERAVGIQKAKALYEEEKGEPVGIRELSRKLTDDGYPVSPSHISRMLDAVEILLPAIPSMLYSGLGVDRVSRILSLRKASLGCWKRLYSGEGVDFEMLFQDTLAIFDSSPDEFIFDRFQDELIDQMKRPLGLRYDQILLEITNGQQEQRRGTLVDLPAPAAPPEIPPVGQESPAASTTGQAQSQSPAAGLQTSKTNSLPGNSSTPPTPPLPVQQQQLTDEERAELLAGHIVSPVSTKIQQTRQRLAALEGEHLPVFEETALQAIPVQVGGLHPITDLWYIERSIDTPEILRQHIADLAEEIALHVGAPGEIVRIQGGVGYTYREPNEDHEITDSALHLMTLLQAVSGQVQVVLNTHDQQTCRDALGEFQFSAGLAQLLLGQPTTSDQPSSQADRLNDEALVKLFRIIRLARRLVDLELPPAASEQAATDQ
>NZ_LODH01000008.1|WP_003111972.1|4748_4997_-|Arc-family-DNA-binding-protein
MARETEDKFVVRMPLGLRDQLKQKAAHNHRSANSEIVYRLERSNELEEELARANRMVDELFAKNQRLQAELAAANTPQVAEA
>NZ_LODH01000008.1|WP_033983907.1|4999_6016_-|nucleoid-associated-protein-YejK
MPIKHAIVHLIEKKPDGTPAVLHARDAELGDSQAIENLLADLNESYNAKNKAWGFFQGESGAYPFSGWLGEYLEGDRDFVGFSREAVEHLQKLMEESNLSTGGHILFAHYQQGMTDYLAIALLHHSEGVAVNESLEVTPSRHLDLGQLHLAARINISEWRNNKQSKQYISFIKGKGGKKVTDYFRDFIGCQEGIDSPGETRALLKAFSEFVESEGMAEQQAREKTETLVDYATSQARIGEPMTLDALSELMDEQQPRAFYDYIRNKDYGLSPEIPADKRTLNQFRRFTGRAEGLSISFESHLLGSRIEYDEERDTLQISSLPTQLRDQLKRRKAQIGE
>NZ_LODH01000008.1|WP_003103841.1|6015_6249_-|hypothetical-protein
MRSFLRGARESVRRLVAFAQAEGWSVDRSAGGHLKLSKIGCASIFISSTPSDARGELNARALLRRADRQRSLNQESF
>NZ_LODH01000008.1|WP_003134082.1|6241_6736_-|hypothetical-protein
MPDVTAYRPLEHFQKVELMLELKLREGPSWICLNCGYHLDGSGAQPCPDCGKSRYWTSGWSVGRGHRFSAAREEWENRLRTRSRSPVASTAPVATDDVCTQLRTEVRMLRSAHDDLACSRQSDRRSLQALVKRLLDAAATDSLPRSLAEMETWLQLNSEETTNA
>NZ_LODH01000008.1|WP_003134081.1|6728_6986_-|hypothetical-protein
MKASQTYQCIVKFDGAGFWTNTIQKQRATCTWSDKVAASRLAERLFGEDNAYITRMPVQAGDHEKRIESRWALSCRNPKEVARDA
>NZ_LODH01000008.1|WP_003141385.1|6982_7510_-|hypothetical-protein
MNTEARFPSIHASAAFTDSAVVHANHVGVNPIELDALSQVISRLSRDESTVAPSSMERELRELEELGYIEISTTQAGTLVVTTRAPGQLLSAYFWSVWIPRHLFSCSLKVSLVPHLCCGTQDSQHLTAVFRIAGSKDAAREFLHQLANNYPGHEPELPELVAVQVGDALSKEAES
>NZ_LODH01000008.1|WP_023123982.1|7499_7685_-|hypothetical-protein
MNTSQPLVTHQCMNCDQHHPHHLVRQVLPAENTPEGEAELLVCPCCGSYDVHQLEAVFDEH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LODH01000008_1	1.1\|124\|18\|NZ_LODH01000008\|CRT	124-141	18	NZ_LODH01000008.1	10-27	0	1.0
NZ_LODH01000008_1	1.4\|295\|18\|NZ_LODH01000008\|CRT	295-312	18	NZ_LODH01000008.1	10-27	0	1.0
NZ_LODH01000008_1	1.1\|124\|18\|NZ_LODH01000008\|CRT	124-141	18	NZ_LODH01000013.1	63890-63907	1	0.944
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000008.1	67-84	1	0.944
NZ_LODH01000008_1	1.4\|295\|18\|NZ_LODH01000008\|CRT	295-312	18	NZ_LODH01000013.1	63890-63907	1	0.944
NZ_LODH01000008_1	1.1\|124\|18\|NZ_LODH01000008\|CRT	124-141	18	NZ_LODH01000001.1	208356-208373	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000007.1	332080-332097	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000015.1	50084-50101	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000037.1	21900-21917	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000037.1	76535-76552	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000041.1	82488-82505	2	0.889
NZ_LODH01000008_1	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	NZ_LODH01000070.1	21814-21831	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000001.1	67403-67420	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000006.1	67523-67540	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000009.1	205842-205859	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000018.1	51903-51920	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000030.1	49628-49645	2	0.889
NZ_LODH01000008_1	1.3\|238\|18\|NZ_LODH01000008\|CRT	238-255	18	NZ_LODH01000035.1	33575-33592	2	0.889
NZ_LODH01000008_1	1.4\|295\|18\|NZ_LODH01000008\|CRT	295-312	18	NZ_LODH01000001.1	208356-208373	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000007.1	332080-332097	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000015.1	50084-50101	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000037.1	21900-21917	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000037.1	76535-76552	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000041.1	82488-82505	2	0.889
NZ_LODH01000008_1	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	NZ_LODH01000070.1	21814-21831	2	0.889

1. spacer 1.1|124|18|NZ_LODH01000008|CRT matches to position: 10-27, mismatch: 0, identity: 1.0

tcggcgccgaggccagga	CRISPR spacer
tcggcgccgaggccagga	Protospacer
******************

2. spacer 1.4|295|18|NZ_LODH01000008|CRT matches to position: 10-27, mismatch: 0, identity: 1.0

tcggcgccgaggccagga	CRISPR spacer
tcggcgccgaggccagga	Protospacer
******************

3. spacer 1.1|124|18|NZ_LODH01000008|CRT matches to position: 63890-63907, mismatch: 1, identity: 0.944

tcggcgccgaggccagga	CRISPR spacer
tccgcgccgaggccagga	Protospacer
** ***************

4. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 67-84, mismatch: 1, identity: 0.944

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgccgaggtcgatc	Protospacer
*******.**********

5. spacer 1.4|295|18|NZ_LODH01000008|CRT matches to position: 63890-63907, mismatch: 1, identity: 0.944

tcggcgccgaggccagga	CRISPR spacer
tccgcgccgaggccagga	Protospacer
** ***************

6. spacer 1.1|124|18|NZ_LODH01000008|CRT matches to position: 208356-208373, mismatch: 2, identity: 0.889

tcggcgccgaggccagga	CRISPR spacer
tcagcgccgagaccagga	Protospacer
**.********.******

7. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 332080-332097, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgcggagaccagga	Protospacer
******* ***.******

8. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 50084-50101, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgtcgaggccggga	Protospacer
******.*******.***

9. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 21900-21917, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgcagcggccagga	Protospacer
******* * ********

10. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 76535-76552, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********

11. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 82488-82505, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********

12. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to position: 21814-21831, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccgccgccgaggccatga	Protospacer
*** *********** **

13. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 67403-67420, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcgccgctcaggtcgatc	Protospacer
*** **** *********

14. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 67523-67540, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgccgaggttgatc	Protospacer
*******.*****.****

15. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 205842-205859, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgctgatgtcgttc	Protospacer
********** **** **

16. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 51903-51920, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgctgaagccgatc	Protospacer
**********.*.*****

17. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 49628-49645, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgttgatgtcgatc	Protospacer
******.*** *******

18. spacer 1.3|238|18|NZ_LODH01000008|CRT matches to position: 33575-33592, mismatch: 2, identity: 0.889

gcggcgctgaggtcgatc	CRISPR spacer
gcggcgctgccgtcgatc	Protospacer
*********  *******

19. spacer 1.4|295|18|NZ_LODH01000008|CRT matches to position: 208356-208373, mismatch: 2, identity: 0.889

tcggcgccgaggccagga	CRISPR spacer
tcagcgccgagaccagga	Protospacer
**.********.******

20. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 332080-332097, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgcggagaccagga	Protospacer
******* ***.******

21. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 50084-50101, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgtcgaggccggga	Protospacer
******.*******.***

22. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 21900-21917, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccggcgcagcggccagga	Protospacer
******* * ********

23. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 76535-76552, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********

24. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 82488-82505, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********

25. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to position: 21814-21831, mismatch: 2, identity: 0.889

ccggcgccgaggccagga	CRISPR spacer
ccgccgccgaggccatga	Protospacer
*** *********** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

