CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_NFFP01000036	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_36_length_68703, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000198	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_198b_length_320, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000110	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_110_length_1402, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000126	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_126_length_1151, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000069	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_69_length_7543, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000103	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_103_length_1852, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000073	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_73_length_5860, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000158	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_158_length_699, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000137	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_137a_length_867, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000018	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_18_length_155833, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000095	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_95_length_2597, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000214	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_214_length_340, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000068	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_68_length_7566, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000139	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_139_length_967, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000211	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_211_length_361, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000097	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_97_length_2365, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000102	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_102_length_1856, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000186	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_186_length_513, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000096	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_96_length_2585, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000051	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_51_length_39301, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000145	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_145_length_894, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000200	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_200_length_459, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000167	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_167_length_645, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000176	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_176a_length_497, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000089	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_89_length_3469, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000173	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_173_length_585, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000191	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_191b_length_455, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000002	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_2_length_295806, whole genome shotgun sequence	0 crisprs	DEDDh	0	1	0
NZ_NFFP01000064	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_64_length_11541, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000070	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_70_length_7230, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000148	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_148_length_857, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000190	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_190_length_499, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000046	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_46_length_45597, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000022	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_22_length_126623, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000013	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_13_length_180362, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000104	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_104_length_1836, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000147	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_147_length_857, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000105	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_105_length_1777, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000044	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_44_length_47188, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000004	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_4_length_279470, whole genome shotgun sequence	0 crisprs	RT,csa3	0	1	0
NZ_NFFP01000003	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_3_length_284817, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_NFFP01000088	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_88_length_3516, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000180	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_180_length_531, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000029	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_29_length_93437, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_NFFP01000141	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_141b_length_827, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000154	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_154a_length_615, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000054	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_54_length_36581, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000074	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_74_length_5768, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000182	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_182b_length_383, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000066	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_66_length_9253, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000042	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_42_length_49288, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000113	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_113_length_1364, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000021	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_21_length_136410, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000171	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_171_length_604, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000082	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_82_length_4315, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000114	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_114a_length_1118, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000183	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_183_length_523, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000132	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_132_length_1064, whole genome shotgun sequence	0 crisprs	NA	0	0	2
NZ_NFFP01000111	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_111_length_1399, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000058	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_58_length_28551, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000035	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_35_length_73990, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000165	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_165_length_647, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000079	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_79_length_5085, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000169	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_169_length_627, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000071	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_71_length_6920, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000055	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_55_length_36122, whole genome shotgun sequence	0 crisprs	RT	0	0	0
NZ_NFFP01000204	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_204_length_444, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000215	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_215_length_336, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000008	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_8_length_236384, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_NFFP01000212	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_212_length_350, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000166	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_166_length_647, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000153	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_153_length_748, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000086	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_86_length_3567, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000084	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_84_length_3622, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000049	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_49_length_42604, whole genome shotgun sequence	0 crisprs	NA	0	0	3
NZ_NFFP01000163	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_163_length_648, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000192	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_192_length_479, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000175	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_175_length_558, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000061	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_61_length_19366, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000031	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_31_length_84527, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000118	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_118_length_1209, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000124	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_124_length_1160, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000196	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_196_length_468, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000094	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_94_length_2606, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000100	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_100_length_2340, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000075	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_75_length_5475, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000015	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_15_length_173435, whole genome shotgun sequence	0 crisprs	csa3,DEDDh	0	2	0
NZ_NFFP01000201	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_201_length_446, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000208	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_208_length_430, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000052	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_52_length_38761, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000127	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_127_length_1148, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000057	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_57_length_29486, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000092	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_92_length_3139, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000023	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_23_length_123220, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000135	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_135_length_1040, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000063	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_63_length_12412, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000083	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_83_length_3686, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000174	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_174a_length_483, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000109	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_109_length_1468, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000202	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_202_length_446, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000099	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_99_length_2347, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000037	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_37_length_65628, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000155	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_155_length_723, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000179	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_179_length_539, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000178	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_178a_length_482, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000039	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_39_length_57471, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000185	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_185_length_514, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000131	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_131_length_1066, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000150	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_150_length_829, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000121	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_121a_length_969, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000117	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_117_length_1258, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000059	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_59_length_28056, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000090	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_90_length_3397, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000122	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_122_length_1167, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000177	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_177_length_545, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000041	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_41_length_49858, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_NFFP01000024	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_24_length_110726, whole genome shotgun sequence	0 crisprs	WYL	0	0	0
NZ_NFFP01000159	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_159_length_697, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000078	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_78_length_5271, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000017	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_17_length_160464, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000152	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_152_length_794, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000026	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_26_length_100455, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000156	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_156b_length_640, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000134	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_134_length_1053, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000098	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_98_length_2361, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000067	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_67_length_8585, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000033	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_33_length_76200, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000138	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_138_length_984, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000062	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_62_length_12564, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000053	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_53b_length_37211, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000197	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_197a_length_398, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000011	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_11_length_221992, whole genome shotgun sequence	0 crisprs	WYL	0	1	0
NZ_NFFP01000016	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_16_length_172313, whole genome shotgun sequence	0 crisprs	RT	0	0	0
NZ_NFFP01000151	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_151_length_802, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000193	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_193_length_474, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000010	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_10_length_223772, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000005	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_5_length_252148, whole genome shotgun sequence	0 crisprs	PD-DExK,csa3	0	0	0
NZ_NFFP01000087	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_87_length_3527, whole genome shotgun sequence	0 crisprs	NA	0	0	1
NZ_NFFP01000168	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_168_length_640, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000101	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_101a_length_1893, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000164	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_164_length_648, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000184	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_184_length_514, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000056	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_56_length_30884, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000007	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_7_length_240951, whole genome shotgun sequence	0 crisprs	TnsE_C	0	2	0
NZ_NFFP01000199	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_199_length_462, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000001	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_1_length_419081, whole genome shotgun sequence	1 crisprs	DEDDh	0	0	0
NZ_NFFP01000025	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_25_length_101652, whole genome shotgun sequence	0 crisprs	csa3	0	1	0
NZ_NFFP01000143	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_143_length_904, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000149	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_149_length_835, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000146	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_146b_length_720, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000080	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_80_length_4806, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000060	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_60_length_24706, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000038	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_38_length_64861, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000187	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_187_length_513, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000207	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_207_length_439, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000195	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_195a_length_437, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000019	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_19_length_145281, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000014	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_14_length_174017, whole genome shotgun sequence	0 crisprs	DinG	0	0	0
NZ_NFFP01000128	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_128a_length_977, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000030	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_30_length_91322, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000210	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_210_length_378, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000194	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_194a_length_375, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000213	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_213_length_344, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000203	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_203_length_445, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000047	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_47b_length_44162, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000091	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_91_length_3141, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000009	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_9_length_229125, whole genome shotgun sequence	0 crisprs	DEDDh,PD-DExK	0	0	0
NZ_NFFP01000130	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_130_length_1069, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000129	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_129_length_1106, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000160	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_160_length_689, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000065	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_65_length_10441, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000032	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_32_length_79894, whole genome shotgun sequence	1 crisprs	NA	2	0	0
NZ_NFFP01000119	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_119_length_1193, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000209	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_209_length_399, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000028	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_28_length_95256, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000116	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_116b_length_1047, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000162	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_162b_length_415, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000188	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_188_length_512, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000170	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_170_length_604, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000142	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_142_length_931, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000050	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_50_length_41988, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000077	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_77_length_5279, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000206	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_206_length_440, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000172	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_172_length_588, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000189	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_189b_length_447, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000027	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_27_length_96424, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000106	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_106_length_1677, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000020	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_20_length_143454, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000157	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_157_length_716, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000076	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_76_length_5307, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000045	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_45_length_46940, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000112	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_112_length_1398, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000093	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_93_length_2834, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000136	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_136_length_1032, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000120	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_120_length_1183, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000081	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_81_length_4698, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000085	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_85_length_3570, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000125	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_125_length_1160, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000133	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_133_length_1059, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000205	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_205_length_442, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000006	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_6_length_242758, whole genome shotgun sequence	0 crisprs	DEDDh,DinG	0	0	0
NZ_NFFP01000034	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_34_length_74282, whole genome shotgun sequence	0 crisprs	csa3	0	0	0
NZ_NFFP01000040	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_40_length_54425, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_NFFP01000012	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_12_length_185145, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000107	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_107_length_1652, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000072	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_72a_length_6799, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000181	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_181_length_531, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000115	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_115a_length_1043, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000108	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_108_length_1543, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000144	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_144_length_895, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000161	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_161a_length_624, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000043	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_43_length_48762, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_NFFP01000140	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_140_length_951, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_NFFP01000048	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_48_length_43969, whole genome shotgun sequence	0 crisprs	RT	0	0	0
NZ_NFFP01000123	Pseudomonas aeruginosa strain S708_C14_RS S708_C14_RS_NODE_123_length_1160, whole genome shotgun sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 49970

Salmonella_phage(10.0%)

coat,tRNA,transposase,integrase

attL 14984:14998|attR 34598:34612

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050396119.1\|0_2231_+\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	78.2
WP_025297689.1\|2928_3567_+	DNA-binding protein	NA	NA	NA	NA
WP_025297690.1\|3566_3788_+	hypothetical protein	NA	NA	NA	NA
WP_124135596.1\|3790_4060_-	hypothetical protein	NA	NA	NA	NA
WP_025297692.1\|4119_5247_-	M23 family metallopeptidase	A7KUS1	Bacillus_phage	3.8e-06	31.7
WP_025297693.1\|5243_5771_-	hypothetical protein	NA	NA	NA	NA
WP_025297694.1\|5763_5952_-	hypothetical protein	NA	NA	NA	NA
WP_025297695.1\|5938_6178_-	hypothetical protein	NA	NA	NA	NA
WP_025297696.1\|6177_6783_-	hypothetical protein	NA	NA	NA	NA
WP_025297697.1\|6908_7439_-	hypothetical protein	NA	NA	NA	NA
WP_025297698.1\|7435_10309_-	DotA/TraY family protein	NA	NA	NA	NA
WP_025297699.1\|10309_10783_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_025297700.1\|11287_12511_+	MobA/MobL family protein	NA	NA	NA	NA
WP_025297701.1\|12735_13140_+	hypothetical protein	NA	NA	NA	NA
WP_025297702.1\|13305_13893_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.3e-55	57.4
WP_025297703.1\|13964_15632_+	Eco57I restriction-modification methylase domain-containing protein	R4TFP1	Halovirus	4.3e-22	25.1
14984:14998	attL	NA	NA	NA	NA
WP_025297704.1\|15632_16373_+	type-2 restriction endonuclease	NA	NA	NA	NA
WP_025297705.1\|16411_16660_+	hypothetical protein	NA	NA	NA	NA
WP_025297706.1\|16663_17482_+	hypothetical protein	NA	NA	NA	NA
WP_025297707.1\|17612_18605_+	hypothetical protein	NA	NA	NA	NA
WP_071534685.1\|18604_19729_+	hypothetical protein	NA	NA	NA	NA
WP_079379992.1\|19725_20430_+	hypothetical protein	NA	NA	NA	NA
WP_025297935.1\|20470_21046_-	hypothetical protein	NA	NA	NA	NA
WP_025297934.1\|21118_21823_-	hypothetical protein	NA	NA	NA	NA
WP_033896075.1\|21809_22997_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0VMI6	Pseudomonas_phage	7.7e-74	39.9
WP_003099270.1\|23213_24314_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_003099278.1\|24354_24939_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_003099279.1\|24980_25595_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_003099281.1\|25711_26653_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	4.5e-45	37.6
WP_003162406.1\|26819_27668_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003095005.1\|27669_28287_-	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_025297597.1\|28291_30064_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003095001.1\|30207_31476_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003114692.1\|31493_32576_+	peptide chain release factor 1	B5LLF2	Mycobacterium_phage	3.3e-07	49.2
WP_003121049.1\|32577_33408_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003099296.1\|33401_34160_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_003099300.1\|34149_34947_+	glutamate racemase	NA	NA	NA	NA
34598:34612	attR	NA	NA	NA	NA
WP_003099307.1\|35080_35602_+	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	1.4e-59	69.8
WP_015648021.1\|35727_37173_-	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	1.4e-45	28.0
WP_015648022.1\|37169_38069_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.9e-16	33.7
WP_003099314.1\|38078_39035_-	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_003094987.1\|39187_40171_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_025297596.1\|40584_41502_+	TIGR01777 family protein	NA	NA	NA	NA
WP_003099324.1\|41498_42521_+	ferrochelatase	NA	NA	NA	NA
WP_003099328.1\|42800_44174_+	MFS transporter	NA	NA	NA	NA
WP_003099330.1\|44175_45123_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003099332.1\|45119_47492_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_003099335.1\|47508_48297_-	molecular chaperone	NA	NA	NA	NA
WP_003099337.1\|48315_48858_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003146046.1\|48857_49391_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003099340.1\|49421_49970_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_NFFP01000004