14. NZ_LODH01000014

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

15. NZ_LODH01000009

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

16. NZ_LODH01000001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

17. NZ_LODH01000043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

136 : 7762

uncultured_Caudovirales_phage(33.33%)

integrase

attL 844:856|attR 7495:7507

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023127771.1\|136_994_+	DNA adenine methylase	Q5QF26	Pseudomonas_virus	1.1e-125	76.3
844:856	attL	NA	NA	NA	NA
WP_023127213.1\|981_1224_+	hypothetical protein	NA	NA	NA	NA
WP_033991663.1\|1216_1420_+	hypothetical protein	A0A2H4J958	uncultured_Caudovirales_phage	4.7e-08	48.3
WP_003098423.1\|1412_1616_+	AlpA family phage regulatory protein	A0A2H4J8C8	uncultured_Caudovirales_phage	2.0e-06	44.2
WP_023127772.1\|1622_2825_-\|integrase	integrase family protein	A0A248SL35	Klebsiella_phage	2.6e-37	30.9
WP_003158602.1\|3277_5206_+\|integrase	tyrosine-type recombinase/integrase	A0A0U1UNT3	Pseudomonas_phage	2.2e-94	45.0
WP_003158603.1\|5757_6513_+	hypothetical protein	NA	NA	NA	NA
WP_003158604.1\|6631_6844_+	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_003158605.1\|6886_7762_+	ParA family protein	A0A240F4U1	Ochrobactrum_phage	4.4e-10	29.9
7495:7507	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

18. NZ_LODH01000076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LODH01000076_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LODH01000076_1

17925-18135

Orphan

Consensus_repeat	Method
ACGTCGATGTTGCCGTTGTTGATGACATCGCC	PILER-CR

2 spacers

The CRISPR arrays of NZ_LODH01000076_1

>merge|NZ_LODH01000076|1|17925-18135|PILER-CR
CGACGATGTTGCCGCTGTTGATGACATCGCCTTCCAGCTTCGTGTTGCCGATCTCGATACCACGGGCTTTGTCGGTTTCTACGCCGTCCGGATCATCCAGGACGTCGATATTGCCGTTGTTGATCAGGCTGTTGGCACGGACGCCGTCCATCACGATACCGACCGCGCCGGCCCCGGTCAGGTCGATGTTGCCGTTGTTGATGATGTCGCC

>NZ_LODH01000076|1|1|17925-18135|PILER-CR
CGACGATGTTGCCGCTGTTGATGACATCGCCT	TCCAGCTTCGTGTTGCCGATCTCGATACCACGGGCTTTGTCGGTTTCTACGCCGTCCGGATCATCCAGGA
CGTCGATATTGCCGTTGTTGATCAGGCTGTTG	GCACGGACGCCGTCCATCACGATACCGACCGCGCCGGCCCCGGTCAGGTCGATGT
TGCCGTTGTTGATGATGTCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LODH01000076.1\|WP_010792947.1\|12265_12649_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_010792946.1\|12747_13803_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271180
NZ_LODH01000076.1\|WP_010792951.1\|8353_9622_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197216
NZ_LODH01000076.1\|WP_010792942.1\|18998_21935_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_021018614.1\|14623_14920_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_010792952.1\|7824_8298_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_042931309.1\|21959_22337_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212463
NZ_LODH01000076.1\|WP_010792949.1\|11349_11643_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_044288737.1\|22665_23964_-\|translesion-error-prone-DNA-polymerase-V-subunit-UmuC	unknown	unknown	gnl\|CDD\|179607
NZ_LODH01000076.1\|WP_010792950.1\|9762_11343_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|277335
NZ_LODH01000076.1\|WP_021018618.1\|11644_12070_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_034036499.1\|27196_27904_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_010792944.1\|14946_15792_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NZ_LODH01000076.1\|WP_021018615.1\|14063_14591_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000076.1\|WP_010792936.1\|26165_27026_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|130771
NZ_LODH01000076.1\|WP_038405176.1\|25189_26014_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376772

Protein	Function_ID	Function_description	E-value
NZ_LODH01000076.1\|WP_042931309.1\|21959_22337_-\|hypothetical-protein	gnl\|CDD\|212463	cd01716, Hfq, bacterial Hfq-like. Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotropic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others. Hfq binds small RNA molecules called riboregulators that modulate the stability or translation efficiency of RNA transcripts. Hfq binds preferentially to unstructured A/U-rich RNA sequences and is similar to the eukaryotic Sm proteins in both sequence and structure. Hfq forms a homo-hexameric ring similar to the heptameric ring of the Sm proteins.	0.00410386
NZ_LODH01000076.1\|WP_010792950.1\|9762_11343_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|277335	cd07389, MPP_PhoD, Bacillus subtilis PhoD and related proteins, metallophosphatase domain. PhoD (also known as alkaline phosphatase D/APaseD in Bacillus subtilis) is a secreted phosphodiesterase encoded by phoD of the Pho regulon in Bacillus subtilis. PhoD homologs are found in prokaryotes, eukaryotes, and archaea. PhoD contains a twin arginine (RR) motif and is transported by the Tat (Twin-arginine translocation) translocation pathway machinery (TatAyCy). This family also includes the Fusarium oxysporum Fso1 protein. PhoD belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.24651e-34
NZ_LODH01000076.1\|WP_010792951.1\|8353_9622_+\|hypothetical-protein	gnl\|CDD\|197216	cd09117, PLDc_Bfil_DEXD_like, Catalytic domain of type II restriction endonucleases BfiI and NgoFVII, and uncharacterized proteins with a DEAD domain. Catalytic domain of type II restriction endonucleases BfiI and NgoFVII, uncharacterized type III restriction endonuclease Res subunit, and uncharacterized DNA/RNA helicase superfamily II members. Proteins in this family are found mainly in prokaryotes. They contain one copy of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue) in a single polypeptide chain, and have been classified as members of the phospholipase D (PLD, EC 3.1.4.4) superfamily. BfiI consists of two discrete domains with distinct functions: an N-terminal catalytic domain with non-specific nuclease activity and dimerization function that is more closely related to Nuc, an EDTA-resistant nuclease from the phospholipase D (PLD) superfamily; and a C-terminal domain that specifically recognizes its target sequences, 5'-ACTGGG-3'. BfiI forms a functionally active homodimer which has two DNA-binding surfaces located at the C-terminal domains but only one active site, located at the dimer interface between the two N-terminal catalytic domains that contain the two HKD motifs from both subunits. BfiI utilizes a single active site to cut both DNA strands, which represents a novel mechanism for the scission of double-stranded DNA. It uses a histidine residue from the HKD motif in one subunit as the nucleophile for the cleavage of the target phosphodiester bond in both of the anti-parallel DNA strands, while the symmetrically-related histidine residue from the HKD motif of the opposite subunit acts as the proton donor/acceptor during both strand-scission events.	1.8709e-18
NZ_LODH01000076.1\|WP_010792936.1\|26165_27026_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|130771	TIGR01710, Type_II_secretion_system_protein_G, type II secretion system protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	6.61962e-10
NZ_LODH01000076.1\|WP_044288737.1\|22665_23964_-\|translesion-error-prone-DNA-polymerase-V-subunit-UmuC	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	6.75201e-172
NZ_LODH01000076.1\|WP_010792944.1\|14946_15792_-\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	0.00204438
NZ_LODH01000076.1\|WP_010792946.1\|12747_13803_+\|site-specific-integrase	gnl\|CDD\|271180	cd00799, INT_Cre_C, C-terminal catalytic domain of Cre recombinase (also called integrase). Cre-like recombinases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.	8.01026e-50
NZ_LODH01000076.1\|WP_038405176.1\|25189_26014_-\|hypothetical-protein	gnl\|CDD\|376772	pfam02369, Big_1, Bacterial Ig-like domain (group 1). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial surface proteins such as intimins and invasins involved in pathogenicity.	7.35564e-08

>NZ_LODH01000076.1|WP_010792944.1|14946_15792_-|alpha/beta-hydrolase
MYIALNRIILAAGALLALSGCANNVNLKEISSGSSLHPEVLLSSPYNIQALVPAGTRYRTLRVYIEGDGHAWATRTQPSTDPTPHTSLMAQFAAEDPAPAAYLARPCQFVITGACKPALWTSERFGRASVDAMNSALNNLKSRYRTESFELVGYSGGAAIALILAGERDDVGQVQTIAGNVDPVTWTKLKNITPLLGSLSPLEYSARLAGIPQRHLIGQNDEVVPAEVVRAYSLQVQAKCLSTVVVPSASHDRGYADAWRAVRDLPFNCDMSGSPQSSQAE
>NZ_LODH01000076.1|WP_021018614.1|14623_14920_-|hypothetical-protein
MQQQIIIQPEGSELIYEVLVSHDGGTVWVNCSDGNSVGRFSKHAGIDLHRTIAEQMAGEGQCLDCTHEPAGPEEWERFCGGLTQHFNVTLPPDLIRFP
>NZ_LODH01000076.1|WP_021018615.1|14063_14591_-|hypothetical-protein
MLKKLKDQIAVQWGRFTGWLDVLERRWKSYWLKRVASATAFAMVAGFTLLALYGPAVSVSYLVTAAGLLLVALSLLVRFKFLQDLATLSGVALAAWWYVQSLPGVFNPVQHVRFDAEPQTSGFFVLPKTRPQGKSQIDDCDFDSASSTLTCSVRVVPVPPEKTVEAPDDRLSLQP
>NZ_LODH01000076.1|WP_010792946.1|12747_13803_+|site-specific-integrase
MSKRPDNDNAGNKVMAMDFELKSALIDSAAGSPNTDKAYRQAREHFKSNGGLLPATEEMVDRYVRTFAGELSVNTLQLRVAAIAKWHQEFGFPDPTKSKVKRTMKGIRALFNKAPKKALPIAIENLRKMIDYLDTAERAAISAGDLAKQLAASRNRALVLIGFWRAFRSDELSRIEAHNITVIPDRDMRIFLRKTKHDRDALGQEFIVPALIELCPVRAYTHWLEDSGIHYGPVFRPITRWGRMADEGLSSSAIGPILRRVAEAAGVEQRYTSHSFRHGFANWAIDEGWDLISMMRYVGWKSVQNAQGYVQPKFNFGKLAIGQPASLSAPRWEPGHGEVFPGIAERLEDDE
>NZ_LODH01000076.1|WP_010792947.1|12265_12649_+|hypothetical-protein
MTDFTSGFNTTNLKVLRGLINSALANLHPEISIEAGKITYDPQGTCTIKVEATVKGAKSKAQTELEQAANLYGYDVSQTKPHTSLGPCKLVGFNSRARKSPWIVECPKGRYKLEDDVVERMWGQSKQ
>NZ_LODH01000076.1|WP_021018618.1|11644_12070_-|hypothetical-protein
MKRAIVLSLVLTSVAGCDALTEMAANVSQAFIAQYPDLQKPISLVFVPGYKVMIGGKATPITGEDTCPPQDGVMAKLFGPNPYEGSNKCVEVSPTATEVHVKFPDVAAGGSLKEEKWSVLRDGGRVALRRPNGDFVTPEKS
>NZ_LODH01000076.1|WP_010792949.1|11349_11643_-|hypothetical-protein
MQRGDKLKSFKTEVVIPLLILGLIAIWNMDRLAATFFEAEHATVRLKNCASAECELHGTLRIEPMSGDYLLTSVEGRVTRFPQSSLASARWPAKIAK
>NZ_LODH01000076.1|WP_010792950.1|9762_11343_+|alkaline-phosphatase-family-protein
MSLLLGPILHFRGIHNDLYQVSALVVLDKGDPKPKPEPTNCVVDKVTRIASIPFGSPTQDVWRVDLSTSQKAAKSQQCSCSVSGGKASFFVPALGESPRVAYGSCNGFSADKYRKKVKDRQNERWFDMAARHKIKGKEFHVLVMGGDQVYTDDLMVIPGEMKDWADLWHSKQVAAKWSRKLEKQVDEYFTQLYVQRWNQAGPREMLQSIPYVAMWDDHDITDGWGSYPQDLHECDVYQNLFRLATRYYRLFQQQLAEDEVHPSAVPNQSPQAKGFSLAYSGLGEVAFLVPDLRSERHPDLKRPDGLSPTQIVSEYTWEAIFAWLDQLDTSKHKHLIVYSSLPVAYLDLNAAEVALNALPGQWELEDDLRDHWRSKPHRDERQRLIKRLLNFSAKGTRVTIVSGDVHVAAAAVIESMLPQHGNGAGAIFQLVSTGIVHTPPPAVAVYFMEKFGAGEEVIEYGVHARMLPIGFKGHYLVPERNWLSLEPDGKGRIWANWHVEGHDHLLTQVIDPVVLPTMLQPVVMNQ
>NZ_LODH01000076.1|WP_010792951.1|8353_9622_+|hypothetical-protein
MADSSIFTNSPGQDQVLRPFQRLISTASHIRLAAPYFTRPGEILEAAERGAKIDLLVGLNPATNPAALRQALEADNCSIRYFTDGFHAKIFLFDGVAMLGSANLTDGGLVSNREAVVLLDQPGDEERIRDLEALFAVLWDSAEVLTRQVYLKFKDAWEKASRMDSRDTPFQSLADVEPPTVLAGSGHKTAQQHYLSDLRKTIYEQYLPAFEEVAAILREQGTRRPEFNGLAWGPEVNRYLNWVRLEHAPGDAAWQDAPIRRPQDRRTQIQTLVMEWLSTATPRIPEDYFELLETLHAVMESPESIRASSKEQIAAALMCVHAFSEQLRFTLGGAEALPAKFWEGNREDLGRVQDTLIYLIHGHEEFAARIGSVLYDPKYKLASFGRFCALELVGTLKPEQVPPINGRMAKALRFLGFDVRAT
>NZ_LODH01000076.1|WP_010792952.1|7824_8298_+|hypothetical-protein
MPSPEHDKLTAMGARWFKKNGFPVVTTEIWAAGSRERPDVLGFRSMCSGVIEVKVSLSDFRADRLKPERVSGGLGNYRFYLCPEGLIRPEDLPARWGLLYAKGRSVVPVVSPPGNLWPGVPRNALEEDLAAEWLPFLHRPDLDAERAALFSIARRLS
>NZ_LODH01000076.1|WP_010792942.1|18998_21935_+|hypothetical-protein
MLSSATISVDDLQARALAADEAAKQEFRNKVLSYANDFRFALKEASRLLGVSAGFLRNYAARNNIEFSDPELRTKEESKSIFKQYEEIRLSKEPKRVEPRKPLLKPDELQLPPQLDLLSKKAHWERQNKFLERVQELAQTMTMKEVSKLVGVSLRFLKNFSYEHDIEFVGSKARPVNEALSPVFIAEEPPCPKLIQFLSRPMPRATDIYEDEITESEEVLNTEQVDSLAIVEAVTAPESSECTAPTEAQVEVVQDQSVGGNSEFDRYSPKAPALRSDTDLNILTLPHNRADETISTSASVDQLTAAGASPGINGERLLGNLPLPATFVNQRSQGAAWTAWYGSAKAVASVFEQICKAKISALGDTRMLMRVPPHAALTSLFISPQCFTAIVDAFPADEAANLFPASRLEANLKHLLGAEVGEIRSLSNGGSAAEVARAVESIWPWTSRLHDHGGFSRHNCVTLLTIGALLKAFHRPNLASTDGFRIDMAITTLLSLLPDPLDRLIATSSTRVRQIGYAGLAGVEVADEAGAGEFWQAVGTETFIACVNEVKRRAPKIESGLTRVSSSELKVFELERTLLAARPDSQVLHEIYSDFVSNTGSPNWNSLLDSLESYSATTEIPLDAKVFTRDLFNKPIQKLPTPTLEAVQILRKAICTSLLQEEPLAFQQRAERQMDAVQKVQSQIKDLGDNLTAANMLKLADLAEQGRTQILASREWFESEIKTYAAEVQHWREFFADWQRLAAPAEQLKEKAKSKGKEQPVQVVEPVPESDVVKELRSELADAEDRNQHLEQELKVAKSEAHRLRQAADARPLPTQQFAPEVEPSLLRRIATRKGITPVDVLAYLQVTSGDRVEILESAWKSAKASEKFAYSERMLDLLDTLVNPYFDSLAAGNPDSVSRELLGGAYVAKESDATSNCGKMRAQREFSYQGQRMYFERHLRVGSGIGNQVCMRIYFQIIDSKIVIAYAGEHLEIASTN
>NZ_LODH01000076.1|WP_042931309.1|21959_22337_-|hypothetical-protein
MIDRSQVEQNRYLDYCLKHKVEISIILISGTHFIGFVLDHDRKGLLLGGKREDKPARYISKGYIALIRPNKDEELELFLEYRGMGTFLQRKRQNQALKKLKARGSQGGKAGGPTPKKLSLRPAID
>NZ_LODH01000076.1|WP_044288737.1|22665_23964_-|translesion-error-prone-DNA-polymerase-V-subunit-UmuC
MGSDQHAAQEHAVSVFALVDCNSFYCSCERIFRPDLAQKAVVVLSNNDACIIARSREAKALGLKMGDPYFKVKRFLDQRGVTAFSSNYALYADVSNRVMRTISTLVASIEVYSVDECWCDLTGMPGDLEQLGRDIQARVRQWVNIPVGVGIGPTKTLAKLAQWAGKNWPATGGVVNLMDSQRQQKLLKLAPVGEVWGVGRKLSSQLETLGIKTAFDLASADPRHIGRMFSKVLERTARELRGEQWLKMHDDPDPKKEIVSSKMFGRRVYLLEELRQAVAAYTTRAAEKLREQDSVCSELVVSVQTSPFADPAERYWNGARMLLPTPTADTRDLIQAANQGLHGIYRDGFAYSKCTIQLCRLSQLEGLTHDMFAPQPRRNVDSLMATMDLVNERFGRGALRVASIPVEAGWAMRREMLSPSYTTSWRELPRAR
>NZ_LODH01000076.1|WP_038405176.1|25189_26014_-|hypothetical-protein
MGLTIVIQATPGSLAALGEKATLVATVQDYDGNNAGRGVVINWTTSDGGLSAATTTTDANGQTSVVLTSSKTIGGATVSATSPAEGGTGQITVPFTDKWVSTSAMYSAWQDSGAPYSCSAWSPDASTINQGTSFTQSAVCYQNQIAYQQNREVSLVTGQVRNVGGVIPLYQTVQAARSQQAVGTKQSTPSCAWSSFTKNGVYATGWDHGVSNTGGPKQGYRLYLGQYIGEVANATDSFAYNGRIYTIGKFRQSTCLGKNCASSREEYEACSVPQ
>NZ_LODH01000076.1|WP_010792936.1|26165_27026_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MGRECQQGFTLMELAIVLAITAMLAAAAVPNYMTRVNQKRADTTVQDTQAIIDAARAYRSEKGTWPGDATCSNAIQALGATTPPMLAGVSNINRYNYPITTSCTQYTFSVDQNTTQDWDGVVVNGLPGSQIINSSTYQIRTTVGVPGTEPALDGKLSRLASANAEMNRMRTNLLMGNNDINEVNAVNAQTLNAAGAVNAQTVAATGNISTAGYVEFTGTAAEGGGCAKAGLVATTSTGAQLTCQGGKWVKSVIWSPAIVSTGQSCASFPKGSLAFDSAGNLYVCKP
>NZ_LODH01000076.1|WP_034036499.1|27196_27904_+|hypothetical-protein
MMTDPGPEQASANIGEQLESPYTRIRYAGEKALHRLLPIAQGDGIQNQVVRSLLLGCYNGQDFPIDPASLRVLNRSVMEDCIALLLMDSAPAMEVHQYVENGSSVYNGMAERWQPPSRIQMQIPTSEDETSEVLRTLGKKSLQHLIAVAQGFSGQCRHIARFLVGCYDGCRYPFDPTRFRCIDHDLFLECIAVIRLLYETRHGIDKNILEGVSVFNRLIQDWSIEPYSADAEAVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	36265-36319	0	1.0
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	257505-257559	0	1.0
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	122500-122554	0	1.0
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	44775-44829	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	28264-28318	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	183990-184044	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	191945-191999	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	234828-234882	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	70171-70225	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	187709-187763	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	191402-191456	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	208093-208147	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	196427-196481	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	354045-354099	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	35526-35580	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	113664-113718	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	211283-211337	1	0.982
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	329126-329180	2	0.964
NZ_LODH01000076_1	1.2\|18059\|55\|NZ_LODH01000076\|PILER-CR	18059-18113	55	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	29793-29847	2	0.964
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	36343-36412	10	0.857
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	257583-257652	10	0.857
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	122407-122476	10	0.857
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	329204-329273	12	0.829
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	29700-29769	12	0.829
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	44853-44922	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	28342-28411	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	183897-183966	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	191852-191921	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	234735-234804	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	70078-70147	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	187616-187685	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	191309-191378	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	208000-208069	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	196334-196403	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	353952-354021	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	35604-35673	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	113742-113811	14	0.8
NZ_LODH01000076_1	1.1\|17957\|70\|NZ_LODH01000076\|PILER-CR	17957-18026	70	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	211190-211259	14	0.8

1. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 0, identity: 1.0

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	Protospacer
*******************************************************

2. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	Protospacer
*******************************************************

3. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 0, identity: 1.0

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	Protospacer
*******************************************************

4. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

5. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

6. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

7. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

8. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

9. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

10. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

11. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

12. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

13. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

14. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

15. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

16. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

17. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 1, identity: 0.982

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacggacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
************************************************ ******

18. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.964

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacgaacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
***************.******************************** ******

19. spacer 1.2|18059|55|NZ_LODH01000076|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.964

caggctgttggcacggacgccgtccatcacgataccgaccgcgccggccccggtc	CRISPR spacer
caggctgttggcacgaacgccgtccatcacgataccgaccgcgccggcgccggtc	Protospacer
***************.******************************** ******

20. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 10, identity: 0.857

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	Protospacer
************************************************************

21. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 10, identity: 0.857

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	Protospacer
************************************************************

22. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 10, identity: 0.857

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	Protospacer
************************************************************

23. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 12, identity: 0.829

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
tgccagcttggtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	Protospacer
* ******* **************************************************

24. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 12, identity: 0.829

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
tgccagcttggtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	Protospacer
* ******* **************************************************

25. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

26. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

27. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

28. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

29. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

30. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

31. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

32. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

33. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

34. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

35. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

36. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

37. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

38. spacer 1.1|17957|70|NZ_LODH01000076|PILER-CR matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 14, identity: 0.8

ttccagcttcgtgttgccgatctcgataccacgggctttgtcggtttctacgccgtccgg	CRISPR spacer
cgccagcttggtgttgccgatctcgatgccacgggctttgtcggtttctacgccgtccgg	Protospacer
. ******* *****************.********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

19. NZ_LODH01000053

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

210 : 16835

Pseudomonas_phage(89.47%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003160559.1\|210_495_-	hypothetical protein	A0A2K8HN48	Pseudomonas_phage	8.0e-46	100.0
WP_025991793.1\|570_957_-	hypothetical protein	A0A2K8HZQ6	Pseudomonas_phage	2.1e-65	100.0
WP_061363319.1\|3307_5074_-	DEAD/DEAH box helicase	A0A0U1UNQ7	Pseudomonas_phage	0.0e+00	99.7
WP_022579942.1\|5070_5451_-	hypothetical protein	A0A2K8HNT1	Pseudomonas_phage	2.7e-65	99.2
WP_021264616.1\|5447_5771_-	DUF4406 domain-containing protein	A0A2K8I958	Pseudomonas_phage	1.0e-57	99.1
WP_060852945.1\|5767_6262_-	DUF550 domain-containing protein	A0A2K8HR09	Pseudomonas_phage	5.2e-93	99.4
WP_061363320.1\|6411_6840_-	hypothetical protein	H2BD44	Pseudomonas_phage	8.0e-74	97.9
WP_033966924.1\|6836_7643_-	class I SAM-dependent methyltransferase	A0A2K8I312	Pseudomonas_phage	1.6e-155	99.6
WP_061363321.1\|7639_9733_-	DNA methyltransferase	J7HXB9	Pseudomonas_phage	0.0e+00	85.3
WP_061363322.1\|9729_10584_-	DNA adenine methylase	Q5QF26	Pseudomonas_virus	4.4e-164	98.6
WP_061363323.1\|10730_10940_-	hypothetical protein	A0A0U1UNR9	Pseudomonas_phage	3.1e-31	98.6
WP_061363324.1\|10936_11992_-	nucleoid-associated protein YejK	A0A2K8HR80	Pseudomonas_phage	1.2e-200	99.4
WP_033970932.1\|12018_12945_-	recombination-associated protein RdgC	A0A0U1SXS1	Pseudomonas_phage	7.1e-168	98.7
WP_061363325.1\|12971_13469_-	single-stranded DNA-binding protein	L7TJL2	Pseudomonas_virus	5.4e-90	97.6
WP_004349164.1\|13472_14078_-	3'-5' exonuclease	A0A0U1W072	Pseudomonas_phage	7.3e-113	100.0
WP_061363326.1\|14207_15224_-	DUF1351 domain-containing protein	A0A0U1UNR0	Pseudomonas_phage	5.5e-121	98.8
WP_015975436.1\|15228_15984_-	hypothetical protein	A0A0U1UNQ9	Pseudomonas_phage	5.3e-145	100.0
WP_004354971.1\|16245_16617_-	hypothetical protein	A0A2K8HNX4	Pseudomonas_phage	3.4e-60	99.2
WP_004354968.1\|16613_16835_-	hypothetical protein	A0A0U1SZL8	Pseudomonas_phage	2.2e-35	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

20. NZ_LODH01000013

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

21. NZ_LODH01000003

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

115644 : 122538

uncultured_Caudovirales_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003097631.1\|115644_116925_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
WP_003160439.1\|116926_118324_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003097628.1\|118328_119303_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003097625.1\|119390_120374_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.5e-141	74.0
WP_003119979.1\|120370_120706_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.5e-38	69.4
WP_003090391.1\|120702_121008_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.5e-21	58.6
WP_003090389.1\|121007_121367_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
WP_003090387.1\|121363_121759_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
WP_003090386.1\|121869_122538_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

22. NZ_LODH01000037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

23. NZ_LODH01000059

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LODH01000059_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LODH01000059_1

4496-4586

Orphan

Consensus_repeat	Method
TTCCCGGTTTAGCATGCGAAACTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LODH01000059_1

>merge|NZ_LODH01000059|1|4496-4586|CRISPRCasFinder
TTCCCGGTTTAGCATGCGAAACTGGGTTCAAATTTTCCGGCTGATGACTTTCCTGCGGAGCATCCGGTTCCGGTTTAGCATGCGAAACTGG

>NZ_LODH01000059|1|1|4496-4586|CRISPRCasFinder
TTCCCGGTTTAGCATGCGAAACTGG	GTTCAAATTTTCCGGCTGATGACTTTCCTGCGGAGCATCCG
GTTCCGGTTTAGCATGCGAAACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LODH01000059.1\|WP_010792593.1\|15314_16514_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_LODH01000059.1\|WP_010792597.1\|11818_12679_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_LODH01000059.1\|WP_019439026.1\|11115_11757_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000059.1\|WP_019484886.1\|12798_14241_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_LODH01000059.1\|WP_010792594.1\|14415_15315_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_LODH01000059.1\|WP_153274579.1\|17125_17263_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LODH01000059.1\|WP_019439028.1\|8088_10113_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_LODH01000059.1\|WP_019439027.1\|10109_10598_-\|CheW-domain-containing-protein	unknown	unknown	gnl\|CDD\|214588
NZ_LODH01000059.1\|WP_010792602.1\|603_1536_-\|chemotaxis-protein-CheB	unknown	unknown	gnl\|CDD\|376531
NZ_LODH01000059.1\|WP_019439029.1\|7300_8092_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224271
NZ_LODH01000059.1\|WP_010792598.1\|10587_10974_-\|response-regulator	unknown	unknown	gnl\|CDD\|333815