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

313 : 36876

uncultured_Caudovirales_phage(25.0%)

plate,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003101660.1\|313_1513_-\|tRNA	tyrosine--tRNA ligase	A0A1S6UA79	Serratia_phage	4.2e-27	28.5
WP_003120825.1\|1797_3141_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	6.1e-19	45.3
WP_003085271.1\|3143_4235_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_003085254.1\|4288_4639_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	3.0e-26	53.2
WP_003120826.1\|4716_5139_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_003085249.1\|5139_5859_-	hypothetical protein	NA	NA	NA	NA
WP_015649704.1\|5858_6893_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_003085245.1\|7183_7606_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_003117983.1\|7622_8591_+	nitronate monooxygenase	NA	NA	NA	NA
WP_003459458.1\|8712_9789_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_003142814.1\|9849_10650_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	2.7e-06	24.5
WP_003101642.1\|10689_12171_-	AAA family ATPase	U5XJW0	Phormidium_phage	6.7e-67	33.5
WP_003085225.1\|12249_12588_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_003085224.1\|12687_13335_+	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_003101641.1\|13389_14184_-	adenosylmethionine decarboxylase	NA	NA	NA	NA
WP_003085219.1\|14503_14926_-	OsmC family protein	NA	NA	NA	NA
WP_003085214.1\|15197_15842_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_003085205.1\|15903_16740_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9
WP_003085203.1\|16736_17786_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003101640.1\|17787_18393_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.0e-75	65.8
WP_003118919.1\|18740_18998_-	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
WP_003101639.1\|18994_19357_-	hypothetical protein	H2BDA0	Pseudomonas_phage	1.9e-15	47.9
WP_003085188.1\|19353_19983_-	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	3.2e-87	78.5
WP_003101637.1\|20015_21005_-	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.2e-106	55.8
WP_003101635.1\|21062_21269_-\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_003085182.1\|21243_22116_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
WP_025297297.1\|22125_24363_-\|tail	phage tail length tape measure protein	NA	NA	NA	NA
WP_003085178.1\|24532_24877_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	3.8e-18	46.7
WP_003085175.1\|24891_25395_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
WP_003109051.1\|25407_26568_-\|tail	phage tail sheath family protein	Q38068	Phage_PS17	2.7e-188	83.4
WP_003085172.1\|26610_27051_-\|tail	tail fiber assembly protein	Q9ZXK5	Pseudomonas_virus	3.0e-31	51.0
WP_015649708.1\|27059_29168_-\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	1.4e-224	52.1
WP_010895511.1\|29169_29703_-\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.0e-62	64.6
WP_015649709.1\|29695_30583_-\|plate	baseplate J/gp47 family protein	S4TNY7	Salmonella_phage	7.0e-88	59.8
WP_003085143.1\|30579_30906_-	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
WP_003085141.1\|31058_31616_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
WP_015649710.1\|31612_32128_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.9e-33	44.0
WP_003118908.1\|32149_32599_-	hypothetical protein	B5TK61	Pseudomonas_phage	5.0e-26	53.3
WP_003459419.1\|32961_33321_-	hypothetical protein	NA	NA	NA	NA
WP_003085132.1\|33368_33569_-	repressor PtrB	Q9ZXI6	Pseudomonas_virus	3.6e-08	50.0
WP_003113202.1\|34026_34797_+	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
WP_003121843.1\|34896_35211_+	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_015649712.1\|35397_36876_-	anthranilate synthase component I	S4VNU7	Pandoravirus	3.7e-41	29.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_NFFP01000002

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

182508 : 191537

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015649078.1\|182508_183144_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	7.8e-41	52.3
WP_003115226.1\|183189_184083_+	peptidoglycan DD-metalloendopeptidase family protein	A0A076G6R1	Bacillus_phage	1.0e-06	34.3
WP_003113871.1\|184187_185192_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.0e-34	34.8
WP_003092272.1\|185618_185942_-	ferredoxin family protein	NA	NA	NA	NA
WP_012613730.1\|186008_188576_-	DNA mismatch repair protein MutS	E5RUN9	Heterocapsa_circularisquama_DNA_virus	1.4e-19	21.5
WP_012613731.1\|188701_189709_-	TolB family protein	NA	NA	NA	NA
WP_003092262.1\|189856_190363_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
WP_003092260.1\|190496_191537_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_NFFP01000087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_NFFP01000087.1|WP_033975723.1|1982_2219_-|anti-CRISPR-protein-AcrF1

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_NFFP01000087.1|WP_033975723.1|1982_2219_-|anti-CRISPR-protein-AcrF1

1982_2219_-

78 aa aa

AcrIF1

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0001\|YP_007392342.1\|AcrIF1\|I-F\|Verified\|Pseudomonas-phage-JBD30	0.9871794871794872	1	1.0

NZ_NFFP01000087.1_1771_2011_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_NFFP01000087.1_1771_2011_-	YP_007392343.1	0.9493670886075949	1	1.0

5. NZ_NFFP01000033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

66301 : 75915

Pseudomonas_phage(83.33%)

integrase

attL 66938:66953|attR 70022:70037

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003111315.1\|66301_67891_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	5.9e-61	28.3
66938:66953	attL	NA	NA	NA	NA
WP_025297371.1\|67921_69139_-\|integrase	site-specific integrase	A0A0U4B0G7	Pseudomonas_phage	1.7e-230	99.5
WP_071537486.1\|69417_69852_-	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	3.8e-79	96.5
WP_025297372.1\|69848_70208_-	hypothetical protein	A0A1L2C9A6	Pseudomonas_phage	7.3e-12	40.2
70022:70037	attR	NA	NA	NA	NA
WP_025297373.1\|70204_70546_-	hypothetical protein	NA	NA	NA	NA
WP_175022313.1\|70542_71148_-	hypothetical protein	A0A125RNP8	Pseudomonas_phage	1.4e-52	64.8
WP_029771102.1\|71140_71455_-	hypothetical protein	B5WZV5	Pseudomonas_phage	2.6e-05	40.2
WP_162836282.1\|71451_71601_-	hypothetical protein	W6MWX2	Pseudomonas_phage	5.3e-17	89.8
WP_025297376.1\|71763_72165_-	hypothetical protein	NA	NA	NA	NA
WP_025297377.1\|72157_72901_-	hypothetical protein	W6MVL9	Pseudomonas_phage	6.8e-20	83.0
WP_025297378.1\|72897_73164_-	hypothetical protein	K7PMC8	Enterobacterial_phage	1.1e-07	46.7
WP_023127337.1\|74412_74637_-	hypothetical protein	A0A0U4J8X2	Pseudomonas_phage	1.6e-36	100.0
WP_025297380.1\|74799_75399_-	hypothetical protein	A0A0U4JEE7	Pseudomonas_phage	1.2e-110	100.0
WP_087937193.1\|75462_75915_-	single-stranded DNA-binding protein	A0A0U4K5C0	Pseudomonas_phage	1.2e-67	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_NFFP01000070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

473 : 6862

unidentified_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033975711.1\|473_4178_-	tape measure protein	B7SE05	Pseudomonas_virus	0.0e+00	97.6
WP_023109243.1\|4304_4823_-	hypothetical protein	I6PCB2	Pseudomonas_phage	1.4e-72	86.3
WP_023109244.1\|4826_5597_-	hypothetical protein	A0A0U5G7I9	unidentified_phage	6.2e-141	99.6
WP_003099460.1\|5629_5809_-	hypothetical protein	A0A0U5G7J8	unidentified_phage	2.9e-25	100.0
WP_023109245.1\|5796_6276_-	hypothetical protein	A0A0U5KSI7	unidentified_phage	1.3e-88	100.0
WP_022580022.1\|6272_6689_-	DUF1320 domain-containing protein	A0A0U5KQ53	unidentified_phage	7.6e-61	100.0
WP_012613796.1\|6685_6862_-	hypothetical protein	A0A0U5KPL8	unidentified_phage	2.6e-23	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_NFFP01000015

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

71 : 48821

Pseudomonas_phage(56.52%)

terminase,protease,integrase,tRNA,portal,capsid

attL 6804:6820|attR 51334:51350

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025297583.1\|71_809_-\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	2.0e-117	89.8
WP_012074147.1\|805_1828_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	1.1e-193	100.0
WP_025297582.1\|1827_2781_-\|capsid	GPO family capsid scaffolding protein	A0A0U4JVV6	Pseudomonas_phage	1.0e-145	99.7
WP_025297581.1\|2938_4987_+\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	0.0e+00	99.6
WP_025297580.1\|4898_5753_+\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	1.2e-129	97.9
WP_023122741.1\|5798_6059_+	ogr/Delta-like zinc finger family protein	U3PB63	Vibrio_phage	2.1e-13	47.6
WP_012074151.1\|6034_6244_-	hypothetical protein	NA	NA	NA	NA
WP_012074152.1\|6602_6884_-	hypothetical protein	A0A0U4B0R1	Pseudomonas_phage	1.7e-32	75.3
6804:6820	attL	NA	NA	NA	NA
WP_012074153.1\|6880_7111_-	hypothetical protein	NA	NA	NA	NA
WP_012074154.1\|7107_7323_-	hypothetical protein	NA	NA	NA	NA
WP_025297579.1\|7309_7723_-	hypothetical protein	NA	NA	NA	NA
WP_012074155.1\|7790_8147_-	hypothetical protein	A0A0U4JXA4	Pseudomonas_phage	6.3e-32	56.4
WP_012077220.1\|8162_8564_-	hypothetical protein	A0A0U4IIM6	Pseudomonas_phage	7.6e-50	72.2
WP_012074157.1\|8535_8736_-	hypothetical protein	NA	NA	NA	NA
WP_012077219.1\|9166_11860_-	toprim domain-containing protein	A0A0U3TH43	Pseudomonas_phage	2.0e-303	56.0
WP_012077218.1\|11870_12101_-	hypothetical protein	A0A0U4KLD7	Pseudomonas_phage	2.8e-25	84.2
WP_012077217.1\|12195_12432_+	helix-turn-helix domain-containing protein	A0A0U4ISL7	Pseudomonas_phage	1.7e-17	57.7
WP_012077216.1\|12436_13552_+\|integrase	tyrosine-type recombinase/integrase	A0A0U4IBS1	Pseudomonas_phage	2.3e-120	60.2
WP_015648083.1\|13582_13855_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_003094361.1\|13884_14745_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.0e-06	31.9
WP_003098853.1\|14746_15211_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003094359.1\|15224_15533_-	ribosome-associated translation inhibitor RaiA	A0A0M7QCF2	Escherichia_phage	1.8e-06	31.8
WP_003094357.1\|15610_17104_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003094355.1\|17329_18055_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	26.5
WP_003120916.1\|18054_18582_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_003094353.1\|18568_19141_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003098849.1\|19149_19689_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	3.4e-29	52.3
WP_003134758.1\|19688_20669_-	KpsF/GutQ family sugar-phosphate isomerase	A0A0B6VSY5	Edwardsiella_phage	8.1e-21	35.1
WP_003094343.1\|21082_21892_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-24	33.0
WP_015648084.1\|21891_22689_+	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_003094339.1\|22689_23163_+	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_003094337.1\|23174_23822_+	phospholipid-binding protein MlaC	NA	NA	NA	NA
WP_015648085.1\|23818_24127_+	anti-sigma factor antagonist	NA	NA	NA	NA
WP_003094334.1\|24243_24483_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_003094332.1\|24503_25769_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_015648086.1\|25786_26422_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_003094326.1\|26547_27870_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_003098833.1\|27872_28928_+	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	3.0e-21	28.3
WP_003098831.1\|28970_30140_-	trypsin-like peptidase domain-containing protein	A0A1B1IRD3	uncultured_Mediterranean_phage	6.5e-09	28.9
WP_003094318.1\|30256_31015_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_003112746.1\|31001_32105_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_003094311.1\|32448_33366_+	sulfate adenylyltransferase subunit CysD	A0A109Z8C1	Bacillus_phage	3.3e-08	26.4
WP_003455505.1\|33377_35279_+	sulfate adenylyltransferase subunit CysN	NA	NA	NA	NA
WP_003094304.1\|35352_35799_-	YhcB family protein	NA	NA	NA	NA
WP_014603291.1\|35943_36573_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_014603290.1\|36640_37987_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003094297.1\|38081_39176_+	cell division protein ZapE	NA	NA	NA	NA
WP_003116213.1\|39240_40203_-	hypothetical protein	NA	NA	NA	NA
WP_003120906.1\|40361_41261_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_003120905.1\|41514_42660_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_003098813.1\|42744_43782_-	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_003094164.1\|44027_44456_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_003098810.1\|44470_44863_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_003100631.1\|45112_45706_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_003094159.1\|45705_46917_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_003094157.1\|46916_47699_+	cytochrome c1	NA	NA	NA	NA
WP_003094155.1\|47784_48402_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_015648088.1\|48413_48821_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	5.9e-34	54.8
51334:51350	attR	NA	NA	NA	NA

DBSCAN-SWA_2

90171 : 97842

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003094072.1\|90171_90930_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	7.7e-11	28.6
WP_003112758.1\|91038_91773_+	HugZ family protein	NA	NA	NA	NA
WP_003094066.1\|91841_92309_+	membrane protein FxsA	NA	NA	NA	NA
WP_003094064.1\|92505_92799_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	7.5e-15	49.5
WP_025297577.1\|92849_94502_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.2e-175	64.2
WP_003120890.1\|94557_95244_-	hypothetical protein	NA	NA	NA	NA
WP_003094051.1\|95472_95856_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.7e-36	69.9
WP_003112759.1\|95875_96205_+	DUF190 domain-containing protein	A0A2H4J2R0	uncultured_Caudovirales_phage	3.1e-25	47.7
WP_003112760.1\|96147_96942_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003094039.1\|97158_97842_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-28	33.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_NFFP01000037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21757 : 65403

Pseudomonas_phage(90.74%)

terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025297800.1\|21757_22021_-	hypothetical protein	A0A0U4JX18	Pseudomonas_phage	4.3e-46	100.0
WP_023910116.1\|22056_22317_-	hypothetical protein	A0A0U4B0B7	Pseudomonas_phage	1.9e-38	100.0
WP_025297799.1\|22313_22682_-	hypothetical protein	H2BDA0	Pseudomonas_phage	5.2e-45	84.4
WP_025297798.1\|22678_23113_-	lysozyme	A0A0S2SYD0	Pseudomonas_phage	5.1e-76	100.0
WP_126122936.1\|23625_24987_+	hypothetical protein	A0A0U4IIU1	Pseudomonas_phage	1.4e-241	100.0
WP_034011451.1\|27125_29855_-	hypothetical protein	A0A127KNI3	Pseudomonas_phage	0.0e+00	98.7
WP_023082970.1\|29826_30234_-	C40 family peptidase	J7HX80	Pseudomonas_phage	3.8e-73	97.8
WP_025297794.1\|30238_30730_-	DUF1833 family protein	H2BD93	Pseudomonas_phage	1.5e-87	96.3
WP_025297793.1\|30713_31181_-	hypothetical protein	A0A125RNN3	Pseudomonas_phage	2.7e-91	98.1
WP_025297792.1\|31177_34189_-	tape measure protein	A0A125RNN2	Pseudomonas_phage	0.0e+00	98.4
WP_025297791.1\|34188_34806_-	hypothetical protein	H2BD90	Pseudomonas_phage	7.4e-113	98.5
WP_029771359.1\|34802_35798_-	Ig-like domain-containing protein	A0A125RNN0	Pseudomonas_phage	4.7e-157	99.7
WP_003127992.1\|35812_36187_-	hypothetical protein	J7I407	Pseudomonas_phage	5.7e-68	100.0
WP_031632521.1\|36183_36621_-	hypothetical protein	A0A125RNM8	Pseudomonas_phage	1.5e-72	97.2
WP_025297790.1\|36622_36961_-	hypothetical protein	A0A125RNM7	Pseudomonas_phage	3.1e-60	98.2
WP_025297789.1\|36957_37359_-	hypothetical protein	A0A125RNM6	Pseudomonas_phage	1.7e-70	97.7
WP_071574138.1\|37670_37862_-	glycoprotein	H2BD83	Pseudomonas_phage	4.6e-29	98.4
WP_025297787.1\|37871_38963_-	hypothetical protein	A0A125RNM3	Pseudomonas_phage	3.4e-185	88.5
WP_025297786.1\|38973_39420_-	hypothetical protein	A0A125RNM2	Pseudomonas_phage	2.1e-40	62.3
WP_025297785.1\|39423_40701_-	hypothetical protein	H2BD80	Pseudomonas_phage	2.8e-215	99.5
WP_171886502.1\|40704_41628_-\|head	phage head morphogenesis protein	H2BD79	Pseudomonas_phage	9.3e-168	98.4
WP_025297783.1\|41590_42961_-	DUF1073 domain-containing protein	H2BD78	Pseudomonas_phage	1.1e-262	98.0
WP_025297782.1\|42963_43161_-	hypothetical protein	H2BD77	Pseudomonas_phage	6.8e-28	98.5
WP_025297781.1\|43160_44417_-\|terminase	terminase	A0A125RNL7	Pseudomonas_phage	3.5e-250	99.3
WP_023098995.1\|44397_44865_-	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	2.3e-82	100.0
WP_025297780.1\|44896_45520_-	hypothetical protein	A0A125RNL5	Pseudomonas_phage	4.1e-119	97.6
WP_023098997.1\|45516_45789_-	hypothetical protein	A0A125RNL4	Pseudomonas_phage	8.8e-42	100.0
WP_023434898.1\|45791_46124_-	peptidase M48	A0A125RNL3	Pseudomonas_phage	2.6e-56	100.0
WP_003088433.1\|46985_47564_-	hypothetical protein	A0A0U4KL14	Pseudomonas_phage	7.7e-104	98.4
WP_003101062.1\|47563_47899_-	hypothetical protein	A0A125RNL0	Pseudomonas_phage	2.2e-58	99.1
WP_025297842.1\|47895_48477_-	recombination protein NinG	A0A125RNK9	Pseudomonas_phage	3.0e-95	87.6
WP_025297840.1\|48694_48904_-	hypothetical protein	NA	NA	NA	NA
WP_025297839.1\|48900_49164_-	hypothetical protein	A0A0S2SYB2	Pseudomonas_phage	7.7e-43	100.0
WP_023082527.1\|49160_49748_-	DUF1367 family protein	Q9MC49	Pseudomonas_phage	7.3e-110	99.5
WP_170954388.1\|49740_50148_-	hypothetical protein	Q9MC50	Pseudomonas_phage	2.4e-75	99.3
WP_025297838.1\|50362_50566_-	TraR/DksA family transcriptional regulator	H2BDI2	Pseudomonas_virus	6.8e-31	95.5
WP_029771370.1\|50567_51050_-	hypothetical protein	H2BDI1	Pseudomonas_virus	1.5e-81	99.4
WP_023082529.1\|51192_53022_-	toprim domain-containing protein	A0A0U4B0G9	Pseudomonas_phage	0.0e+00	94.4
WP_023464593.1\|53018_53867_-	helix-turn-helix domain-containing protein	A0A0A0YR83	Pseudomonas_phage	8.6e-11	45.7
WP_106120735.1\|53863_54289_-	GIY-YIG nuclease family protein	A0A2P0ZL92	Lactobacillus_phage	7.9e-05	37.3
WP_023099006.1\|54664_54976_-	hypothetical protein	Q37905	Pseudomonas_phage	9.8e-13	44.7
WP_023099007.1\|55265_55931_+	helix-turn-helix transcriptional regulator	H2BDH4	Pseudomonas_virus	1.8e-43	40.2
WP_071536331.1\|55978_56467_+	hypothetical protein	NA	NA	NA	NA
WP_023082999.1\|56873_57080_+	hypothetical protein	A0A0U4B0I0	Pseudomonas_phage	2.2e-29	94.1
WP_015649351.1\|57090_57297_+	hypothetical protein	A0A0U4IJ22	Pseudomonas_phage	3.9e-34	97.1
WP_134621334.1\|57575_58175_+	hypothetical protein	J7I0S5	Pseudomonas_phage	3.5e-43	45.6
WP_087937194.1\|58316_59234_+	hypothetical protein	A0A0U3TGV3	Pseudomonas_phage	3.0e-78	88.2
WP_025297920.1\|59465_59777_+	hypothetical protein	B5WZX2	Pseudomonas_phage	5.7e-05	39.3
WP_025297919.1\|59808_60003_+	hypothetical protein	NA	NA	NA	NA
WP_050397050.1\|60256_60514_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_023083003.1\|60510_60930_+	hypothetical protein	A0A0S2SY96	Pseudomonas_phage	3.9e-73	99.3
WP_023083004.1\|60926_61205_+	hypothetical protein	NA	NA	NA	NA
WP_071574137.1\|61201_61885_+	HNH endonuclease	A0A2I7R2R0	Vibrio_phage	5.6e-29	39.7
WP_025297916.1\|61881_62202_+	hypothetical protein	A0A125RNR7	Pseudomonas_phage	7.2e-11	41.5
WP_025297915.1\|62308_62668_+	hypothetical protein	B5WZW7	Pseudomonas_phage	3.3e-65	96.6
WP_023098766.1\|62664_62802_+	hypothetical protein	A0A0S2SY24	Pseudomonas_phage	1.9e-16	97.7
WP_014603746.1\|62974_64039_+	hypothetical protein	Q9MC69	Pseudomonas_phage	5.6e-84	94.9
WP_025297913.1\|64046_64793_+	phage recombination protein Bet	A0A0U4JIS4	Pseudomonas_phage	3.9e-140	100.0
WP_025297912.1\|64776_65403_+	YqaJ viral recombinase family protein	A0A0U4JVN8	Pseudomonas_phage	1.1e-116	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

9. NZ_NFFP01000001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_NFFP01000001_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_NFFP01000001_1

99442-99536

Orphan

Consensus_repeat	Method
GCCGACAACGGCAGCGAGCAGACCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_NFFP01000001_1

>merge|NZ_NFFP01000001|1|99442-99536|CRISPRCasFinder
GCCGACAACGGCAGCGAGCAGACCGTCGACCGCCTGCACAAGGACATGACCAAGGCCGAAGCCCGCCTGGCCGACAACGGCAGCGAACAGACCGT