Protein	Function_ID	Function_description	E-value
NZ_LODH01000059.1\|WP_010792593.1\|15314_16514_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	2.19349e-19
NZ_LODH01000059.1\|WP_010792597.1\|11818_12679_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	7.64101e-42
NZ_LODH01000059.1\|WP_019484886.1\|12798_14241_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	5.25757e-09
NZ_LODH01000059.1\|WP_010792594.1\|14415_15315_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	3.61725e-35
NZ_LODH01000059.1\|WP_019439028.1\|8088_10113_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.37587e-19
NZ_LODH01000059.1\|WP_019439027.1\|10109_10598_-\|CheW-domain-containing-protein	gnl\|CDD\|214588	smart00260, CheW, Two component signalling adaptor domain.	1.84852e-12
NZ_LODH01000059.1\|WP_010792602.1\|603_1536_-\|chemotaxis-protein-CheB	gnl\|CDD\|376531	pfam01339, CheB_methylest, CheB methylesterase.	5.28159e-45
NZ_LODH01000059.1\|WP_019439029.1\|7300_8092_-\|hypothetical-protein	gnl\|CDD\|224271	COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms].	4.75748e-46
NZ_LODH01000059.1\|WP_010792598.1\|10587_10974_-\|response-regulator	gnl\|CDD\|333815	pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.	9.43056e-28

>NZ_LODH01000059.1|WP_010792602.1|603_1536_-|chemotaxis-protein-CheB
MRVGIISTSNVQVALIQEVLSPVVGELTVYDMSHVENGDLSATGVHALIVDFSDEAILNSEDVLEMLGRDEPVCVLNERELYSMSAAERQAWCNKLVDELKRSIPDLAESLDARKAEIESRNANDTWVIGCSSGGPQAIRDFLGELPTLPVSIFLVQHLTEAAFNTYVQRVRECTSRWEVVAAEHGAKLKAGTIFVVPRDTTVEVRSGVIQLRPVKPNTYSPSINSVIRSVFSSIAGKLGVIILTGMGDDGASGIRDLKGKAKIVMAQDAESSQARSMPDAARETGAVSFSGKPAELARHMYRMYGIGNH
>NZ_LODH01000059.1|WP_019439029.1|7300_8092_-|hypothetical-protein
MNTVDDLILDEGMANSWMKIIEERFAIEIDEHRRVAFARALTSFACETGETLESLFKLFVSGRLEEAQRFQILHLATNHETRFFRYPPSLSAIRDACADIRRPPRVLSVGCSTGEEPYSIACTLLRAGHAAFHVHGTDVSQPCIDKARQGIYRGHPEIRLDVAAPQGQHEVRFHAWIRDMVTFEQHNILAERPVNFTAPDVIITQNMLIYYRVETRHLILQKLAAMLPIGGYLLTGPAEDGNWNPLGLKRLPNHLLNLFVRVA
>NZ_LODH01000059.1|WP_019439028.1|8088_10113_-|methyl-accepting-chemotaxis-protein
MRQDRMSNNFSFVPLTAVLLIATGSAAAWTGYSFLKDTRADSFYVAETYELKSAAMQTIYLADKAAADGAYASQLVEAESQVERALMHLRNGDPIKGIPGAPESVLRSLESLSASWDGIAPSIAKLISGQSGTEAFSRSAKEAKTAVVKVIESGRSAEALLSKLNATSQQKSQLAQALTELEADVAGVTATTVVDATGLQGAEAGVSKYLGALTAFGNSLPRDKAMMDELIKSYRSAQSAQSLISQASGLSANSAQNLPHAKEIWQARDKIASSTDTLIASVKALPDARAINPTLVAVLGALTIGLAILSVLLVARVSASRAQAVETRGSTIEGSQRERSKELSLLLTEIERVGRGELDLTLTDDRDSTKEIAKLLNQVFARFHEIFTETSQTVMGLAAATEQTITTARNVDRNRDEQFRAIEHISSLIADMNTFINLIQQLMGDTQRVANSVANKVHAGSESVNGVHEGILVQTQHLNSIQHRNKHLIERFQMLERISEFVKEVATKSELVAYNAYLVSDQVEGNTELSRAMAKSGEAVQDLSTQSKAVVSEIGQLLKDMNEAARDTQTAVDISLSEMQGLLTRSNAALASLKDIQSITESLTTSVDDVNQRTNSLISQSSEVSETMSSIRHYASENSAASEQTASAMNNLNRQAQNLHSGIQDFYSKQRERA
>NZ_LODH01000059.1|WP_019439027.1|10109_10598_-|CheW-domain-containing-protein
MSSDISSGRYKCIGYRIGDTYCLSPSLAVNAITQVPVSPTQVPGTKPWLLGATKLDGDIIPFVNIARFLSIPQTMSRAEHSNPVALIVRGGADVGDVGVIVDQVVGFIPSGNLTDAPNANLKIPPGLGACLVGVVTGDARTWAVIDIQALIADPKMQTIDLT
>NZ_LODH01000059.1|WP_010792598.1|10587_10974_-|response-regulator
MSNIRSVCIVDDSPGMRKMGAGFLQKADIEVHLAKDGYEALRVIREARPDACFIDIEMPNLDGLKLASILRASTQFKHLPIAMLSSASSPFDIQKGLLAGADLYLTKPFTGDKIAKALIDMEAIIDEQ
>NZ_LODH01000059.1|WP_019439026.1|11115_11757_+|hypothetical-protein
MRKSNHRAAFASDPKFLERIARQLQSEPTSTPPSPADKKPSKAVQRLEKVQTANMDGRKDRISLESTSRVLTICFPGAKLVSLNTMLRVHDAKATRLKNTWLKRVEALRYTYKAVLEEWIAIATYPLLVEEVYITGESSLLDPESVTAACKPVIDALVSNGFLPDDDPSHIAHPLPYTSRGESPGLVICLRPAGRPWGLIEDATIQVASSLGR
>NZ_LODH01000059.1|WP_010792597.1|11818_12679_+|ParB/RepB/Spo0J-family-partition-protein
MYQSETGINPTESHCLGINLVPVEHRDVDVDLMQPGIWQTRRNFTLAELEELGDSMVKAGGNVTPVVLCPRAQGGYFIISGERRWRAAQLKMIPRLHCRIGHYTDNQARFISAVENVLRVQLNPIEEAQAYADIQETGLSHEQIGKELGKSRSHVSNYLRLLTLDITAKDFLIHGKLTATQARPLCSLDSKGIQREVATKAVRLGWSVKKIEDEVAKHLNKPKPKVNLPKQDADIARLTRLVSDHTGYPCVIQKTPSGNWQMGFLMTGDDQFAGLLERLGIKVDEC
>NZ_LODH01000059.1|WP_019484886.1|12798_14241_+|hypothetical-protein
MLNRPFPVPTLLAIALTAVLAGCTSTHEPVELASIEPQSQYDQRIQDGLGSQKYTESQILYMRRLNEFKDQIDSLEKQKQALEASLSTTAYEQDLGSGKAPSTESSRIEEFQAATQASQARVAEENSKAAIRQSIIENDRDRALLEAENRAMAEIEQLKAADAAKQADLAKLKAQLAEQKAESSRTLEKQRFAMAVANADAERRAANAVVEINNQISELKGQLSQLETKLAAAQKEHERLADLSRQLQTPVAVTAAITDQPSPEIGSLTESRIAEIKARLAREKTEITAKARTEVAALTAGAEIKKATVVAPVVTGRAVYAGSYGEKPTTYAKVDDKPVKQDAKPLAIASKQAPVVTVAKFEPKISPVVIQRGSDAGSAVLAGGPVTSSVQSPAPIVVSPKSRVIYDVLYVYKDEGSWQKFQRYLEAYGIKDFEPVHKGSTYYLYMGRFYDKLAAAKRVEYLNRTTNTNHATVHPQEVPM
>NZ_LODH01000059.1|WP_010792594.1|14415_15315_+|ParA-family-protein
MAAIPFKKRKLLADVHAVTNQKGGVGKTTIDFHWLVYLVEQGYRVLGIDLDSQGNFSSRLAPDSRNGGLRSAHLFKEELPDLKPLQTALGADLIYALNKDDELSSVEQIGLSAVGPFAKHIQKLAEDYDYIVIDTPPTNGVRMIAASVVSDHIFVPVELAAFAVDGVISLIETFDMVGPLFGTQITPTGIICNKYNTRVNAHRESLEDLRKVVGPKILQNSLSIRGAIDTALRQCKPVWSMRTNGAERETGVEMIRLMEEMAHRAGVEITPVVIAPKVPRKKKPVKKKSQSRAKKVGAI
>NZ_LODH01000059.1|WP_010792593.1|15314_16514_+|ParB/RepB/Spo0J-family-partition-protein
MAKTLDLGSLTRLNDLMDLGRAAQENQIILLSVDQIEVKPQVRKDFKEIEELAASYDDEGQQTPIIVGPMNPETQKYPLKKGGRRYAAAVLRPGFKLKAIVDGKKRTPAKEILSQLIENEQRQNLNPYEVGQALAEAKAEAKAAGEPLSNQDLATYMGKSETYISIHLGLADLPEELVDLIKGGITSDSEVLREMKQLKNLQPETFTAFIERAKAEGSISRQQVRDAVRAAKGKTVPTKAPPAQEPQTEHQAGKVGHPAQDGVGKGGNSSQANPPGQTDQSPVSHAKPEGQSKAQGQGETNTPAVVTTPSQEQGPAAAPNSSSKKNGKGYIPITAERQVIGIKVALDSAVASGYLMNDRVSEDPSKAWCMLMIGGSQQPKQIKVDQIDIVSVAAMETDG
>NZ_LODH01000059.1|WP_153274579.1|17125_17263_+|hypothetical-protein
MKYALTFAFALSAALFLFQGDDARNTMTKVQHDRCASFEAAGVEC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	210486-210526	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	261779-261819	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	209984-210024	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	26557-26597	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	26715-26755	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	78857-78897	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	43163-43203	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	352188-352228	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	29964-30004	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	46635-46675	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	28143-28183	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	28143-28183	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	27909-27949	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	29318-29358	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP039294	Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence	253489-253529	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	104456-104496	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	312300-312340	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	204335-204375	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	330177-330217	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	276757-276797	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	29340-29380	0	1.0
NZ_LODH01000059_1	1.1\|4521\|41\|NZ_LODH01000059\|CRISPRCasFinder	4521-4561	41	NZ_KU130294	Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence	26763-26803	1	0.976

1. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

2. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

3. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

4. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

5. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

6. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

7. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

8. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

9. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

10. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

11. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

12. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

13. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

14. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

15. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP039294 (Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

16. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

17. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

18. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

19. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

20. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

21. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgactttcctgcggagcatccg	Protospacer
*****************************************

22. spacer 1.1|4521|41|NZ_LODH01000059|CRISPRCasFinder matches to NZ_KU130294 (Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence) position: , mismatch: 1, identity: 0.976

gttcaaattttccggctgatgactttcctgcggagcatccg	CRISPR spacer
gttcaaattttccggctgatgaccttcctgcggagcatccg	Protospacer
***********************.*****************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

99172 : 106626

Acinetobacter_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061363356.1\|99172_99931_+	hypothetical protein	A0A172Q0Q4	Acinetobacter_phage	1.7e-10	26.1
WP_010792509.1\|99923_101018_+\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	2.5e-39	34.0
WP_010792508.1\|101017_101965_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_010792507.1\|101964_102693_+	HAD-IB family hydrolase	NA	NA	NA	NA
WP_010792506.1\|102695_103289_+	TerD family protein	A0A2I7QY07	Vibrio_phage	4.7e-24	37.4
WP_010792505.1\|103285_104476_+	hypothetical protein	NA	NA	NA	NA
WP_010792504.1\|104523_104973_+	tellurite resistance TerB family protein	Q1MVI3	Enterobacteria_phage	1.3e-10	30.2
WP_010792503.1\|104984_106019_+	TerC/Alx family metal homeostasis membrane protein	K7QKE8	Escherichia_phage	3.1e-71	47.2
WP_010792502.1\|106047_106626_+	TerD family protein	A0A2L1IWC0	Streptomyces_phage	5.7e-06	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

24. NZ_LODH01000085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

62 : 7473

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044266199.1\|62_1019_+	hypothetical protein	Q5ZQW5	Pseudomonas_phage	6.6e-185	97.2
WP_061363399.1\|1021_1945_+	hypothetical protein	A0A0S4L5N6	Pseudomonas_phage	6.6e-182	99.0
WP_061363400.1\|1947_3654_+	hypothetical protein	A0A0S4L0R5	Pseudomonas_phage	0.0e+00	98.4
WP_010791806.1\|3640_4459_+	DUF2163 domain-containing protein	J9SP65	Pseudomonas_phage	4.5e-166	100.0
WP_023117665.1\|4468_4699_+	hypothetical protein	J9SHJ9	Pseudomonas_phage	2.7e-36	100.0
WP_078463973.1\|4695_4926_+	hypothetical protein	J9RWP7	Pseudomonas_phage	4.2e-37	96.1
WP_061363401.1\|4912_7123_+	hypothetical protein	J9RWA5	Pseudomonas_phage	0.0e+00	97.8
WP_153971268.1\|7119_7473_+	DUF2793 domain-containing protein	J9SVS6	Pseudomonas_phage	5.5e-60	89.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

25. NZ_LODH01000079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

106 : 21342

Pseudomonas_virus(77.78%)

tail,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003098380.1\|106_379_+\|holin	phage holin family protein	Q9ZXL7	Pseudomonas_virus	2.6e-38	97.8
WP_061363387.1\|375_1182_+	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	2.0e-150	98.9
WP_061363388.1\|1178_1640_+	peptidase	Q9ZXL5	Pseudomonas_virus	3.1e-71	98.0
WP_022580427.1\|1720_2257_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	3.6e-95	98.9
WP_023127414.1\|2249_2708_+	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	3.5e-67	88.2
WP_023127749.1\|2777_3350_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	2.7e-93	91.1
WP_022580424.1\|3346_3691_+\|plate	phage baseplate protein	Q9ZXK9	Pseudomonas_virus	1.6e-56	98.2
WP_023127750.1\|3687_4605_+\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	4.9e-145	87.5
WP_023127751.1\|4601_5219_+\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	3.1e-87	76.3
WP_023127753.1\|7042_7477_+	hypothetical protein	A0A291LAV4	Bordetella_phage	4.0e-28	51.9
WP_023127754.1\|7577_8753_+\|tail	phage tail sheath protein	Q9ZXK4	Pseudomonas_virus	1.1e-216	98.0
WP_023127755.1\|8809_9325_+\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	1.2e-92	98.2
WP_023127421.1\|9379_9709_+\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	2.6e-48	95.4
WP_003098394.1\|9717_9837_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	1.8e-15	100.0
WP_061363389.1\|9826_12541_+\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	0.0e+00	96.0
WP_015967206.1\|12546_12987_+\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	6.1e-77	100.0
WP_061363390.1\|12983_14258_+	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	1.3e-236	97.9
WP_033936089.1\|14375_14834_+	hypothetical protein	A0A1V0E842	Vibrio_phage	2.9e-13	34.9
WP_071557704.1\|14830_15058_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033936090.1\|15034_15385_-	hypothetical protein	Q9ZXJ5	Pseudomonas_virus	2.7e-59	99.1
WP_079390330.1\|15703_16066_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	3.4e-09	35.1
WP_031643139.1\|16144_16357_+	hypothetical protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.9e-07	46.8
WP_033936176.1\|16419_16857_+	hypothetical protein	Q9ZXJ2	Pseudomonas_virus	1.0e-68	91.7
WP_003098408.1\|16853_17147_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	1.1e-50	99.0
WP_061363391.1\|17143_17494_+	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	2.3e-10	36.4
WP_003098410.1\|17564_17798_+	hypothetical protein	Q9ZXI9	Pseudomonas_virus	7.8e-39	100.0
WP_061363392.1\|17794_20515_+	toprim domain protein	Q9ZXI8	Pseudomonas_virus	0.0e+00	99.2
WP_061363393.1\|20559_21342_+	hypothetical protein	Q9ZXI8	Pseudomonas_virus	6.9e-23	30.8

Anti-CRISPR protein detection

Acr_ID: NZ_LODH01000079.1|WP_033936089.1|14375_14834_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LODH01000079.1|WP_033936089.1|14375_14834_+|hypothetical-protein

14375_14834_+

152 aa aa

AcrIF11

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0498\|WP_033936089.1\|AcrIF11\|I-F\|Verified\|Pseudomonas-aeruginosa	1.0	1	1.0

NZ_LODH01000079.1_14830_15058_+

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_LODH01000079.1_14830_15058_+	AcrIC7-Aca10\|WP_074980464.1	0.7627118644067796	0.8	0.9076923076923077

106-21342

26. NZ_LODH01000006

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

27. NZ_LODH01000011

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22150 : 61586

Pseudomonas_phage(63.83%)