>NZ_NFFP01000001|1|1|99442-99536|CRISPRCasFinder
GCCGACAACGGCAGCGAGCAGACCGT	CGACCGCCTGCACAAGGACATGACCAAGGCCGAAGCCCGCCTG
GCCGACAACGGCAGCGAACAGACCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_NFFP01000001.1\|WP_003095488.1\|94382_94727_+\|osmotically-inducible-lipoprotein-OsmE	unknown	unknown	gnl\|CDD\|183058
NZ_NFFP01000001.1\|WP_003095492.1\|94770_95178_-\|Rho-termination-factor-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377850
NZ_NFFP01000001.1\|WP_003107570.1\|107844_108474_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236881
NZ_NFFP01000001.1\|WP_015647955.1\|100461_101076_-\|cytochrome-b/b6-domain-containing-protein	unknown	unknown	gnl\|CDD\|226602
NZ_NFFP01000001.1\|WP_003095479.1\|93183_93600_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183165
NZ_NFFP01000001.1\|WP_003095483.1\|93754_94294_+\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225167
NZ_NFFP01000001.1\|WP_003121124.1\|89966_90581_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000001.1\|WP_003095519.1\|103940_105257_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_NFFP01000001.1\|WP_003095496.1\|95324_96137_+\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	unknown	unknown	gnl\|CDD\|226231
NZ_NFFP01000001.1\|WP_003121132.1\|105476_106589_-\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|225779
NZ_NFFP01000001.1\|WP_015647956.1\|96138_98208_-\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_NFFP01000001.1\|WP_003095513.1\|101129_101753_-\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000001.1\|WP_003095526.1\|108703_109207_+\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237322
NZ_NFFP01000001.1\|WP_025297607.1\|106585_107686_-\|ferredoxin-reductase	unknown	unknown	gnl\|CDD\|99812
NZ_NFFP01000001.1\|WP_015647954.1\|102558_103950_+\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_NFFP01000001.1\|WP_003095515.1\|101890_102580_+\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_NFFP01000001.1\|WP_003121125.1\|90672_91536_-\|oxaloacetate-decarboxylase	unknown	unknown	gnl\|CDD\|225311
NZ_NFFP01000001.1\|WP_003095503.1\|98503_99037_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|225104
NZ_NFFP01000001.1\|WP_003099398.1\|91743_93009_+\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212673
NZ_NFFP01000001.1\|WP_003112308.1\|99697_100465_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026

Protein	Function_ID	Function_description	E-value
NZ_NFFP01000001.1\|WP_003095488.1\|94382_94727_+\|osmotically-inducible-lipoprotein-OsmE	gnl\|CDD\|183058	PRK11251, PRK11251, osmotically-inducible lipoprotein OsmE.	1.90142e-51
NZ_NFFP01000001.1\|WP_003107570.1\|107844_108474_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|236881	PRK11202, PRK11202, HTH-type transcriptional repressor FabR.	4.59942e-41
NZ_NFFP01000001.1\|WP_015647955.1\|100461_101076_-\|cytochrome-b/b6-domain-containing-protein	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	2.81233e-70
NZ_NFFP01000001.1\|WP_003095479.1\|93183_93600_-\|hypothetical-protein	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	1.76735e-18
NZ_NFFP01000001.1\|WP_003095483.1\|93754_94294_+\|MOSC-domain-containing-protein	gnl\|CDD\|225167	COG2258, COG2258, Uncharacterized protein conserved in bacteria [Function unknown].	5.52525e-29
NZ_NFFP01000001.1\|WP_003095492.1\|94770_95178_-\|Rho-termination-factor-N-terminal-domain-containing-protein	gnl\|CDD\|377850	pfam07498, Rho_N, Rho termination factor, N-terminal domain. The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It it thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers. This domain is found to the N-terminus of the RNA binding domain (pfam07497).	0.000208897
NZ_NFFP01000001.1\|WP_003095519.1\|103940_105257_-\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.70918e-108
NZ_NFFP01000001.1\|WP_003095496.1\|95324_96137_+\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	gnl\|CDD\|226231	COG3708, COG3708, Uncharacterized protein conserved in bacteria [Function unknown].	1.65802e-48
NZ_NFFP01000001.1\|WP_003121132.1\|105476_106589_-\|fatty-acid-desaturase	gnl\|CDD\|225779	COG3239, DesA, Fatty acid desaturase [Lipid metabolism].	7.76501e-66
NZ_NFFP01000001.1\|WP_015647956.1\|96138_98208_-\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	0
NZ_NFFP01000001.1\|WP_003095526.1\|108703_109207_+\|urease-accessory-protein-UreE	gnl\|CDD\|237322	PRK13261, ureE, urease accessory protein UreE; Provisional.	2.44267e-58
NZ_NFFP01000001.1\|WP_025297607.1\|106585_107686_-\|ferredoxin-reductase	gnl\|CDD\|99812	cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	8.42632e-88
NZ_NFFP01000001.1\|WP_015647954.1\|102558_103950_+\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_NFFP01000001.1\|WP_003095515.1\|101890_102580_+\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	2.43467e-112
NZ_NFFP01000001.1\|WP_003121125.1\|90672_91536_-\|oxaloacetate-decarboxylase	gnl\|CDD\|225311	COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism].	1.3777e-87
NZ_NFFP01000001.1\|WP_003095503.1\|98503_99037_+\|bacterioferritin	gnl\|CDD\|225104	COG2193, Bfr, Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism].	1.01703e-50
NZ_NFFP01000001.1\|WP_003099398.1\|91743_93009_+\|Hsp70-family-protein	gnl\|CDD\|212673	cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins. This bacterial subfamily includes the uncharacterized Escherichia coli YegD. It belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. YegD lacks the SBD. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some family members are not chaperones but instead, function as NEFs for their Hsp70 partners, other family members function as both chaperones and NEFs.	0
NZ_NFFP01000001.1\|WP_003112308.1\|99697_100465_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	5.57634e-96

>NZ_NFFP01000001.1|WP_003095503.1|98503_99037_+|bacterioferritin
MTTVQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQEMQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILAQEEEHADDMADILDDLA
>NZ_NFFP01000001.1|WP_015647956.1|96138_98208_-|AsmA-family-protein
MTRGRKILTWSLASLVLLLAALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFSAEDITLGNPEWTAGKTKASEFASLERIEFRLAPLPLLWQTIRIPQIKLTQPRADLLRLADGRANWDFDLPASDSDEPSAWQLDIREIGFDKGSVSLDDQRLKTRLEVLVDPLGKPVPFGQLAGKALATGDAANAQDYVFGWKVKGTYKGQALAGSGKVGGMLALQDASKPFPLQAEVSAGSTRAAVVGTLTDPLNLGALDLRLKLSGTSMANLYPLTGITLPDTPAYSTDGHLLARLKEEGGALFRYENFNGKVGASDLHGSLTFVARQPRPKLSGKLTSEQLRFADLGPLIGADSNAEKQKRGQTSRQPGDKVLPVEEFRTERWRDMDADVEFTGKRIVHSDQLPISDLYTHLVLNDGLLRLEPLRFGVAGGKLESDIRLDGGKQPMQSRVKMSARGFKLKQLFPGFAPMQTSFGELNGDASLSGSGNSVAKILGGADGELKMLINDGAISKGLTEIAGLNVGNYLVTKLFGDDEVKINCAAADFGLQKGLMTSRLFVFDTENALVNVDGTVNFANEKLDLDVTPHSKGLRIFSLRSPLYVRGTFAKPDAGVHAGPLVARGAGMIALGVTVGPAASLLALVAPSKSDDNQCTALLQRMRLPAKVPAGKR
>NZ_NFFP01000001.1|WP_003095496.1|95324_96137_+|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR
MLTIGQLARIFEISTKTLRHYDAIGLFVPARTGSDNGYRYYQPEQIEQLSRILALRRLDVPLEAIDRLKRDGALDDPQRLRHFLQRHQHTLREEISARQRLLAELDRTLATLAHWRIRNMHARIVERPAFSVVGMEYFGSAPGDTIGQLWERFIPREHEIAGKHDPEVSYGICAQQPNGEFHYVAGFEVQEGWPVPEGMVRFQVPAQKYAVFTHKGTAPQIAESFQAIYSHLLAERGLEPKAGVDFEYYDQRFRGPLDPNSQVDLYIPIY
>NZ_NFFP01000001.1|WP_003095492.1|94770_95178_-|Rho-termination-factor-N-terminal-domain-containing-protein
MPRGDKSKYSDKQQRKAEHIEESYKAKGVSESEAEARAWATVNKQSGGGERKGGSGRAKSETAKRADRKDSAHRAAQARSGRPANRGSASRGKRQGSTSVSEMTREELMQLARKRDIRGRSTMRKAELIEALSRA
>NZ_NFFP01000001.1|WP_003095488.1|94382_94727_+|osmotically-inducible-lipoprotein-OsmE
MYKQSLAALFVMATLAGCASTKVQNPVNYITFRNEPLVKDVEKGMSQQEVLRIGGTPSGTQKRLMKPGSCNSYILNKDGQQQPFYVSFDGSGKVDGSGFLSCSELDRHERDARP
>NZ_NFFP01000001.1|WP_003095483.1|93754_94294_+|MOSC-domain-containing-protein
MQQVIAVSLCATHAFSKQVRPAIRLLKGLGVEGDAHHGVTVKHRSRVRQDPTQPNLRQVHLIHEELHDELRASGFAIGPGTMGENITTRGVDLLGLPTGTRLRLGESALVELTGLRNPCSQLDNYQPGLTAAVLGRDEQGNLIRKAGVMAIVLEDGEVRPGDAIDIQLPPLPHRALEKV
>NZ_NFFP01000001.1|WP_003095479.1|93183_93600_-|hypothetical-protein
MNILRIPMFVLAMAVSAHGFAATAQQEKMTACNAEATTKALKGDERKAFMSGCLKAGAPAGGKATAQQEKMKSCNADASAKSLKGDERKAFMSSCLKAGGSAKAATQQEKMKTCNADATAKALKGDERKAFMSTCLKK
>NZ_NFFP01000001.1|WP_003099398.1|91743_93009_+|Hsp70-family-protein
MNPSTAARALGIDFGTSNSTVGWWRPEVEPLIELEDGKITLPSVVFFNVEERRPVYGRQALGEYLEGYEGRLMRSLKSLLGSKLLKSETTVLGSALPFKDLLGLFIGQLKARGEAAAGQAFDAVVLGRPVFFVDDDPEADREAQDTLVQVANKLGFKEVSFQYEPIAAAFDYERCIQREELVLIVDIGGGTSDFSLVRLAPERRNLAERQDDILATGGVHIGGTDFDKQLSLEGVMPLFGYGSRMKSDAFMPTSYHLNLATWHTINAVYAQKSQLALKNMRYDIVDSTGIDRLFRLIEERAGHWLAMQVEDSKIRLTETERLHLSLERIEAGLGVELTRGLFENAVDGLLERVRNSVAQLLASAGVDPDRVDTVFFTGGSSGIPALRRSVSAMLPNARHVEGNLFGSIGSGLAIEAKKRYG
>NZ_NFFP01000001.1|WP_003121125.1|90672_91536_-|oxaloacetate-decarboxylase
MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVVVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEYQAWARDYMEVKE
>NZ_NFFP01000001.1|WP_003121124.1|89966_90581_+|hypothetical-protein
MMGPFRRLAHLIDQGRQLDAALAGDPFALPAPEDRYSVRQLHGLYPRRHPGLYAPLLGSLALLLGAAPLGLAALRLALPEAPLRPLGWLSALPLLAAWLWLIALLSRGASLGPRLARDASLLLVATGLLLRLASGETSGLVALGGGACAWLLFNSRAMQRYMELVYAQRLYRAQSANRPGSAQRRLANQAAYRERKRRERSGRS
>NZ_NFFP01000001.1|WP_003112308.1|99697_100465_-|molybdopterin-dependent-oxidoreductase
MKGPEKKRAKIAIDPSSERQMVDLQRRLLLRGGLSLGALAMLSGCRLQDGDSVDKVLWAMSRWNDRVQAWLFSRTRLAPTFDPSQVASPFPFNAFYPAYNVPEIDLPEYRLQVSGRVRDKRPWSLEQLRRLPQASQVTQLICIEGWSAIGQWSGVPLRTFLELVGADTSAKYVGFKCADRYYSSLDMPSALHPQTLLALEMSGQALPEENGYPLRLRIPTKLGFKNAKHVVEIFVSNSNPGGYWEDQGYNWFSGV
>NZ_NFFP01000001.1|WP_015647955.1|100461_101076_-|cytochrome-b/b6-domain-containing-protein
MNRALHAWPVRLCHWLNAYAMACLIGSGWGIYNASPLLDFRFPAWATLGGWLGGSIAWHLAAMWLLLGNGLCYLAYGLSSGHFRRDFLPLSAAGVWRDLRLALGLRLVHEPGRYNAVQRLLYWLVLGLGALLVLSGLAIWKPVQLHGLTVLFGGFQGARWVHFLAMAGVVGFVVVHLLLVLLVPRTLLPMIIGREWRRGRRSEG
>NZ_NFFP01000001.1|WP_003095513.1|101129_101753_-|hypothetical-protein
MLRLKASPALLFGLLLASAASFAAQPPAGMLQPLRGTIQQAADDHLQLKARNGQQLTVRLTDKTAIRAVSLAKPEDIQPDSFIGTAAVPQPDGTLKALEVHVFAPSLRGSGEGHRPWENADGSASTMTNGTVGNLVVSQGRRMTVKYGDGEKTVVVPDDVPIVSLEPGERSLLKPGAKVVLFPQKGADGSLTALAISVGKDGVTPPM
>NZ_NFFP01000001.1|WP_003095515.1|101890_102580_+|heavy-metal-response-regulator-transcription-factor
MRILVIEDDTKTGEYLKKGLGESGYAVDWSQHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTARDQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLQLDVLRRKVSRQGQVIALTNKEFALLHLLMRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP
>NZ_NFFP01000001.1|WP_015647954.1|102558_103950_+|heavy-metal-sensor-histidine-kinase
MPARRSLTLYAALLFAAVAALVVSAVGFYLYRSVEEAMLRRSDVMVAGRVEHFRNLLRDNLTLAELKARPRLFENMLGNEQDILLLGQPGEAPIVAVNPRHERLPSLRVVAAGQALNPSVVHAALTHDGVPMRVLAAEVLVGGREPLQITAAHLLLGETRMLAQYRDRVIAAVLLAFLGTALLGWLVLRHGLRPLRTLAAKAAEIHPTSLDTRLDVAAAPAELQQVAQSFNAMLERLDDGYQRLQQFSADLAHEIRTPIGSLMGHGQVALRQPRSNEEYQALIASNQEELERIARMVESILFLARADDVRAAVERSRLDLGEELRRQAEYFEGLAEERGLSLDVQVSGQLRADPQLFRRALSNLLANAIRYASADSLIEVRGLRRSGEFLLSVENACDRLPAEPLSRLFDRFYRGDAARSDAQSSGLGLAIVQAIMRLHGGRAEASAPAPGRIRFDLAFPAQD
>NZ_NFFP01000001.1|WP_003095519.1|103940_105257_-|MFS-transporter
MFSPLVTFPALYTATLLMLAGSGLFTTYIGLRLTQEGAGDLWVGGLMASYYFGLVCGGKFGHKLIASFGHIRSYVACAGIATVTVLLHALVDQLEVWLLLRFITGAVMMNQYMVIESWLNEQAESHQRGKVFAGYMVAVDLGLVLGQGLLALSPTLDYKPLLLVAICFASCLIPLAMTRRVHPAKLVAAPLEVRFFWQRVPQALGTIFIAGLMVGAFYGLAPVYANRNGLDASQSSFFVGMCIVAGFCAQWPLGWLSDRLDRSWLIRGNAVLLCLASIPMWGLVTLPYWLLLANGFVTGMLLFTLYPLAVALANDHVEQPRRVALSAMLLTTYGVGACIGPLVAGALMRHFGPGLFYMLVSGYAVLLVFWVQPKRVTGEHRVDEAPLQHVAMPDTVSPMAATLDPRVEEVPEELVVEAPANIGRSDGEPDAGEKPAQS
>NZ_NFFP01000001.1|WP_003121132.1|105476_106589_-|fatty-acid-desaturase
MNRPASPAMRDDRELTPEQLAAFGAELDALRLRTLADLGADDARYIRRVRAAVRVCCWSGRALLMFGWLPPTWLLGSLLLGLGKILENMELGHNVMHGQYDWMNDPEFAGRAYEWDIAGPSDFWRHTHNHIHHTYTNVLGKDDDVGYGVVRLFPEQRWKPFYRWQPLWVTLQALLFQYAVAIQHLRLDKYAKGRLDKAELMPLLRRLRAKLGRQWTKDYLLFPLLGLFAGGFGAVFVGNLLANVLRNLWTFTVIFCGHFTEKAVVFPPSVLEGETRGHWYLRQLRGSSNLEGGPLFHILTGNLSHQIEHHLYPDLPARRYAALSREVREIARRYGQTYNSGRLGRQFLTVLRRIWVYRLPPREPLPAGRG
>NZ_NFFP01000001.1|WP_025297607.1|106585_107686_-|ferredoxin-reductase
MALLPLALLTPLLAPLRRLAARGWLREVDVDGLLRHAHPLASLNRHYARVEARYWVADDMLALALRTAPGWPPVRPGQHIQLLAERDGVRVGRSYSLTRVVGERLEIAVKRHPDGLLSPWLCEHLAVGQRVELQPAQGDLRWPMQAEAVCLLAAGSGLTPLLGLLREALENGYRGPVLWLHYVRHPGQRAWLGELEALAARHPNLELRWSLTRGARADGCLEGHFQPRHLDGWAADLARSQALACGPAAFVEAVGEQLGARFAGLQTESFSVPRWRSGEAPREVRLRFARSQREVSGDSAASLLEQAEAHGLRPAHGCRQGICASCTCVLLSGCVRDLRSGALCSEPGQPIRLCVSAAHGDLALDL
>NZ_NFFP01000001.1|WP_003107570.1|107844_108474_+|TetR-family-transcriptional-regulator
MSSPRAEQKQQTRHALMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHFSDMDQLGLALVAEVDETFRATLRAVRRNEFELGGLIDASVRIFLDAVGANRSQFLFLAREQYGGSLPIRQAIASLRQRITDDLAADLALLNKMPHLDGAALDVFADLVVKTVFATLPELIDPPAADLPPHLMPAAKITHQLRFIMIGGKHWHGLPG
>NZ_NFFP01000001.1|WP_003095526.1|108703_109207_+|urease-accessory-protein-UreE
MLVIHQRLPARSPRWDEELHLTYEARSKSRLRCFAASGEEVGLFLERGQPPLADGDCLEARDGRLVRVVARSERLLHVTCASPLELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQLGATVEAIEAPFQPEHGAYGGGHHHSHHGEAEFNYAPRLHQFGVRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

10. NZ_NFFP01000049

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_NFFP01000049.1|WP_087937214.1|23585_23825_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_NFFP01000049.1|WP_087937215.1|23826_24147_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_NFFP01000049.1|WP_087937216.1|24171_24408_-|anti-CRISPR-protein-AcrF1

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_NFFP01000049.1|WP_087937214.1|23585_23825_-|hypothetical-protein

23585_23825_-

79 aa aa

AcrIE6

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0488\|WP_087937214.1\|AcrIE6\|I-E\|Verified\|Pseudomonas-aeruginosa	1.0	1	1.0

NZ_NFFP01000049.1_23376_23589_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_NFFP01000049.1_23376_23589_-	AcrIE7-Aca1\|WP_087937213.1	1.0	1	1.0

NZ_NFFP01000049.1|WP_087937215.1|23826_24147_-|hypothetical-protein

23826_24147_-

106 aa aa

AcrIE7

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0489\|WP_087937215.1\|AcrIE7\|I-E\|Verified\|Pseudomonas-aeruginosa	1.0	1	1.0

NZ_NFFP01000049.1_23376_23589_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_NFFP01000049.1_23376_23589_-	AcrIE7-Aca1\|WP_087937213.1	1.0	1	1.0

NZ_NFFP01000049.1|WP_087937216.1|24171_24408_-|anti-CRISPR-protein-AcrF1

24171_24408_-

78 aa aa

AcrIF1

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0001\|YP_007392342.1\|AcrIF1\|I-F\|Verified\|Pseudomonas-phage-JBD30	0.935064935064935	1.0	0.9871794871794872

NZ_NFFP01000049.1_23376_23589_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_NFFP01000049.1_23376_23589_-	AcrIE7-Aca1\|WP_087937213.1	1.0	1	1.0

11. NZ_NFFP01000132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_NFFP01000132.1|WP_016068584.1|319_622_-|anti-CRISPR-protein-AcrFgp36

Click the colored protein region to show detailed information

Acr_ID: NZ_NFFP01000132.1|WP_022580027.1|618_816_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_NFFP01000132.1|WP_016068584.1|319_622_-|anti-CRISPR-protein-AcrFgp36

319_622_-

100 aa aa

AcrIF4

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0002\|YP_007392799.1\|AcrIF4\|I-F\|Verified\|Pseudomonas-phage-JBD24	1.0	1	1.0

NZ_NFFP01000132.1_108_357_-

Protein_id	Hit_Aca_id	Identity	Query_coverage	Hit_coverage
NZ_NFFP01000132.1_108_357_-	WP_046599059.1	0.9878048780487805	1	1.0

NZ_NFFP01000132.1|WP_022580027.1|618_816_-|hypothetical-protein

618_816_-

65 aa aa

AcrIE3

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR0408\|YP_950454.1\|AcrIE3\|I-E\|Verified\|Pseudomonas-phage-DMS3	0.967741935483871	0.9692307692307692	0.9117647058823529