portal,protease,lysis,head,integrase,capsid,tail,holin,terminase

attL 22439:22458|attR 64228:64247

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003096630.1\|22150_22423_+	HU family DNA-binding protein	B5TA87	Burkholderia_phage	3.1e-15	51.1
22439:22458	attL	NA	NA	NA	NA
WP_033982455.1\|22535_23585_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	2.2e-101	55.1
WP_061362850.1\|23584_23827_-	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	1.7e-17	61.6
WP_077563744.1\|23810_24326_-	hypothetical protein	NA	NA	NA	NA
WP_034014243.1\|24972_25218_-	hypothetical protein	NA	NA	NA	NA
WP_034014242.1\|25214_25394_-	hypothetical protein	NA	NA	NA	NA
WP_003085685.1\|25649_26465_-	hypothetical protein	A0A0A0YUE9	Pseudomonas_phage	5.7e-60	87.7
WP_003085687.1\|26461_26797_-	hypothetical protein	A0A1W6JTA6	Pseudomonas_phage	1.2e-53	99.1
WP_003085689.1\|26799_27030_-	Arc family DNA-binding protein	A0A1W6JTB4	Pseudomonas_phage	2.9e-30	89.5
WP_025991892.1\|27071_27908_-	prohibitin family protein	A0A0A0YRT7	Pseudomonas_phage	2.2e-128	99.6
WP_058164186.1\|27904_28159_-	hypothetical protein	A0A0A0YUF2	Pseudomonas_phage	1.4e-38	98.8
WP_058164185.1\|28258_28492_-	hypothetical protein	A0A0A0YQ28	Pseudomonas_phage	4.3e-37	98.7
WP_022580279.1\|28494_28878_-	LuxR family transcriptional regulator	A0A0A0YWH0	Pseudomonas_phage	1.1e-61	99.2
WP_031294207.1\|29229_30018_-	helix-turn-helix domain-containing protein	A0A2K8HKD5	Pseudomonas_phage	4.6e-83	60.9
WP_063837809.1\|30120_30441_+	hypothetical protein	A0A1W6JTD1	Pseudomonas_phage	5.3e-06	52.4
WP_012613571.1\|30437_30947_+	EndY protein	Q7Y5F9	Xanthomonas_virus	1.4e-32	49.0
WP_055327988.1\|31036_31348_+	hypothetical protein	A0A0A0YUF6	Pseudomonas_phage	2.8e-44	90.3
WP_003119033.1\|31344_31632_+	DUF3077 domain-containing protein	A0A0A0YQ33	Pseudomonas_phage	7.6e-44	100.0
WP_055327987.1\|31628_31937_+	hypothetical protein	A0A0A0YWH5	Pseudomonas_phage	1.8e-43	88.2
WP_055327986.1\|31933_32209_+	hypothetical protein	A0A1W6JTB7	Pseudomonas_phage	1.8e-39	97.8
WP_055327985.1\|32334_32697_+	hypothetical protein	A0A0A0YUG0	Pseudomonas_phage	5.0e-61	97.5
WP_055327984.1\|32693_33458_+	hypothetical protein	A0A0A0YQ39	Pseudomonas_phage	1.2e-22	33.7
WP_023093236.1\|33454_33811_+	hypothetical protein	NA	NA	NA	NA
WP_033867071.1\|33945_34260_+	hypothetical protein	NA	NA	NA	NA
WP_023093240.1\|35311_37123_+	AAA family ATPase	A0A0U4B0G9	Pseudomonas_phage	1.6e-259	70.1
WP_043096406.1\|37119_37398_+	hypothetical protein	A0A1W6JTC1	Pseudomonas_phage	7.3e-44	96.7
WP_004353175.1\|37394_37784_+	hypothetical protein	A0A1W6JTD2	Pseudomonas_phage	2.2e-70	99.2
WP_079761837.1\|38157_38856_+	Rha protein	A0A0P0ZFJ1	Escherichia_phage	2.4e-27	41.5
WP_004353177.1\|38940_39273_+\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	1.9e-54	96.4
WP_061362851.1\|39269_39881_+	glycoside hydrolase family 19 protein	A0A1B0Z086	Pseudomonas_phage	1.3e-101	90.1
WP_003085739.1\|39894_40125_+	hypothetical protein	A0A2C9CY14	Yersinia_phage	4.1e-16	60.6
WP_061362852.1\|40131_40644_+\|lysis	lysis protein	A0A1B0Z001	Pseudomonas_phage	1.8e-72	92.9
WP_061362853.1\|40656_40839_+	hypothetical protein	NA	NA	NA	NA
WP_061362854.1\|40838_41168_+	HNH endonuclease	B5WZZ4	Pseudomonas_phage	3.5e-29	54.6
WP_079761838.1\|41177_41678_+	HNH endonuclease	A0A2I7RA87	Vibrio_phage	1.7e-14	37.8
WP_034012134.1\|41766_42258_+	hypothetical protein	Q3HQS6	Burkholderia_phage	3.2e-10	37.9
WP_061362855.1\|42261_43941_+\|terminase	terminase large subunit	A0A2H4JDK9	uncultured_Caudovirales_phage	2.5e-195	66.0
WP_043152921.1\|43943_45167_+\|portal	phage portal protein	A0A2H4JFN7	uncultured_Caudovirales_phage	6.3e-172	73.0
WP_015649331.1\|45150_45795_+\|head,protease	HK97 family phage prohead protease	A0A2H4JA51	uncultured_Caudovirales_phage	3.5e-89	75.7
WP_061362856.1\|45791_47006_+\|capsid	phage major capsid protein	A0A2H4J8D1	uncultured_Caudovirales_phage	1.0e-153	67.1
WP_003085760.1\|47057_47261_+	hypothetical protein	NA	NA	NA	NA
WP_043106558.1\|47260_47590_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J8C5	uncultured_Caudovirales_phage	2.0e-24	57.1
WP_023111187.1\|47593_47932_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	3.2e-25	57.1
WP_061362857.1\|47924_48398_+	hypothetical protein	A0A2H4JB20	uncultured_Caudovirales_phage	7.9e-30	50.0
WP_043106556.1\|48397_48766_+	DUF3168 domain-containing protein	A0A1J0GUW9	Halomonas_phage	1.1e-34	58.2
WP_004353198.1\|48832_49327_+	hypothetical protein	Q9MCA5	Pseudomonas_phage	1.6e-57	66.5
WP_003088469.1\|49336_49687_+	hypothetical protein	NA	NA	NA	NA
WP_003088470.1\|49716_49983_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	7.1e-12	42.2
WP_123788680.1\|50080_50410_+	hypothetical protein	A0A140IES7	Pseudomonas_phage	5.3e-17	45.3
WP_079761841.1\|50968_54289_+	tape measure protein	B7SE05	Pseudomonas_virus	3.7e-65	43.9
WP_023910125.1\|54289_54637_+\|tail	phage tail protein	A0A2D1GNJ1	Pseudomonas_phage	9.2e-28	51.3
WP_153549358.1\|54674_54833_+	hypothetical protein	NA	NA	NA	NA
WP_061362859.1\|55219_55837_-	hypothetical protein	NA	NA	NA	NA
WP_004353204.1\|55977_56679_+\|tail	phage minor tail protein L	A0A2D1GNF3	Pseudomonas_phage	6.5e-105	74.4
WP_061362860.1\|56681_57464_+	C40 family peptidase	A0A2D1GNP8	Pseudomonas_phage	2.2e-122	75.2
WP_004353206.1\|57460_58039_+\|tail	tail assembly protein	A0A2D1GNM2	Pseudomonas_phage	1.2e-64	65.4
WP_061362861.1\|58094_61586_+\|tail	phage tail protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	66.3
64228:64247	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

28. NZ_LODH01000035

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

73937 : 116178

Pseudomonas_phage(79.41%)

holin,protease,tRNA,terminase,integrase,portal,capsid,head

attL 70176:70192|attR 110952:110968

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
70176:70192	attL	NA	NA	NA	NA
WP_003092872.1\|73937_76790_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.0e-148	37.0
WP_003100590.1\|76910_77279_-	hypothetical protein	NA	NA	NA	NA
WP_003100593.1\|77290_77719_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_003092867.1\|77715_79203_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.0e-51	36.1
WP_016253042.1\|79539_80352_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_061363187.1\|80435_81359_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003092864.1\|81550_82669_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_019726663.1\|82661_83729_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_003100603.1\|83860_84358_-	RDD family protein	NA	NA	NA	NA
WP_061363188.1\|84487_86068_+	EAL domain-containing protein	NA	NA	NA	NA
WP_079761875.1\|86564_87566_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	5.7e-155	97.9
WP_031275115.1\|87577_87946_+	outer membrane protein assembly factor BamE	J7HXI2	Pseudomonas_phage	9.4e-47	87.3
WP_023910263.1\|88064_88715_+	hypothetical protein	A0A0U4J8W4	Pseudomonas_phage	4.9e-123	99.1
WP_034004326.1\|89079_89292_+	hypothetical protein	NA	NA	NA	NA
WP_126610319.1\|89263_89863_+	DUF2335 domain-containing protein	NA	NA	NA	NA
WP_078451488.1\|90097_90445_+	hypothetical protein	NA	NA	NA	NA
WP_023910260.1\|90441_90756_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_023910258.1\|90758_91064_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_031275114.1\|91124_91427_-	hypothetical protein	A0A0A0YRS6	Pseudomonas_phage	5.1e-51	97.0
WP_023123490.1\|91423_91765_-	hypothetical protein	NA	NA	NA	NA
WP_003129605.1\|91769_92459_-	hypothetical protein	A0A0A0YUE3	Pseudomonas_phage	2.6e-29	36.8
WP_061363190.1\|92631_92823_-	hypothetical protein	A0A1W6JTB8	Pseudomonas_phage	5.6e-27	98.3
WP_058171377.1\|92935_93598_-	hypothetical protein	A0A1W6JT97	Pseudomonas_phage	2.1e-44	96.9
WP_033987586.1\|93594_93930_-	hypothetical protein	A0A1W6JTA6	Pseudomonas_phage	7.7e-48	88.3
WP_023123494.1\|93932_94163_-	Arc family DNA-binding protein	A0A1W6JTB4	Pseudomonas_phage	1.5e-31	94.7
WP_023086948.1\|94260_94494_-	hypothetical protein	A0A0A0YQ28	Pseudomonas_phage	8.0e-36	94.8
WP_023086949.1\|94496_94883_-	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	2.4e-53	96.6
WP_126610311.1\|95295_95772_-	hypothetical protein	NA	NA	NA	NA
WP_023086950.1\|95784_96297_-	ImmA/IrrE family metallo-endopeptidase	Q854W5	Mycobacterium_virus	3.2e-08	34.9
WP_031654979.1\|96643_97393_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.8e-65	69.8
WP_023123496.1\|97864_98365_+	hypothetical protein	Q9XJS9	Pseudomonas_phage	1.6e-41	53.6
WP_023103992.1\|98517_98868_+	hypothetical protein	NA	NA	NA	NA
WP_031654981.1\|98864_99143_+	hypothetical protein	A0A1W6JTC3	Pseudomonas_phage	8.4e-40	96.7
WP_034004616.1\|99139_99448_+	hypothetical protein	NA	NA	NA	NA
WP_034004614.1\|99440_99737_+	hypothetical protein	NA	NA	NA	NA
WP_031630393.1\|99733_100063_+	hypothetical protein	NA	NA	NA	NA
WP_058171376.1\|100055_100856_+	hypothetical protein	A0A1W6JTB2	Pseudomonas_phage	1.5e-118	84.2
WP_003085718.1\|100852_101083_+	hypothetical protein	A0A1W6JTF8	Pseudomonas_phage	4.1e-40	100.0
WP_023086959.1\|101079_101919_+	helix-turn-helix domain-containing protein	A0A1W6JTD5	Pseudomonas_phage	7.9e-150	96.1
WP_049238134.1\|102094_102715_+	ATP-binding protein	A0A1W6JTD8	Pseudomonas_phage	6.5e-109	99.0
WP_034002871.1\|102711_104109_+	AAA family ATPase	A0A1W6JTB3	Pseudomonas_phage	5.2e-263	98.7
WP_023085527.1\|104105_104390_+	hypothetical protein	A0A1W6JTC1	Pseudomonas_phage	2.7e-41	95.5
WP_003129671.1\|104386_104944_+	hypothetical protein	A0A0A0YRV6	Pseudomonas_phage	1.0e-73	95.0
WP_124126739.1\|106325_106550_+	hypothetical protein	NA	NA	NA	NA
WP_015649339.1\|106738_107053_+\|holin	phage holin, lambda family	A0A0A0YUH2	Pseudomonas_phage	5.7e-53	100.0
WP_058171375.1\|107052_107670_+	glycoside hydrolase family 19 protein	A0A1B0Z086	Pseudomonas_phage	1.9e-108	94.1
WP_058171374.1\|107666_107909_+	hypothetical protein	A0A0H5AWC3	Pseudomonas_phage	1.1e-19	51.9
WP_031691157.1\|107902_108163_-	hypothetical protein	NA	NA	NA	NA
WP_015648943.1\|108451_109189_+	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	1.5e-43	46.7
WP_014602833.1\|109454_109949_+	DNA packaging protein	A0A1B0Z033	Pseudomonas_phage	1.7e-51	64.2
WP_014602834.1\|109920_111849_+\|terminase	phage terminase large subunit family protein	A0A1B0Z2K0	Pseudomonas_phage	1.8e-253	65.2
110952:110968	attR	NA	NA	NA	NA
WP_015648941.1\|111864_112089_+	hypothetical protein	NA	NA	NA	NA
WP_034004368.1\|112088_113564_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	6.2e-198	70.1
WP_052156285.1\|113560_114757_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.0e-110	56.5
WP_015648940.1\|114756_115116_+\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	9.3e-07	38.7
WP_061363191.1\|115182_116178_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	5.7e-131	69.9

DBSCAN-SWA_2

145302 : 151488

Vibrio_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092836.1\|145302_145794_+	Fe-S cluster assembly transcriptional regulator IscR	M4M9K8	Vibrio_phage	2.2e-06	30.7
WP_003092832.1\|145823_147038_+	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	2.6e-32	36.9
WP_003092829.1\|147073_147460_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	79.8
WP_003100617.1\|147487_147811_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.8e-24	50.5
WP_003092824.1\|147818_148340_+	co-chaperone HscB	NA	NA	NA	NA
WP_003143122.1\|148382_150242_+	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	4.8e-107	40.1
WP_003092818.1\|150248_150587_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003092814.1\|150612_150813_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003092811.1\|151056_151488_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.2e-22	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

29. NZ_LODH01000041

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

74264 : 97317

Pseudomonas_phage(100.0%)

transposase,integrase,head

attL 76736:76751|attR 92797:92812

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003094179.1\|74264_74624_-	hypothetical protein	A0A0S4L0M4	Pseudomonas_phage	6.5e-61	100.0
WP_003094181.1\|74626_75190_-	regulatory protein GemA	Q5ZR14	Pseudomonas_phage	5.0e-100	100.0
WP_061363249.1\|75176_75644_-	hypothetical protein	J9STM8	Pseudomonas_phage	1.1e-60	85.2
WP_061363250.1\|75645_75864_-	hypothetical protein	J9STW0	Pseudomonas_phage	2.8e-30	95.8
WP_003094188.1\|75865_76555_-	DUF2786 domain-containing protein	Q5ZR11	Pseudomonas_phage	1.3e-126	100.0
WP_061363251.1\|76556_77075_-	host-nuclease inhibitor protein Gam	H6V8L7	Pseudomonas_phage	1.7e-86	94.8
76736:76751	attL	NA	NA	NA	NA
WP_061363252.1\|77099_77630_-	hypothetical protein	J9STN6	Pseudomonas_phage	1.1e-88	97.7
WP_061363253.1\|77619_77877_-	hypothetical protein	NA	NA	NA	NA
WP_033938127.1\|77876_78161_-	hypothetical protein	J9SGZ7	Pseudomonas_phage	4.7e-38	86.2
WP_061363254.1\|78157_78499_-	hypothetical protein	J9STH1	Pseudomonas_phage	1.3e-55	95.6
WP_061363255.1\|78500_79667_-	AAA family ATPase	J9SHF3	Pseudomonas_phage	5.2e-216	99.5
WP_061363256.1\|79666_81451_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	J9SGQ3	Pseudomonas_phage	0.0e+00	98.8
WP_061363257.1\|81454_82432_-	hypothetical protein	J9SND0	Pseudomonas_phage	9.8e-160	98.8
WP_003094211.1\|82441_82756_-	hypothetical protein	J9SH06	Pseudomonas_phage	1.2e-50	100.0
WP_003094213.1\|82752_83013_-	hypothetical protein	J9RWD0	Pseudomonas_phage	1.6e-40	100.0
WP_061363258.1\|83005_83494_-	hypothetical protein	J9SVV8	Pseudomonas_phage	2.0e-89	97.5
WP_023127889.1\|83617_83842_+	hypothetical protein	NA	NA	NA	NA
WP_003094216.1\|84126_84357_-	DNA-binding protein	J9SNE2	Pseudomonas_phage	3.2e-37	100.0
WP_061363259.1\|84462_84834_+	helix-turn-helix domain-containing protein	J9SH16	Pseudomonas_phage	1.7e-19	100.0
WP_034066089.1\|84851_85355_+	hypothetical protein	J9RWD8	Pseudomonas_phage	6.5e-83	95.2
WP_003094225.1\|86412_86670_+	membrane protein	A0A0S4L5C0	Pseudomonas_phage	7.2e-38	100.0
WP_003094230.1\|86827_87457_+	transglycosylase SLT domain-containing protein	A0A0S4L2W4	Pseudomonas_phage	4.6e-118	98.1
WP_061363260.1\|87643_88255_+	hypothetical protein	J9RWN0	Pseudomonas_phage	6.3e-96	99.5
WP_003094234.1\|88258_88648_+	hypothetical protein	A0A0S4L2V7	Pseudomonas_phage	5.2e-64	100.0
WP_003139994.1\|88649_88946_+	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	4.6e-52	100.0
WP_003094238.1\|88951_89527_+	DUF3486 family protein	J9SNV5	Pseudomonas_phage	7.4e-91	100.0
WP_003139988.1\|89528_91232_+	hypothetical protein	A0A0S4L072	Pseudomonas_phage	0.0e+00	99.8
WP_003152194.1\|91231_92710_+	DUF935 family protein	J9RWN4	Pseudomonas_phage	1.4e-287	100.0
WP_031630688.1\|92709_93960_+\|head	phage head morphogenesis protein	J9SWK6	Pseudomonas_phage	1.5e-240	100.0
92797:92812	attR	NA	NA	NA	NA
WP_031630686.1\|93956_94529_+	phage virion morphogenesis protein	J9SN67	Pseudomonas_phage	4.3e-99	96.8
WP_023442965.1\|94747_95995_+	peptidase	J9SGT4	Pseudomonas_phage	7.3e-184	93.3
WP_061363261.1\|95998_96391_+	DUF2190 family protein	A0A0S4L3C3	Pseudomonas_phage	6.3e-57	97.6
WP_033940210.1\|96387_97317_+	hypothetical protein	Q5ZQX7	Pseudomonas_phage	3.8e-177	99.4

Anti-CRISPR protein detection

Acr_ID: NZ_LODH01000041.1|WP_003094216.1|84126_84357_-|DNA-binding-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LODH01000041.1|WP_003094216.1|84126_84357_-|DNA-binding-protein

84126_84357_-

76 aa aa

74264-97317

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_LODH01000008_1	Orphan	1.2\|181\|18\|NZ_LODH01000008\|CRT	181-198	18	82505-82488	2
NZ_LODH01000008_1	Orphan	1.5\|352\|18\|NZ_LODH01000008\|CRT	352-369	18	82505-82488	2

1. spacer 1.2|181|18|NZ_LODH01000008|CRT matches to NZ_LODH01000041 position: 82505-82488, mismatch: 2

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********

2. spacer 1.5|352|18|NZ_LODH01000008|CRT matches to NZ_LODH01000041 position: 82505-82488, mismatch: 2

ccggcgccgaggccagga	CRISPR spacer
cctgcgccgcggccagga	Protospacer
** ****** ********