12. NZ_NFFP01000030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

54507 : 91120

Pseudomonas_phage(91.3%)

lysis,plate,protease,head,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071534013.1\|54507_55986_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_009315920.1\|56059_57514_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003094397.1\|57529_57817_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_003094393.1\|58056_59094_+	rod shape-determining protein	NA	NA	NA	NA
WP_071533941.1\|59125_60166_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003094389.1\|60165_60660_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003162780.1\|60749_61355_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003094386.1\|61388_62846_+	ribonuclease G	NA	NA	NA	NA
WP_015648082.1\|62860_66691_+	TIGR02099 family protein	NA	NA	NA	NA
WP_003112739.1\|66740_67589_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003098866.1\|67591_69034_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_003120921.1\|69064_69667_-	ribosome-associated protein	NA	NA	NA	NA
WP_003110024.1\|69687_71037_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_003162782.1\|71184_71580_+	hypothetical protein	NA	NA	NA	NA
WP_003098863.1\|71572_72949_+	class II fumarate hydratase	NA	NA	NA	NA
WP_003094369.1\|72976_73426_+	hypothetical protein	NA	NA	NA	NA
WP_003098862.1\|73438_74050_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	4.4e-81	72.8
WP_003120918.1\|74068_75001_+	ZIP family metal transporter	NA	NA	NA	NA
WP_071534354.1\|75543_75726_+	type II toxin-antitoxin system HicA family toxin	A0A0U4KLG1	Pseudomonas_phage	3.7e-28	100.0
WP_012077229.1\|75753_76158_+	type II toxin-antitoxin system HicB family antitoxin	A0A0U4ISP5	Pseudomonas_phage	4.2e-72	100.0
WP_012077228.1\|76200_77172_-	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	1.4e-182	100.0
WP_033896049.1\|77156_77855_-	hypothetical protein	A0A1D9CA29	Salinivibrio_phage	9.5e-40	36.9
WP_012074127.1\|77854_78394_-	hypothetical protein	A0A0U4J942	Pseudomonas_phage	8.0e-95	100.0
WP_012074128.1\|78390_79311_-	hypothetical protein	NA	NA	NA	NA
WP_012074129.1\|79307_80018_-	hypothetical protein	A0A0U4JEJ6	Pseudomonas_phage	4.7e-135	100.0
WP_025297588.1\|80031_81996_-\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	0.0e+00	100.0
WP_012074131.1\|82007_82532_-\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	5.7e-98	100.0
WP_012074132.1\|82524_83697_-\|plate	baseplate J/gp47 family protein	A0A0U4JJ14	Pseudomonas_phage	1.5e-223	100.0
WP_012074133.1\|83693_84014_-	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	4.2e-51	100.0
WP_012074134.1\|84010_86065_-\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	0.0e+00	100.0
WP_012074135.1\|86079_86220_-	hypothetical protein	A0A0U4B0S4	Pseudomonas_phage	2.2e-20	100.0
WP_012074136.1\|86243_86531_-	hypothetical protein	A0A0U4B0P2	Pseudomonas_phage	2.0e-44	100.0
WP_012074137.1\|86527_87013_-\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	4.2e-79	100.0
WP_012074138.1\|87009_87471_-	lysozyme	A0A0U4JP67	Pseudomonas_phage	1.4e-79	100.0
WP_025297585.1\|87467_87773_-	hypothetical protein	A0A0H5AUD7	Pseudomonas_phage	7.6e-10	40.4
WP_012074140.1\|87772_87982_-	TraR/DksA family transcriptional regulator	A0A0U4IIN4	Pseudomonas_phage	5.2e-34	100.0
WP_029771257.1\|87981_88413_-	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	1.9e-75	100.0
WP_012074142.1\|88434_89550_-	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	5.0e-208	100.0
WP_012074143.1\|89561_90227_-	virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	2.7e-121	100.0
WP_012074144.1\|90219_90657_-\|tail	phage tail protein	A0A0U4IBS7	Pseudomonas_phage	8.5e-79	100.0
WP_012074145.1\|90658_91120_-\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	2.0e-78	96.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

13. NZ_NFFP01000019

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

141588 : 145281

Pseudomonas_phage(83.33%)

integrase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015994775.1\|141588_142248_-	helix-turn-helix transcriptional regulator	A0A0A1IWY4	Pseudomonas_phage	1.2e-121	100.0
WP_015994776.1\|142488_142845_+	helix-turn-helix domain-containing protein	A0A0A1IVZ1	Pseudomonas_phage	1.7e-61	100.0
WP_033975765.1\|142847_143282_+	hypothetical protein	A0A0A1IVF5	Pseudomonas_phage	8.7e-76	99.3
WP_015972845.1\|143281_143608_+	hypothetical protein	L7SW73	Pseudomonas_phage	1.3e-52	100.0
WP_033975761.1\|143604_144015_+	hypothetical protein	B7SDW8	Pseudomonas_virus	7.5e-61	99.3
WP_143485830.1\|144007_145281_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	L7P839	Pseudomonas_phage	5.4e-243	99.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

14. NZ_NFFP01000027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12722 : 52065

Planktothrix_phage(33.33%)

plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015648865.1\|12722_14000_-\|tail	pyoverdine-tailoring periplasmic protein PvdN	NA	NA	NA	NA
WP_012614138.1\|14011_15370_-\|tail	pyoverdine-tailoring dipeptidase-like protein PvdM	NA	NA	NA	NA
WP_025297422.1\|15584_17222_+	pyoverdine maturation tyrosinase PvdP	NA	NA	NA	NA
WP_031757762.1\|17270_18695_-	pyoverdine export/recycling transporter outer membrane subunit OmpQ	NA	NA	NA	NA
WP_003131508.1\|18700_20692_-	pyoverdine export/recycling transporter ATP-binding/permease subunit PvdT	G9BWD6	Planktothrix_phage	6.9e-35	39.3
WP_015648862.1\|20691_21867_-	pyoverdine export/recycling transporter periplasmic adaptor subunit PvdR	NA	NA	NA	NA
WP_015648861.1\|21967_22963_-	FecR family protein	NA	NA	NA	NA
WP_003103620.1\|23126_23606_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_015648860.1\|23738_25070_+	L-ornithine N(5)-monooxygenase	NA	NA	NA	NA
WP_003144019.1\|25192_27481_+	acylase	NA	NA	NA	NA
WP_003089535.1\|27661_27985_+	transcriptional repressor	NA	NA	NA	NA
WP_003114511.1\|28026_28947_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_033895540.1\|29043_30195_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_003089526.1\|30261_30504_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_003104944.1\|30798_31035_+	hypothetical protein	NA	NA	NA	NA
WP_003089521.1\|31301_31772_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_025297421.1\|31768_34084_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_023085259.1\|34500_35706_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003110901.1\|35906_36548_-	response regulator transcription factor	NA	NA	NA	NA
WP_003089513.1\|36824_37220_+	DUF4280 domain-containing protein	NA	NA	NA	NA
WP_015648858.1\|37242_37779_-	toxin-antitoxin system YwqK family antitoxin	NA	NA	NA	NA
WP_025297420.1\|37789_39793_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.5e-42	29.6
WP_003116945.1\|39799_40585_-	hypothetical protein	NA	NA	NA	NA
WP_003116944.1\|40654_41530_-	hypothetical protein	NA	NA	NA	NA
WP_087937186.1\|41620_44170_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	7.6e-79	30.2
WP_025297419.1\|44171_45188_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_025297418.1\|45151_46945_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003122696.1\|46928_47354_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_003089495.1\|47366_47864_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_003089494.1\|47937_49422_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003089493.1\|49444_49990_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003089492.1\|50197_50674_+	hypothetical protein	NA	NA	NA	NA
WP_031629011.1\|50733_52065_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

15. NZ_NFFP01000011

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

135445 : 141632

Vibrio_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092836.1\|135445_135937_+	Fe-S cluster assembly transcriptional regulator IscR	M4M9K8	Vibrio_phage	2.2e-06	30.7
WP_003092832.1\|135966_137181_+	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	2.6e-32	36.9
WP_003092829.1\|137216_137603_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	79.8
WP_003100617.1\|137630_137954_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.8e-24	50.5
WP_003092824.1\|137961_138483_+	co-chaperone HscB	NA	NA	NA	NA
WP_003100622.1\|138525_140385_+	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	4.8e-107	40.1
WP_003092818.1\|140391_140730_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003092814.1\|140756_140957_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003092811.1\|141200_141632_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.2e-22	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

16. NZ_NFFP01000007

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27852 : 89854

uncultured_Mediterranean_phage(15.38%)

tRNA,protease,transposase,integrase

attL 56486:56503|attR 74644:74661

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003097276.1\|27852_28800_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_003100271.1\|28799_30854_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_033896138.1\|30910_32617_-	hypothetical protein	NA	NA	NA	NA
WP_031757402.1\|32948_33485_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_003100265.1\|33496_34270_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003097268.1\|34592_37013_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.1e-114	34.9
WP_003118474.1\|37009_38119_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003097262.1\|38128_39232_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	6.7e-56	36.1
WP_003109151.1\|39260_40805_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003100258.1\|41330_41465_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003100251.1\|41479_41887_+	ribonuclease P protein component	NA	NA	NA	NA
WP_003097255.1\|42127_43864_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_003100248.1\|43934_45302_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_003100246.1\|45796_46021_+	hypothetical protein	NA	NA	NA	NA
WP_014603452.1\|46494_48387_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_003100242.1\|48386_49031_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_003097243.1\|49049_49838_+	ParA family protein	Q8JL10	Natrialba_phage	3.8e-21	35.5
WP_003100240.1\|49847_50720_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	8.9e-11	34.6
WP_003118473.1\|50883_51264_+	F0F1 ATP synthase subunit I	NA	NA	NA	NA
WP_003100237.1\|51280_52150_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_003097235.1\|52199_52457_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_003100235.1\|52514_52985_+	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_003097135.1\|52996_53533_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_003097134.1\|53551_55096_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_003097132.1\|55146_56007_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_003097130.1\|56037_57414_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
56486:56503	attL	NA	NA	NA	NA
WP_003097128.1\|57455_57881_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_003114651.1\|58001_59366_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	2.4e-31	35.0
WP_015649893.1\|59379_59889_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_009877311.1\|59956_60730_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_003097120.1\|60745_62581_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	2.8e-131	42.6
WP_025297933.1\|62726_63554_+\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_013984538.1\|63567_65628_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_013984537.1\|65620_67231_+	ATP-binding protein	NA	NA	NA	NA
WP_034000753.1\|67232_68735_+	TnsD family Tn7-like transposition protein	NA	NA	NA	NA
WP_025297844.1\|68727_70350_+	hypothetical protein	NA	NA	NA	NA
WP_001446199.1\|70941_71205_-\|transposase	transposase	A0A218MNG9	uncultured_virus	6.3e-05	41.7
WP_025297682.1\|71219_71483_+	hypothetical protein	NA	NA	NA	NA
WP_025297683.1\|71706_71988_+	helix-turn-helix domain-containing protein	A0A1B1IUF9	uncultured_Mediterranean_phage	8.0e-06	39.3
WP_016782887.1\|72022_72592_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_034000756.1\|72689_75551_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	6.9e-129	41.1
74644:74661	attR	NA	NA	NA	NA
WP_034000759.1\|75567_76998_+	cardiolipin synthase	NA	NA	NA	NA
WP_025297816.1\|77025_78843_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	1.9e-103	40.9
WP_001275372.1\|78930_79389_+	small heat shock protein sHSP20-GI	NA	NA	NA	NA
WP_025297817.1\|79411_80326_+	heat resistance protein YfdX1	NA	NA	NA	NA
WP_034000762.1\|80428_81316_+	heat resistance protein YfdX2	NA	NA	NA	NA
WP_023657744.1\|81412_82024_+	heat resistance membrane protein HdeD-GI	NA	NA	NA	NA
WP_025297970.1\|82103_83249_+	hypothetical protein	NA	NA	NA	NA
WP_000786814.1\|83238_83679_+	heat resistance system thioredoxin Trx-GI	A0A023NHA9	Dinoroseobacter_phage	5.8e-11	34.7
WP_034000769.1\|83682_85389_+	cation:proton antiporter	NA	NA	NA	NA
WP_020805429.1\|86468_86903_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_034000773.1\|86889_87759_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_025297756.1\|87778_88930_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	9.9e-26	30.2
WP_109353903.1\|89000_89854_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.4e-23	45.0

DBSCAN-SWA_2

189641 : 197595

Paenibacillus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109353903.1\|189641_190495_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.4e-23	45.0
WP_003114107.1\|190828_191743_+	GDP-6-deoxy-D-mannose reductase	A0A1C9C5B8	Heterosigma_akashiwo_virus	1.3e-15	30.0
WP_003096890.1\|191739_192711_+	GDP-mannose 4,6-dehydratase	E5EQW4	Bathycoccus_sp._RCC1105_virus	1.5e-91	53.2
WP_015649863.1\|192714_194154_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	6.5e-51	30.6
WP_003096887.1\|194153_194951_+	ABC transporter permease	NA	NA	NA	NA
WP_003102571.1\|194950_196216_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-15	26.8
WP_003096882.1\|196212_197595_+	glycosyltransferase family 4 protein	Q684B1	Sulfolobus_virus	6.8e-05	37.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

17. NZ_NFFP01000032

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_NFFP01000032_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_NFFP01000032_1

54246-54445

Orphan

Consensus_repeat	Method
CTCCCCATAAACGTTCACCTT	PILER-CR

2 spacers

The CRISPR arrays of NZ_NFFP01000032_1

>merge|NZ_NFFP01000032|1|54246-54445|PILER-CR
CTCCCCATAAACGTTCACCTTTCCCCCGATCCTGGTGCTCGACCAGTAGCCTTCAAATGGCCCCATATGCTTTCACCTTTGCTCAGGAGGCCCCATAAACGTTCACTTCACGCTCCCCACATCCATTCACCTTTCGCCCCACATCCATTCACCTCTCACCCCATAGCCTTTCACCATTGCTCCCCATAAACTTTCACCTT

>NZ_NFFP01000032|1|1|54246-54445|PILER-CR
CTCCCCATAAACGTTCACCTTTCCCCCGATCCT	GGTGCTCGACCAGTAGCCTTCAAATGGCCCCATATGCTTTCACCTTTGCTCAGGA
GGCCCCATAAACGTTCACTTCACGCTCCCCACA	TCCATTCACCTTTCGCCCCACATCCATTCACCTCTCACCCCATAGCCTTTCACCATTGCTCCCCATAAACTT
TCACCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_NFFP01000032.1\|WP_009684343.1\|45996_46266_-\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_009684351.1\|52256_52910_-\|DotI/IcmL/TraM-family-protein	unknown	unknown	gnl\|CDD\|319861
NZ_NFFP01000032.1\|WP_009684344.1\|46258_47491_-\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_023118095.1\|59286_60210_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|272946
NZ_NFFP01000032.1\|WP_009684347.1\|48628_49162_-\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_031642866.1\|48218_48542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_009684360.1\|60264_60792_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274177
NZ_NFFP01000032.1\|WP_131201116.1\|61448_61643_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_110676726.1\|61690_61990_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_009684362.1\|61094_61436_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_009684356.1\|57590_58715_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NZ_NFFP01000032.1\|WP_171021351.1\|50101_51316_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319757
NZ_NFFP01000032.1\|WP_009684350.1\|51339_52260_-\|type-IV-secretion-system-protein-IcmK	unknown	unknown	gnl\|CDD\|372018
NZ_NFFP01000032.1\|WP_009684348.1\|49172_50102_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NZ_NFFP01000032.1\|WP_009684355.1\|56544_57594_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_NFFP01000032.1\|WP_009684361.1\|60851_61085_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_110676711.1\|58993_59287_+\|hypothetical-protein	unknown	unknown	unknown
NZ_NFFP01000032.1\|WP_009684354.1\|54841_56161_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_NFFP01000032.1\|WP_009684345.1\|47490_48204_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|238038
NZ_NFFP01000032.1\|WP_009684352.1\|53043_53562_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_NFFP01000032.1\|WP_009684351.1\|52256_52910_-\|DotI/IcmL/TraM-family-protein	gnl\|CDD\|319861	cd16385, IcmL, inner membrane protein IcmL/DotI. This family contains the periplasmic domain of the inner membrane protein DotI of the Dot/Icm (defect in organelle trafficking/intracellular multiplication) type IVB secretion system, including its ortholog in the conjugation system of plasmid R64, TraM, and similar proteins. These domains share striking structural similarity to the type IV secretion system (T4ASS) component VirB8 suggesting DotI/TraM to be its functional counterpart. DotI is essential for intracellular growth of Legionella pneumophila (causing agent of Legionnaires' disease) within mammalian and protozoan cells; it translocates numerous effector proteins into its eukaryotic host.	4.09562e-48
NZ_NFFP01000032.1\|WP_009684356.1\|57590_58715_-\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.82947e-34
NZ_NFFP01000032.1\|WP_171021351.1\|50101_51316_-\|hypothetical-protein	gnl\|CDD\|319757	cd16431, IcmE, DotG/IcmE is a homolog of VirB10 which forms part of core complex in Type IV secretion system. This family contains DotG/IcmE (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. The Dot/Icm system is a T4SS found in the pathogens Legionella and Coxiella and the conjugative apparatus of IncI plasmids; T4SS is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. Similar to T4SS VirB/D components, the Legionella Dot/Icm secretion apparatus contains a critical five-protein sub-assembly that forms the membrane-spanning 'core-complex' (CC), around which all other components assemble. This transmembrane connection is mediated by protein dimer pairs consisting of two inner membrane proteins, DotF and DotG, each independently associating with DotH/DotC/DotD in the outer membrane.	1.39173e-55
NZ_NFFP01000032.1\|WP_009684350.1\|51339_52260_-\|type-IV-secretion-system-protein-IcmK	gnl\|CDD\|372018	pfam12293, T4BSS_DotH_IcmK, Putative outer membrane core complex of type IVb secretion. T4BSS_DotH_IcmK is a family of bacterial transporter proteins from Proteobacteria. DotH is an integral outer membrane component and it may form an outer membrane complex along with DotD and DotC functionally equivalent to secretins. DotH is the strongest candidate for the VirB9 counterpart of other T4BSS systems.	2.39508e-55
NZ_NFFP01000032.1\|WP_009684348.1\|49172_50102_-\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	3.20212e-05
NZ_NFFP01000032.1\|WP_009684355.1\|56544_57594_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	5.81979e-36
NZ_NFFP01000032.1\|WP_023118095.1\|59286_60210_+\|hypothetical-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	0.00462295
NZ_NFFP01000032.1\|WP_009684354.1\|54841_56161_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.9665e-28
NZ_NFFP01000032.1\|WP_009684345.1\|47490_48204_-\|HNH-endonuclease	gnl\|CDD\|238038	cd00085, HNHc, HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.	0.00285853
NZ_NFFP01000032.1\|WP_009684360.1\|60264_60792_+\|hypothetical-protein	gnl\|CDD\|274177	TIGR02520, putative_Type_IV_pilus_protein, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking].	0.00719338

>NZ_NFFP01000032.1|WP_009684352.1|53043_53562_-|hypothetical-protein
MSSTYAENEVFSFCGHLEGELGGELKSGYAVAQSAEEAIRSMRECGFYISAITSLAEVKQTVSILELIAHRHPDIEPTDYVDVYPAEIQPYPESNVFCFTGHVVDAFGALKAGFIVASDVDFVVTYLKGLGFVVESATSLEQLRQAMADMMAIADDDASFDHSCVVNFKSAA
>NZ_NFFP01000032.1|WP_009684351.1|52256_52910_-|DotI/IcmL/TraM-family-protein
MSGTSPRDDEHCLDLSRLQFYKKYFGKLLNALIFSIVLNFVTGGAFVWVKTRDVEREYFGQDSVTGRLTQMVPLSEPFVSPQKLLDWTVECVAGANSYDFVHSQKQLQRNSQCFTPDGWSMFMEALDRSGNLDLVKKQRLVTSAVPLAAPVVTNQGMRRGVWTWQIEVPFIVSFQGGQGGRTVATQKTLVTLLVTRVNPFESRDGLGIAQYLGGDLR
>NZ_NFFP01000032.1|WP_009684350.1|51339_52260_-|type-IV-secretion-system-protein-IcmK
MSRLVKVSAGLIWFVLSAGPAHADTAESVPGQNPATAGEMAIPALPPLPDINDAAYQQAVEQAAPLTPSQIRNLRQQVDDTERAAAALPRFFPKIVTNSVTVSLSPGATPQVVRLFSGFVTTLMVVDQAGNPLIVKTVDIGGGDKDFTVTWEKDAEKSGSNYVKISPKSPYAFGNVSITLVDVSVPISLTLVSGQREVDDRVDVRVQGIGNIATAALPKGVAPAILTMLSGFGPDGAKLLTSSNTEVMAWEYKDKFFVRTNYALLSPAYLSMQRSPDGIAVYEIPRTPVVVALSNGAPLNVSLSGY
>NZ_NFFP01000032.1|WP_171021351.1|50101_51316_-|hypothetical-protein
MDNLKVALSDGPTRLIYGGSFLIMLIAAGAGYWLFTSNKKTNADPSYVNSYQGLQGPAVMSGGGPMPQSTPQYDAYIAQENSDNVRAAVQSGSSAVPTVRTGVTETVIEDAAPPKKKAPEEDPEAVRRRNEEREKQLADAQKRYDEARRANDEAIKARKEAMSQQVGLLVKNWEPSSHKTLDIYSTATANTASGVGGKGQVGAASNVQQTPALKLARAGDLQCGQVDTAVNTDEPGPVLATIWQEGELKRTKLLGKIETGQNAQKATLHFTTANIPGVNGSVQVDAYAVDPNTARTALATDVDNHLVQRYGLFLAATFLEGYGTAIMQAGQNQQLVASPSGTVVQTDALDNTQILSAAAGNVGKRVADSLADGVNRKPTITIDSGTAVCFLFMNDVEIKGEGNK
>NZ_NFFP01000032.1|WP_009684348.1|49172_50102_-|hypothetical-protein
MSIDQEDILGQQNEFDEDDAPPADKKKSNKNGQLMTYGMYVVAALVVGLALFKIFGPRFFHSNDQGYGTAPITIDQPSGQGAGQYGYQGQGYQPQPNPPSPVPEPVGQYQQAQNYVADPQVQAALPVSESPAPPVMQQPVAPVGQAAQIQPHVTMEPQAATAAPVPTSGQEMASIAQVQKQLEQQDIQLKAIQETLDEIKKSLPKTAAKPAPKPSSASKSSTSQAASQKKPQPQPQRQVQKSQAGSGQQKNSPASMSLKAVLEGRAWFVTKGGESISVSVGDTIPGVGSVQRIDPDQGQVIMSNGVVYR
>NZ_NFFP01000032.1|WP_009684347.1|48628_49162_-|hypothetical-protein
MIDASTMLASFAQQFPGLEDLLNAVVALLGLVLTGNAVFKAIQVDKTGGQGMTWTTPIMYFFCGVALFNFAASIDTALDSFWGGSVSVKNLMSYQGSANMPAQTSELIGVIVLCLRFYGYITYARGWMSMRRIGSGQNGSDEVFKKSFIRLVAGVALINIVGTVNMFSETFGFGEVL
>NZ_NFFP01000032.1|WP_031642866.1|48218_48542_-|hypothetical-protein
MAMLAFTELAHGEGVGAIGRRAATEADGLGVGAQALFALGGLIMVGLSIFEIKKYNKTDGAQGKISMAAILLFGGAFLLYIASGIETGSDTIWGEGGGDKSRVQIQR
>NZ_NFFP01000032.1|WP_009684345.1|47490_48204_-|HNH-endonuclease
MIELSVVRDIRKAPLIQHGSRLDKSAGELRKQVIAQGRFGRRCHFCDFAFGTTDSFDIHNLDGDHTNNELENLVPVCELCHAPFHLDTVSKKWPSDPGKIVFLPELTQVQLNNLLQVIFYCMAMQSVAAGPEKVASTAEQGINPHTVYRRITDRAHQVEMNSKGETVRKGLSDPLVCSRVLLDMSDDEYEQRSVLLGGCRYVPGADYFIQQAGMWSGNGASFSRLDLAAWPGVAGVA
>NZ_NFFP01000032.1|WP_009684344.1|46258_47491_-|hypothetical-protein
MGVVRHGCVRFDADDPNMGGWASVEGMEAFRISSVGNLDNDTLWWTNLSFSAIYGANLHKTPYIKRTTYLNSWLQEGQADICSAWGLMRRSYTEKQITEILSGVFSRVMWYAKGAYGIDGSRSVPMHDNLADEIRCKILPDKDPHIAPEVDGALSAAHQYYTYCLTPHYNREEMVVVRFSAPAVAYAREMLSMIVPGEQVEYFSAEQIAPISDKVQWVVNNPRPVLAKVSVSNINPDYVNVIAFANGAKAGSNRSWVSQPELLLLSQYAQVEVACAFVFSGYEMLETSCELPMFSALQAMSPGAELLAMNHWVGLSRENCYRLEPKSTEYRAVSPRAAWITAVDRFLMFTYALQLHKAGFAIRKYGAGSVTCLVPKHNFKDAYDIASSIGLLAPPNMSSDIEVQEDLHNV
>NZ_NFFP01000032.1|WP_009684343.1|45996_46266_-|hypothetical-protein
MSDINTLLEVALRDSRNLEVIIALDRLLLLPENDAALHAAMKDLETVKSFINTKLPSHLKEFARGLFVQHGRLVAEHYKAKLETGETAR
>NZ_NFFP01000032.1|WP_009684354.1|54841_56161_+|replication-initiation-protein
MGMPAATPGQNVLAPSVRKHAGAIHIKNDISCLQRKAWNVLLHNAYDDFPDVNLQLHTIPVRDLMDLAGFDSKNVKYLKDALEDMVTTKIKWDIIDHQGKSDWGVTTALASASIKDGICSYAYSPQLRTKLYNPEFYARIDLLIISRFSSGHALALYENCARYRAINQTPILPLPLFRELLGVNNTASYDEFKILNRAVIQPAIKEINSISDICLEVELQREKRKVVGVKFRIQENVQGALAIDSPSSFNHELLRKLQDDFCLTETQAKEALALHSEDRISIVMEYVQEKYTEGKIKAGAKGIAPYFLRVLRDGDVKLAKTGLDKLLQGGAQASPKAAQAGQQSLLQDDDAVRREFNAQRRSEVELLLAGMDSEVRNSLNDQFAATLVGQRLMLKKWAEFLAKGEGSAMVVNNFYMFVAEKLLPPYEEALELYRKSLGA
>NZ_NFFP01000032.1|WP_009684355.1|56544_57594_-|ParB/RepB/Spo0J-family-partition-protein
MKSTRPLGTSQPTHIQGVPVAEAPAANLGRSMSDILAERGLLDDSQAQTSGVPAETFHGEKSTNFHGEKSVGPAAPLEGQYLPAKEGVTLLDTDMVDPSPYQPRKIFNEVALQLLADAIQANGGLNNPIVVRPKANGRFELVGGERRWRAHDILQWTKIEAYVRDLSDEDAAVLAVTDNESQEPLTDFERALSYKKLLDSKAVKNQMTLSRRVGRSMATISRCLAYFKLPQETLTLLEDDPAFIGTKHVADLAALADEGHKDLVVQATQLVFDGKLSQEAAVAWIKSSVRKSSDLPPAPPVPVKLFAKGRELADLKVRGQKITLDCPKGVNPEEVLELIKKHFDPPSEA
>NZ_NFFP01000032.1|WP_009684356.1|57590_58715_-|AAA-family-ATPase
MENNEFGIDQYPFTDFQQLFYSSKYAAECIQVSQDMLALIEKQHNLNIRRIPRGTVEARGYTLDDIFRIASIRRESGVIKPFPRPITLSVYVQKGGTAKTTTACNLAIQFSLMGLRTLVIDNDPQADVTSMLGYDPDLTAAELEDVGVPGARAVDGHIGNLMRVGSTYTPLSLEEVIKKPFGEFGPHLIPAEVTLDEMDIVLRNANGSDFRYSIFIEQARNGKLPHCDLSSYDVIIMDNAPSGTMLSRNSMVAADFLVCPIRMDKFSFRALSRLAFRLSEFAKDFQRSPEIIAIPTMYIRNRPRIQANLERLTTLFPGKVTQSPLYHNEDYSKSLEEGIPVSLWRQASDNSVGAFRTVFSEVVSRIRDVLEASK
>NZ_NFFP01000032.1|WP_110676711.1|58993_59287_+|hypothetical-protein
MHRGENGMTAEETNGALLRRLIEKAGMTQLEALELVNVGQAKPIAVSTWKAYLASRESKRWRDCPETILAHAKSRLSSDSRDSIATNQTTDTQGRGQ
>NZ_NFFP01000032.1|WP_023118095.1|59286_60210_+|hypothetical-protein
MAKQVEMPLDSFERDLVQGSTKKAMSGSKSRDLWQVDPRELKFMSGFNARTPRPGLEAHIRALADSMKSEGYYMDKPIAVYIAREGDQEVKYVSDGHCRTKAVLLAIQEGAEIETIPAVPEERGVSLEDLTVKLYRSNTGLPLTPYETGLVCKRLIRYGLELEVVADRMGLGTAYVDGLLMLVGGPKSIRDAVIDDRISATEAVKLLKTHGDKAVEVLEQMLAAAQAQGRNKATAKHAPGAAIKRVVKKHSDSLYQAAKTVRQDPGYTSLAVETRLLLDELLRTLDRAEKDLATEDSDAPEEERQQA
>NZ_NFFP01000032.1|WP_009684360.1|60264_60792_+|hypothetical-protein
MKRFLIVAVMFPMLATSALAESGSNIFLSGKVFKGDEVVASFAAPTLLGNTLPVKDQVLHSYIEKAVSDGKKTTLIPGKLVTGLDMSMTPTAVVGENVIVAVKGSLAVLEGFDKAPLAGTNLAIDLPKMSRNEFSQSFEIKKGQPLEFGFGGCTLVDGNPTNCSHKLILDASANN
>NZ_NFFP01000032.1|WP_009684361.1|60851_61085_+|hypothetical-protein
MANKRKTPAQLQSQCDAWNKLHGLGTLIAYEDIRGEGETHRGKSTTEAQVLGGHSAVIWLEGKSGCVSLDHCMALAS
>NZ_NFFP01000032.1|WP_009684362.1|61094_61436_+|hypothetical-protein
MMKNIVFSLALLGALTETGPAFAESKSLPDCAVTSAKSHGVELALFRALMIHELGETPLAAPCSFYEAAAANLATSLNSQHGDRWGAVSLFIHGRVLLDDPVVERVRTIYESK
>NZ_NFFP01000032.1|WP_131201116.1|61448_61643_+|hypothetical-protein
MTEKPQAIPDSTTEQEQCLGVFNAGHGVVTTPSSYDPALYERFKRIYSEGEPVIITGNMKVFRP
>NZ_NFFP01000032.1|WP_110676726.1|61690_61990_+|hypothetical-protein
MKFRTITGAIIGADPQAEAPTPVGLADPASERGVGQVEPAHLLRKQIERVIREYSADPAQAALAVCVILDENLGLAEDGCFDDDETVLNAILANEQADD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_NFFP01000032_1	1.1\|54279\|55\|NZ_NFFP01000032\|PILER-CR	54279-54333	55	MN961671	Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence	168120-168174	0	1.0
NZ_NFFP01000032_1	1.1\|54279\|55\|NZ_NFFP01000032\|PILER-CR	54279-54333	55	MN961672	Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence	116132-116186	0	1.0
NZ_NFFP01000032_1	1.1\|54279\|55\|NZ_NFFP01000032\|PILER-CR	54279-54333	55	NC_018746	Pseudomonas putida ND6 plasmid pND6-2, complete sequence	90700-90754	1	0.982
NZ_NFFP01000032_1	1.2\|54367\|72\|NZ_NFFP01000032\|PILER-CR	54367-54438	72	MN961671	Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence	168194-168265	12	0.833
NZ_NFFP01000032_1	1.2\|54367\|72\|NZ_NFFP01000032\|PILER-CR	54367-54438	72	MN961672	Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence	116206-116277	12	0.833

1. spacer 1.1|54279|55|NZ_NFFP01000032|PILER-CR matches to MN961671 (Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

ggtgctcgaccagtagccttcaaatggccccatatgctttcacctttgctcagga	CRISPR spacer
ggtgctcgaccagtagccttcaaatggccccatatgctttcacctttgctcagga	Protospacer
*******************************************************

2. spacer 1.1|54279|55|NZ_NFFP01000032|PILER-CR matches to MN961672 (Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence) position: , mismatch: 0, identity: 1.0

ggtgctcgaccagtagccttcaaatggccccatatgctttcacctttgctcagga	CRISPR spacer
ggtgctcgaccagtagccttcaaatggccccatatgctttcacctttgctcagga	Protospacer
*******************************************************

3. spacer 1.1|54279|55|NZ_NFFP01000032|PILER-CR matches to NC_018746 (Pseudomonas putida ND6 plasmid pND6-2, complete sequence) position: , mismatch: 1, identity: 0.982

ggtgctcgaccagtagccttcaaatggccccatatgctttcacctttgctcagga	CRISPR spacer
ggtgctcgaccggtagccttcaaatggccccatatgctttcacctttgctcagga	Protospacer
***********.*******************************************

4. spacer 1.2|54367|72|NZ_NFFP01000032|PILER-CR matches to MN961671 (Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence) position: , mismatch: 12, identity: 0.833

tcacgctccccacatccattcacctttcgccccacatccattcacctctcaccccatagc	CRISPR spacer
tcacgctccccacatccattcacctttcgccccacatccattcacctctcaccccatagc	Protospacer
************************************************************

5. spacer 1.2|54367|72|NZ_NFFP01000032|PILER-CR matches to MN961672 (Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence) position: , mismatch: 12, identity: 0.833

tcacgctccccacatccattcacctttcgccccacatccattcacctctcaccccatagc	CRISPR spacer
tcacgctccccacatccattcacctttcgccccacatccattcacctctcaccccatagc	Protospacer
************************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

18. NZ_NFFP01000040

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

36832 : 43726

uncultured_Caudovirales_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003090386.1\|36832_37501_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1
WP_003090387.1\|37611_38007_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
WP_012613994.1\|38003_38363_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	3.1e-34	61.7
WP_003090391.1\|38362_38668_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.5e-21	58.6
WP_003119979.1\|38664_39000_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.5e-38	69.4
WP_003097625.1\|38996_39980_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.5e-141	74.0
WP_003097628.1\|40067_41042_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_025297439.1\|41046_42444_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003097631.1\|42445_43726_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

19. NZ_NFFP01000097

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14 : 2349

Pseudomonas_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015649662.1\|14_485_+	hypothetical protein	A7Y8L4	Pseudomonas_virus	1.8e-82	100.0
WP_003094530.1\|484_901_+	structural protein	A0A0A1IX72	Pseudomonas_phage	4.6e-74	100.0
WP_033975743.1\|900_1143_+	hypothetical protein	A0A0U5KPK1	unidentified_phage	9.9e-37	98.8
WP_087937239.1\|1139_1541_+	hypothetical protein	A0A076FR25	Pseudomonas_phage	4.9e-65	98.5
WP_003094538.1\|1651_1840_+	hypothetical protein	A0A0A1IVG3	Pseudomonas_phage	1.0e-25	100.0
WP_033975739.1\|1848_2349_+	DUF1804 family protein	H6V8N3	Pseudomonas_phage	2.9e-83	99.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

20. NZ_NFFP01000025

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

74299 : 80324

Pseudomonas_phage(33.33%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034000943.1\|74299_75325_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	2.5e-153	80.0
WP_034000940.1\|75579_75852_+	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	3.1e-07	31.2
WP_012073902.1\|75862_76123_+	ogr/Delta-like zinc finger family protein	Q8HA63	Vibrio_phage	2.5e-06	33.3
WP_012073903.1\|76206_77538_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	7.1e-68	36.4
WP_012073904.1\|77534_77825_-	hypothetical protein	NA	NA	NA	NA
WP_012073905.1\|77821_79378_-	DUF3631 domain-containing protein	NA	NA	NA	NA
WP_012073906.1\|79377_79761_-	virulence-associated protein E	A0A2I6UG20	Salinibacter_virus	2.4e-08	42.1
WP_012073907.1\|79757_80324_-	hypothetical protein	Q775A9	Bordetella_phage	1.0e-07	57.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage