CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_FOGM01000023	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000008	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000020	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_FOGM01000003	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000033	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000006	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_FOGM01000004	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000012	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	cas3	0	1	0
NZ_FOGM01000032	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000007	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	cas3	0	0	0
NZ_FOGM01000017	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000022	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000002	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_FOGM01000010	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000025	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000021	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_FOGM01000030	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000024	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	0
NZ_FOGM01000014	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	DinG	0	1	0
NZ_FOGM01000019	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000018	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000016	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000001	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	1 crisprs	cas9,cas1,cas2,csn2	2	2	2
NZ_FOGM01000028	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000027	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	1	1
NZ_FOGM01000026	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000005	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	csa3,csm6	0	0	0
NZ_FOGM01000011	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0
NZ_FOGM01000029	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000031	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000009	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000013	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	NA	0	0	0
NZ_FOGM01000015	Streptococcus gallolyticus strain VTM2R47, whole genome shotgun sequence	0 crisprs	DEDDh	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 19187

Streptococcus_phage(83.33%)

protease,terminase,tail,portal,capsid,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074628277.1\|0_2192_-\|tail	phage tail protein	A0A286QMY8	Streptococcus_phage	1.2e-202	46.0
WP_141768281.1\|2191_3754_-\|tail	phage tail family protein	A0A286QT64	Streptococcus_phage	7.5e-170	54.8
WP_074628278.1\|3759_8352_-	tape measure protein	A0A286QPN7	Streptococcus_phage	7.6e-311	56.3
WP_074581035.1\|8563_8926_-\|tail	phage tail protein	F8HGT7	Streptococcus_phage	1.2e-33	65.5
WP_074581036.1\|8984_9596_-\|tail	phage tail protein	A0A286QNH0	Streptococcus_phage	4.4e-81	74.5
WP_074581037.1\|9600_9981_-	DUF806 family protein	A0A286QNX0	Streptococcus_phage	2.4e-45	71.5
WP_074581038.1\|9980_10403_-	HK97 gp10 family phage protein	A0A286QS23	Streptococcus_phage	1.5e-51	72.9
WP_074581039.1\|10402_10756_-\|head	phage head closure protein	O64288	Streptococcus_virus	5.8e-38	67.0
WP_074581040.1\|10748_11066_-\|head,tail	phage head-tail connector protein	A0A286QNI5	Streptococcus_phage	3.0e-33	70.5
WP_074628279.1\|11078_12311_-\|capsid	phage major capsid protein	A0A2I6QQY9	Streptococcus_phage	1.4e-91	46.5
WP_074581042.1\|12324_13047_-\|protease	Clp protease ClpP	A0A2P0VGN2	Streptococcus_phage	1.5e-72	61.2
WP_074581043.1\|13033_14206_-\|portal	phage portal protein	Q9MCK6	Streptococcus_virus	6.9e-160	72.8
WP_176760975.1\|14236_14392_-	hypothetical protein	NA	NA	NA	NA
WP_074581044.1\|14391_14577_-	DUF1056 family protein	A0A2I6QQZ6	Streptococcus_phage	7.3e-16	68.9
WP_074628280.1\|14592_16470_-\|terminase	terminase large subunit	Q9MCK8	Streptococcus_virus	0.0e+00	86.1
WP_074628281.1\|16483_16942_-\|terminase	phage terminase small subunit P27 family	A0A2I6QR01	Streptococcus_phage	1.4e-71	87.5
WP_074628282.1\|17121_17640_-	HNH endonuclease	A0A1S5PRT8	Streptococcus_phage	9.1e-64	68.5
WP_074628286.1\|17877_18282_-	DUF1492 domain-containing protein	A0A2I6QQS5	Streptococcus_phage	4.8e-36	57.9
WP_074628284.1\|18860_19187_-	hypothetical protein	A0A1S5SCI4	Streptococcus_phage	3.1e-17	43.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_FOGM01000020

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14423 : 28604

Streptococcus_phage(77.78%)

integrase

attL 11407:11422|attR 22051:22066

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
11407:11422	attL	NA	NA	NA	NA
WP_074628201.1\|14423_15152_+	response regulator transcription factor	A0A2H4J4Z6	uncultured_Caudovirales_phage	1.6e-13	26.3
WP_074628202.1\|15164_16529_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_074628203.1\|17459_18620_-\|integrase	site-specific integrase	A0A141E0Q7	Streptococcus_phage	1.2e-82	43.0
WP_074628204.1\|18809_19328_-	hypothetical protein	F8HGP5	Streptococcus_phage	1.9e-08	55.2
WP_074628205.1\|19350_19782_-	hypothetical protein	NA	NA	NA	NA
WP_074581049.1\|19801_20188_-	ImmA/IrrE family metallo-endopeptidase	F8HGP6	Streptococcus_phage	1.5e-26	45.7
WP_081350185.1\|20174_20582_-	helix-turn-helix domain-containing protein	O34035	Streptococcus_phage	3.7e-60	90.3
WP_074628207.1\|20730_20970_+	DUF739 family protein	O34036	Streptococcus_phage	1.0e-33	92.4
WP_074628208.1\|20982_21702_+	phage antirepressor KilAC domain-containing protein	A0A1S5SDI0	Streptococcus_phage	1.1e-99	75.0
WP_074628209.1\|21815_22067_+	helix-turn-helix domain-containing protein	A3F618	Streptococcus_phage	5.4e-22	61.2
22051:22066	attR	NA	NA	NA	NA
WP_074628210.1\|22103_22490_+	hypothetical protein	NA	NA	NA	NA
WP_074628211.1\|22512_22704_+	hypothetical protein	NA	NA	NA	NA
WP_141768277.1\|22830_23010_+	hypothetical protein	NA	NA	NA	NA
WP_177159406.1\|23106_23358_+	transcriptional regulator	A0A1S5SFN6	Streptococcus_phage	1.1e-11	45.1
WP_074628214.1\|23522_23846_+	DnaD domain protein	Q938N2	Temperate_phage	7.5e-16	47.4
WP_074628215.1\|23867_24650_+	ATP-binding protein	A0A286QR66	Streptococcus_phage	1.8e-63	52.4
WP_074628216.1\|24640_24856_+	hypothetical protein	NA	NA	NA	NA
WP_074628217.1\|24852_25179_+	hypothetical protein	A0A1P8VVU1	Streptococcus_phage	1.2e-26	60.2
WP_074596893.1\|25461_25713_+	hypothetical protein	A0A097PAR6	Streptococcus_pyogenes_phage	6.2e-10	42.2
WP_074628218.1\|25719_25908_+	hypothetical protein	Q708Q3	Streptococcus_phage	1.4e-06	58.7
WP_074628219.1\|25907_26657_+	phage recombination protein Bet	A0A060QNU4	Streptococcus_phage	6.9e-97	73.6
WP_074628220.1\|26670_27669_+	DUF1351 domain-containing protein	A0A060QNS1	Streptococcus_phage	3.9e-119	69.3
WP_074628221.1\|27810_28146_+	hypothetical protein	M1PKX3	Streptococcus_phage	2.9e-18	45.5
WP_074628222.1\|28142_28604_+	RusA family crossover junction endodeoxyribonuclease	A0A191KBK7	Streptococcus_virus	1.1e-65	73.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_FOGM01000006

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

170 : 17405

Streptococcus_phage(76.19%)

integrase

attL 4484:4497|attR 18044:18057

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074627549.1\|170_611_-	DUF1492 domain-containing protein	A0A0B5A564	Streptococcus_phage	9.2e-33	50.0
WP_074627550.1\|1046_1469_-	hypothetical protein	A0A141E0J5	Streptococcus_phage	1.5e-16	41.0
WP_074627551.1\|1465_1978_-	DUF1642 domain-containing protein	A0A1X9I5P8	Streptococcus_phage	5.9e-23	45.2
WP_074627552.1\|1974_2391_-	hypothetical protein	A0A1V0SJQ1	Klosneuvirus	3.7e-15	40.3
WP_074627616.1\|2693_4016_-	helicase	A0A1S5SB13	Streptococcus_phage	6.1e-213	83.1
WP_074627553.1\|4018_4837_-	bifunctional DNA primase/polymerase	B3GVY7	Streptococcus_phage	1.4e-122	78.0
4484:4497	attL	NA	NA	NA	NA
WP_074627554.1\|4861_5389_-	hypothetical protein	X2L082	Streptococcus_phage	2.3e-62	68.0
WP_074627555.1\|5408_6179_-	AAA family ATPase	B3GVY5	Streptococcus_phage	1.6e-112	78.8
WP_074627556.1\|6181_7375_-	DEAD/DEAH box helicase family protein	A0A126GGP4	Streptococcus_phage	6.3e-177	76.3
WP_074627557.1\|7352_7823_-	hypothetical protein	A0A141E0U8	Streptococcus_phage	2.0e-65	76.1
WP_074627558.1\|7824_8187_-	hypothetical protein	M1PRM6	Streptococcus_phage	2.1e-27	50.8
WP_074627559.1\|8320_8803_-	siphovirus Gp157 family protein	A0A1S5SAH2	Streptococcus_phage	1.7e-43	58.8
WP_074627560.1\|8804_9023_-	hypothetical protein	NA	NA	NA	NA
WP_177159395.1\|9024_9180_-	hypothetical protein	NA	NA	NA	NA
WP_074627561.1\|9176_9488_-	excisionase	A0A1S5SA25	Streptococcus_phage	3.3e-37	73.5
WP_074627562.1\|9792_10005_-	helix-turn-helix transcriptional regulator	A0A1S5SCR6	Streptococcus_phage	3.8e-16	55.9
WP_074627563.1\|10302_10683_+	helix-turn-helix transcriptional regulator	A0A0A0YV45	Streptococcus_phage	2.2e-27	52.4
WP_141768254.1\|10692_11454_+	ImmA/IrrE family metallo-endopeptidase	A0A0A0YSF3	Streptococcus_phage	7.2e-41	40.2
WP_074627565.1\|11509_12061_+	zinc-binding protein	A0A141DZS3	Streptococcus_phage	3.7e-71	78.3
WP_074627566.1\|12080_12200_+	colicin immunity protein	NA	NA	NA	NA
WP_074627567.1\|12265_12502_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_074627568.1\|12501_13239_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_074627569.1\|13497_14637_+\|integrase	site-specific integrase	A0A2H4JG38	uncultured_Caudovirales_phage	1.1e-112	52.5
WP_074627570.1\|14720_15770_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	9.2e-71	44.2
WP_009853945.1\|15942_16536_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	2.3e-10	32.3
WP_009853944.1\|16535_17405_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	7.5e-103	64.9
18044:18057	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_FOGM01000002

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

53687 : 63683

Streptococcus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074627133.1\|53687_54779_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.6e-174	81.8
WP_074627134.1\|54914_55544_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003066000.1\|55651_55993_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_074627135.1\|56049_57285_-	ammonium transporter	NA	NA	NA	NA
WP_013643330.1\|57684_58551_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-114	71.9
WP_003066006.1\|58557_58878_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	1.5e-29	61.3
WP_074595989.1\|58870_59671_-	signal peptidase II	NA	NA	NA	NA
WP_074627136.1\|59667_60543_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.9e-75	50.7
WP_074627137.1\|60553_61189_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-70	66.2
WP_039694390.1\|61375_62035_-	CBS domain-containing protein	M1NSC5	Streptococcus_phage	3.3e-74	65.1
WP_009854757.1\|62208_62919_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-13	26.0
WP_074595986.1\|62918_63683_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.2e-17	25.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_FOGM01000001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_FOGM01000001_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_FOGM01000001_1

33919-34086

TypeII

Consensus_repeat	Method
GTTTTTGTACTCTCAAGATTTAAGTAACCGTAAAAC	PILER-CR

2 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_FOGM01000001_1

>merge|NZ_FOGM01000001|1|33919-34086|PILER-CR
NNNNNNNNACTCTCAAGATTTAAGTAACCGTAAAACAGATGCCAATAACCACATTGTCGACGCAGTGTTTTTGTACTCTCAAGATTTAAGTAACCGTAAAACTTATCTGAAATTGTAGCAGGTGAGAAATACGTTTTTGTACTCTCAAGATTTAAGTAACCGTAAAAC

>NZ_FOGM01000001|1|1|33919-34086|PILER-CR
NNNNNNNNACTCTCAAGATTTAAGTAACCGTAAAAC	AGATGCCAATAACCACATTGTCGACGCAGT
GTTTTTGTACTCTCAAGATTTAAGTAACCGTAAAAC	TTATCTGAAATTGTAGCAGGTGAGAAATAC
GTTTTTGTACTCTCAAGATTTAAGTAACCGTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_FOGM01000001.1\|WP_074626945.1\|32130_33180_+\|CRISPR-associated-protein-Cas7	csn2	cd12217_csn2_CAS-II-A	gnl\|CDD\|213410
NZ_FOGM01000001.1\|WP_074626947.1\|36299_37583_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_FOGM01000001.1\|WP_074627087.1\|23941_25189_+\|DUF3440-domain-containing-protein	unknown	unknown	gnl\|CDD\|226478
NZ_FOGM01000001.1\|WP_074626948.1\|37575_38052_+\|shikimate-kinase	unknown	unknown	gnl\|CDD\|234654
NZ_FOGM01000001.1\|WP_074626953.1\|45336_45780_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378913
NZ_FOGM01000001.1\|WP_141768243.1\|22746_23916_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|350180
NZ_FOGM01000001.1\|WP_014294906.1\|31810_32134_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NZ_FOGM01000001.1\|WP_074626949.1\|38048_38873_+\|prephenate-dehydratase	unknown	unknown	gnl\|CDD\|237013
NZ_FOGM01000001.1\|WP_012962168.1\|30897_31809_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NZ_FOGM01000001.1\|WP_074626941.1\|25172_25688_+\|ParB-like-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|319255
NZ_FOGM01000001.1\|WP_074626950.1\|38959_40402_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_FOGM01000001.1\|WP_074626946.1\|34246_36082_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_FOGM01000001.1\|WP_039692288.1\|26813_27230_+\|nucleoside-diphosphate-kinase	unknown	unknown	gnl\|CDD\|179085
NZ_FOGM01000001.1\|WP_074626944.1\|27335_30725_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|273840
NZ_FOGM01000001.1\|WP_074626943.1\|25933_26236_+\|hypothetical-protein	unknown	unknown	unknown
NZ_FOGM01000001.1\|WP_141768240.1\|42681_42927_+\|hypothetical-protein	unknown	unknown	unknown
NZ_FOGM01000001.1\|WP_074626942.1\|25708_25888_+\|hypothetical-protein	unknown	unknown	unknown
NZ_FOGM01000001.1\|WP_074626951.1\|40511_41873_+\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	unknown	unknown	gnl\|CDD\|225174
NZ_FOGM01000001.1\|WP_012962151.1\|44727_45192_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|238612
NZ_FOGM01000001.1\|WP_061459721.1\|43649_44255_+\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224

Protein	Function_ID	Function_description	E-value
NZ_FOGM01000001.1\|WP_074626945.1\|32130_33180_+\|CRISPR-associated-protein-Cas7	gnl\|CDD\|213410	cd12217, Stu0660_Csn2, Stu0660-like CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. This family of Csn2 proteins includes Stu0660, the proteins are larger than other (canonical) Csn2 proteins as they have an additional alpha-helical C-terminal domain. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	3.95011e-150
NZ_FOGM01000001.1\|WP_074627087.1\|23941_25189_+\|DUF3440-domain-containing-protein	gnl\|CDD\|226478	COG3969, COG3969, Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only].	2.07906e-151
NZ_FOGM01000001.1\|WP_074626953.1\|45336_45780_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378913	pfam12674, Zn_ribbon_2, Putative zinc ribbon domain. This domain appears to be a zinc binding DNA-binding domain.	7.56297e-24
NZ_FOGM01000001.1\|WP_074626944.1\|27335_30725_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|273840	TIGR01865, conserved_hypothetical_protein, CRISPR subtype II/NMENI RNA-guided endonuclease Cas9/Csn1. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas locus. The species range so far for this protein is animal pathogens and commensals only.	0
NZ_FOGM01000001.1\|WP_014294906.1\|31810_32134_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.09621e-29
NZ_FOGM01000001.1\|WP_074626949.1\|38048_38873_+\|prephenate-dehydratase	gnl\|CDD\|237013	PRK11898, PRK11898, prephenate dehydratase; Provisional.	7.14801e-152
NZ_FOGM01000001.1\|WP_012962168.1\|30897_31809_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	7.18224e-124
NZ_FOGM01000001.1\|WP_074626941.1\|25172_25688_+\|ParB-like-nuclease-domain-containing-protein	gnl\|CDD\|319255	cd16397, IbrB_like, immunoglobulin-binding regulator IbrB activates eib genes. IbrB (along with IbrA) activates immunoglobulin-binding eib genes in Escherichia coli. IbrB is related to the ParB N-terminal domain family, which includes DNA-binding proteins involved in chromosomal/plasmid segregation and transcriptional regulation, consistent with a possible mechanism for IbrB in DNA binding-related regulation of eib expression. The ParB like family is a diverse domain superfamily with structural and sequence similarity to ParB of bacterial chromosomes/plasmid parABS partitioning system and Sulfiredoxin (Srx), which is a reactivator of oxidatively inactivated 2-cys peroxiredoxins. Other families includes proteins related to StrR, a putative regulator in the biosynthetic gene cluster and a family containing a Pyrococcus furiosus nuclease and putative transcriptional regulators SbnI (Staphylococcus aureus siderophore biosynthetic gene cluster ) and EdeB (Brevibacillus brevis antimicrobial peptide edeine biosynthetic cluster). Nuclease activity has also been reported in arabidopsis Srx.	1.69587e-59
NZ_FOGM01000001.1\|WP_141768243.1\|22746_23916_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|350180	cd18793, SF2_C_SNF, C-terminal helicase domain of the SNF family helicases. The Sucrose Non-Fermenting (SNF) family includes chromatin-remodeling factors, such as CHD proteins and SMARCA proteins, recombination proteins Rad54, and many others. They are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.	1.38724e-14
NZ_FOGM01000001.1\|WP_074626946.1\|34246_36082_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_FOGM01000001.1\|WP_039692288.1\|26813_27230_+\|nucleoside-diphosphate-kinase	gnl\|CDD\|179085	PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated.	8.61327e-79
NZ_FOGM01000001.1\|WP_074626947.1\|36299_37583_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_FOGM01000001.1\|WP_074626950.1\|38959_40402_+\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	7.79038e-55
NZ_FOGM01000001.1\|WP_074626948.1\|37575_38052_+\|shikimate-kinase	gnl\|CDD\|234654	PRK00131, aroK, shikimate kinase; Reviewed.	2.52667e-59
NZ_FOGM01000001.1\|WP_074626951.1\|40511_41873_+\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	4.05543e-180
NZ_FOGM01000001.1\|WP_012962151.1\|44727_45192_+\|nucleoside-deaminase	gnl\|CDD\|238612	cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protein synthesis. Other members of the family are guanine deaminases which deaminate guanine to xanthine as part of the utilization of guanine as a nitrogen source.	4.77351e-46
NZ_FOGM01000001.1\|WP_061459721.1\|43649_44255_+\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	1.45633e-17

>NZ_FOGM01000001.1|WP_074626945.1|32130_33180_+|CRISPR-associated-protein-Cas7
MRLHFTHPYKDNLDINFGQFTQIIGQNQQLKYYMWQIFMWYFDGKKYSEEDLSLFNQEEPEILCEGKSLKRNSFSVISISDIQDLLEQMSYKRGTVACDFLKLHLNTVDVMTEVDEINDKLDKISLTVNHNLDLSIKDVTYHTESCVVTSEQLLSKYFQPYFNYQGRNISFEFVDNETKVMFLLKMLQERLSNDTNNILLIFKNMDDYLDYSSFITICKTITQMTEKFPNFYCTIFPSNESYLYVTKETIEHVTIVSDFIESLFDLDFMYERFIGRYPSNNIPSKSEFLILLQKNASYLFSDQISYISLGISDMVAIKILNSLYQYDKSVVYPIPKIDPLEISFLKDKD
>NZ_FOGM01000001.1|WP_014294906.1|31810_32134_+|CRISPR-associated-endonuclease-Cas2
MRYAAMRLLCFFDLPMETAQEKRVYRNFRKELIANGFEMLQFSVYYRTCPNRSFANKFYKRLQQSNLPAGNVRLLAVTEKQFSEMTLIVGGKTKQEEVVSDNKLVVI
>NZ_FOGM01000001.1|WP_012962168.1|30897_31809_+|type-II-CRISPR-associated-endonuclease-Cas1
MTWRVVHVNQSEKMRLKLDNIVIKKLGEEYTIPLSDISIIVAEGGDTVVTLRLLSALSKYNIALIVCDNQHLPTGIYHAPNGHSRAYKRLQKQLEWSQEQKDKLWQIVTYFKINNQQDVLSIFERDIDAIQLLADYKDNIELGDKTNREGHAAKVYFNELFGKQFTRVTQQEADVINAGLNYGYAIFRAQMARIIEGYGLNPLVGIFHRNEYNQFNLVDDLMEPFRQIVDVWVYQNLRDKEYLKYEYRLNLTNLLNAKIKYGNENCTVTGAMDKYVQGFIKCIDKKDTSKFFCPVVSSLELES
>NZ_FOGM01000001.1|WP_074626944.1|27335_30725_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MTNGKILGLDIGIASVGVGIIEAKTGKVVHANSRLFSAANAENNAERRGFRGSRRLNRRKKHRVKRVRDLFEKYEIVTDFRNLNLNPYELRVKGLTEQLTNEELFAALRTISKRRGISYLDDAEDDSTGSTDYAKSIDENRRLLKTKTPGQIQLERLEKYGQLRGNFTVYDENGEAHRLINVFSTSDYEKEARKILETQADYNKKITAEFIDDYVEILTQKRKYYHGPGNEKSRTDYGRFRTDGTTLENIFGILIGKCSFYPDEYRASKASYTAQEYNFLNDLNNLKVPTETDKLSTEQKEALVEFAKSTATLGPAKLLKEIAKILDCKVDEIKGYREDDKGKPDLHTFEPYRKLKFNLDSVNIDDLSREVLDKLADILTLNTEREGIEDAIKRNLPNQFTEEQISEIINVRKSQSTAFNKGWHSFSAKLMNELIPELYATSDEQMTILTRLEKFKVNKKSSKNTKTIDEKEVTDEIYNPVVAKSVRQTIKIINAAVKKYGDFDKIVIEMPRDKNADDEKKFIDKRNKENKKEKDDALKRAAYLYNGTDKLPDEVFHGNKQLETKIRLWYQQGERCLYSGKPIPIQELVHNSNNFEIDHILPLSLSFDDSLANKVLVYAWTNQEKGQKTPYQVIDSMDAAWSFREMKDYVLNQKGLGKKKRDYLLTTENIDKIEVKKKFIERNLVDTRYASRVVLNSLQSALRELGKDTKISVIRGQFTSQLRRKWKIDKSRETYHHHAVDALIIAASSQLKLWEKQDNPMFVDYGNNQVVDKQTGEILSVSDDEYKELVFQPPYQGFVNTISSKGFEDEILFSYQVDSKYNRKVSDATIYSTRKAKIGKDKKEETYVLGKIKDIYSQNGFDTFIKKYNKDKTQFLMYQKDSLTWENVIEVILRDYPTTKKSEDGKNDIKCNPFEEYRRENGLICKYSKKGKGTPIKSLKYYDTILKNTSGLDITPEISNNKVILQSLNPWRTDVYFNPITLKYELAGIRYCDLQYLKGGNYGLIEDKYKEILKKEGVTEESEFKFTLYKNDLILIKDAETNEKILLRFLSRSDLSCKNKVELKPYNKEKFSSGEFLISVIGTTPVRCTKTLSYKNISIYKVRTDVLGNKYFVKKEGDKPKLDFKNNKK
>NZ_FOGM01000001.1|WP_039692288.1|26813_27230_+|nucleoside-diphosphate-kinase
MEKTFFMIKPDGVKRGLVGEVLHRIERRGFTIEKLEMRMATPELLEKHYVDLVDRPFFPLIVDFMTSGPVITGVMSGNEVITSWRTMMGATNPKEALPGTIRGDYAQAPDEGGATFNIVHGSDSPESVEREIALWFGE
>NZ_FOGM01000001.1|WP_074626943.1|25933_26236_+|hypothetical-protein
MKISVDSEKLLNEAINDFDIFGEDFNVYAIYSYREDYDFEYISDYVDADEPTRDEFETEEDYQEVMKDFKENLDSLKFTKHKKMTIADLVHELWEQNRIF
>NZ_FOGM01000001.1|WP_074626942.1|25708_25888_+|hypothetical-protein
MPKVSESKRKANDKWDKNNKERKQYINRRSVARNFIKNMEDEDVPEFKKLMKERASKTK
>NZ_FOGM01000001.1|WP_074626941.1|25172_25688_+|ParB-like-nuclease-domain-containing-protein
MENYSSPVYNIKKVPIEKIQANSYNPNHVATPEMKLLYESIKADGYTMPIVCYYLKDEDKYEIVDGFHRYTTMLNHKDIYERENGCLPVSVIDKPLEERMASTVRHNRARGSHDIGLMANIVAEMVDSGMSDTKVMKSLGMDADELLRLKQVSGLASLFADKEFSKSWDVE
>NZ_FOGM01000001.1|WP_074627087.1|23941_25189_+|DUF3440-domain-containing-protein
MERIKYIFDNFDHVYVSFSGGKDSGVMLNLVLKYLKDNQLKRKITLMHLDYEAQYEMTTEYVKLMEDKYKDYLNIYHVCVPFKVSTCTSMFQNYWRPWEEAKKDIWVRDLPKNAMTKDDFDFYDKNQWDYDFQEKLSVWSHKREKAEKTAVLVGIRTQESLHRWRTIAKERNSYYADKKYSKKIADNVYNFYPIYDWTTEDIWVANAKFAWDYNKLYDLYYQAGLPVETMRVASPFISEGQETLKLYKVIEPHTWGKLVSRVNGVNFTGLYGGTTAMGWKNITKPDNMTWKQYMEFLLDTLPENTRQNYLNKLETSIKFWKEKGGVLSDEVIKELDDLSIKYEIGTHNYKTTKKAVKLDYLDDLDIKEFKAIPTYKRMCICILKNDHTCKYMGFSPTKIEMQKRKEAIEKYGKLL
>NZ_FOGM01000001.1|WP_141768243.1|22746_23916_+|DEAD/DEAH-box-helicase
MKQGTGKTRVALELIKSTDCDFVLFLCPFSTKANLKSEIDKWGLERPFEIIGYETLSSSDRTYLKLLDLQKQYHKIFIVADESVFIKNSDSKRFERMLKLRDMSEYRLLLNGTPITKNEWDIYNQMEFLSPLIIKMNRPEFLQTFFKKIKYKRAGENPREFYKLSTVNIGYLHKLIEPYIFEADLEFDKNIHVKNIEILSSDETNELYEERKQNLLNSLAIGECKVEQFTNLAVACFDDKERHKAIAKQLKGQIIVFCSLLSEVKHISKEIDCYAITGATAPQERLKIINQFKEENKPLLMTYGTGAFGLNLQFCHRIAFASLTFDYAKVDQAMSRIKRLGQEKDIEYTYFTSNLGIYNMINENITKKQTLKELIIDKIEKGEDFEKNL
>NZ_FOGM01000001.1|WP_074626946.1|34246_36082_+|elongation-factor-4
MDIQELKKRQEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYTAKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEIEDVIGLDASEAVLTSAKAGIGIEEILEQIVEYVPAPAGDVEAPLQALIFDSVYDAYRGVILQVRIVNGMVKPGDKIQLMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTVTLAENPAEAPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTKVASIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDENRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRKSKLVKMDILLNGDKVDALSFIVHNEFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLSMDDDNSKK
>NZ_FOGM01000001.1|WP_074626947.1|36299_37583_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKLLTNVSQLKGTLRVPGDKSISHRSIMFGSLAKGTTTVHDILRGEDVLSTMQVFRDLGVDIQDDGNIVTITGVGFDGLKAPKNKLDMGNSGTSIRLISGVLAGQDFTVEMFGDDSLSKRPMDRVTIPLRQMGVEVSGQTDRDLPPLTMRGSKALKPIHYQLPVASAQVKSALIFAALQADGESVIIEKEKTRNHTEDMIVQFGGAIDVNDKEIRIKGGQEFTGQDVVVPGDISSAAFWLVAGLIVPNAKVILENVGINETRTGIIDVIKEMGGKMTISNVDEIAKSATITVETSELHGVEIGGEIIPRLIDELPIIALLATQANGTTIIRDAEELKVKETDRIQVVADALNAMGADITPTDDGMIIKGKTPLHGAKVNTFGDHRIGMMTAIAALLVSDGDVELERAEAINTSYPSFFNDLEVLSRG
>NZ_FOGM01000001.1|WP_074626948.1|37575_38052_+|shikimate-kinase
MARIIIGFMGSGKSTISSLLDENYIDMDALITERIGMSIADFFAKEGEAKFREIESQVLAELADSNQVISTGGGVVINPINREILAKNPETIYLKSDFETLYDRIEHDTENIRPLFVNNSKEAFKEIFDGRQEMYEAAANRIIDVAGKTPEEIVEEIG
>NZ_FOGM01000001.1|WP_074626949.1|38048_38873_+|prephenate-dehydratase
MKVGYLGPSGSFTHNVAVKAFPEANRMPFANITEVIKSYEEGFVDYAIIPVENSIEGSVHETLDYLFHQAEIEAIAEIIQPIKQQLLATTKTKKIEKIFSHPQAIAQGKKYIKAHYPAAKIEMTASTAYAARFIAEHPEENFAAIAPVAAAKEYGLEIIAKDIQEMDENYTRFWVLGHQKRSFDLAKLNQKVSLALTLPDNLPGALYKALSVFAWRGIDLTKIESRPLKTALGEYFFIVDVENKNDTLVSFALEELSVLGIDYKILGRYDVYKL
>NZ_FOGM01000001.1|WP_074626950.1|38959_40402_+|LCP-family-protein
MARSNLSRHEELRYEYLLSNLEYLSAREKQEFDYLYNKKQASEISEPPRSQPLSAYNDNYYDDYYDDAYDNQVDYYDDDNWTSQGLPKYPEEKKQPKRSFRRTSEQQAEILPTYQDNYENYDEAFYQELEPVTPKKAKKSKKKRRKIRIKRLLKLLGFLVILVMVGMIYMFFKGVNDVSSGETNYTAAVTETFNGEDSDDGTNILILGSDQRITQGSSDARTDTIMVMNIGNSDEKIKLVSFMRDTLVNIDGVSYNAYSNDQKLNVAFNIGEQDDNQGAELMRQTLKDNFDINIKYYVMVDFETFAEAIDTLFPNGVEIDAKFGTVDGQAVSSVEVPDDLNMQADGTVPNQTIEVGTQKMDGRTLLNYARFRKDDDGDYGRTQRQQQVISAIVNQIKDPSKLFTGSAAIGKIYALTSTNVSYPFLLKEGLSVITSGQNGIEQATIPAEGDWTDDYDMYGGLGIAIDFDKYQEELKELGLR
>NZ_FOGM01000001.1|WP_074626951.1|40511_41873_+|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD
MLSKNAIVDAEITDLSHEGAGVAKVDGFVFFVENALPGEKIKMRVLKVKKNIGFGKVEEYVTISEHRNQDLNVDYLRTGIADFGHLAYAEQLKFKRKQVMDNLYKTAGISDVEVAETLGMASPYAYRNKAQVPVRRVNGQLETGFFRKHSHDLMPISDYYIQNKEIDRLINFTRDLLRRFDLKPYDEKEQTGLIRNLVVRRGHYSGEMMLVFVTTRPKIFRIEQIIEKIVAEFPAVKSIVQNINDKNTNAIFGKEFKTLYGKATIVDSMLGNQYEISARSFYQVNTEMAEKLYQAAIDFSDLTADDIVIDAYSGIGTIGLSFAKNVKAVYGVEVIEEAVEDAKRNAALNGITNAHYVADSAEHAMATWSKNGIKPSVILVDPPRKGLTENFIKASVAMQPEKITYISCNPATMARDIKLYQELGYKLQKVQPVDLFPNTHHVETVVLMSRKDT
>NZ_FOGM01000001.1|WP_141768240.1|42681_42927_+|hypothetical-protein
MANWIRVLLIVAGSVIFAVGIGNAVKIEQTAGYYECPNCHNKYVPTYQSVFWAPHMGRTRYMKCPECGKRSWQKKVLTKEE
>NZ_FOGM01000001.1|WP_061459721.1|43649_44255_+|transglutaminase-family-protein
MNQAYLEATKYVDYDHPKIQQQARQLKKESSDEIDLVKNTFQFVRDKISHSWDVQDSRVTVSASDCLREGVGICWAKANLLAALLRANGIPSGFSYQRLILGSTPDTGYCIHALNTAYLDSLGKWLRLDARGNKKNVHAEFSLDEEKLAFYPNAEGEIDYHDNHANPDQGLMTVLEHSTDAIDMYLHHLPDSLSNDIKELK
>NZ_FOGM01000001.1|WP_012962151.1|44727_45192_+|nucleoside-deaminase
MLEDYMQKAIQEAYDGIKKGDGGPFGSVIVKNGEIVASGHNMVLAHHDPTAHGEVTAIRKAGEKLGTHDLSGTTLFTTGEPCPMCLAACLWANIDKVYYGCTIADNAMIGFRDQRFDELMGGRKNLPKDYLVQLNHDECLKLFKDYQEMTHNLY
>NZ_FOGM01000001.1|WP_074626953.1|45336_45780_+|helix-turn-helix-domain-containing-protein
MEIQEVLKNLCDKYQLTQEELAALVLVTRQAVSRWETGKTQPNTDTLKLLSKEFNVSINTLLGSPRQLICQCCGMPLTEDEVISRETDGNFNEDYCKWCYVDGAFAYTTKDSLLDYLVTNMPNPDNLSDEERRLQFDAYLSQLKYWK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_FOGM01000001_1	1.1\|33955\|30\|NZ_FOGM01000001\|PILER-CR	33955-33984	30	MK448704	Streptococcus phage Javan213, complete genome	17134-17163	2	0.933
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NZ_AP018256	Calothrix sp. NIES-4071 plasmid plasmid1 DNA, complete genome	264336-264365	5	0.833
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	MN103543	Pseudomonas phage vB_PaeM_PS119XW, complete genome	67232-67261	7	0.767
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	MK599315	Pseudomonas phage PA1C, complete genome	66911-66940	7	0.767
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NZ_CP013929	Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence	2815-2844	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	CP013931	Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence	2821-2850	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	2838-2867	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NZ_CP018322	Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence	4247-4276	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NC_017296	Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence	58687-58716	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NC_015686	Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence	58687-58716	8	0.733
NZ_FOGM01000001_1	1.2\|34021\|30\|NZ_FOGM01000001\|PILER-CR	34021-34050	30	NC_001988	Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence	58687-58716	8	0.733

1. spacer 1.1|33955|30|NZ_FOGM01000001|PILER-CR matches to MK448704 (Streptococcus phage Javan213, complete genome) position: , mismatch: 2, identity: 0.933

agatgccaataaccacattgtcgacgcagt	CRISPR spacer
agatgctaataaccacattatcgacgcagt	Protospacer
******.************.**********

2. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NZ_AP018256 (Calothrix sp. NIES-4071 plasmid plasmid1 DNA, complete genome) position: , mismatch: 5, identity: 0.833

ttatctgaaattgtagcaggtgagaaatac----	CRISPR spacer
ttatctgaaattgcagcaggt----aatactagt	Protospacer
*************.*******    *****

3. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to MN103543 (Pseudomonas phage vB_PaeM_PS119XW, complete genome) position: , mismatch: 7, identity: 0.767

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
tcattctcaattttagcaggtgagaaatat	Protospacer
*.**..  **** ****************.

4. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to MK599315 (Pseudomonas phage PA1C, complete genome) position: , mismatch: 7, identity: 0.767

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
tcattctcaattttagcaggtgagaaatat	Protospacer
*.**..  **** ****************.

5. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NZ_CP013929 (Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
gccagtgaaattgtagcagatgagaaattg	Protospacer
 .   **************.********

6. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to CP013931 (Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
gccagtgaaattgtagcagatgagaaattg	Protospacer
 .   **************.********

7. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
gccagtgaaattgtagcagatgagaaattg	Protospacer
 .   **************.********

8. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NZ_CP018322 (Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
gccagtgaaattgtagcagatgagaaattg	Protospacer
 .   **************.********

9. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NC_017296 (Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
ttatctgaaattttagcatgtgatttaccg	Protospacer
************ ***** ****   *.

10. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NC_015686 (Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
ttatctgaaattttagcatgtgatttaccg	Protospacer
************ ***** ****   *.

11. spacer 1.2|34021|30|NZ_FOGM01000001|PILER-CR matches to NC_001988 (Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence) position: , mismatch: 8, identity: 0.733

ttatctgaaattgtagcaggtgagaaatac	CRISPR spacer
ttatctgaaattttagcatgtgatttaccg	Protospacer
************ ***** ****   *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

127 : 27230

Streptococcus_phage(85.71%)

head,terminase,protease,tail,portal,capsid,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074626921.1\|127_598_+\|terminase	phage terminase small subunit P27 family	M1PKP2	Streptococcus_phage	1.8e-50	60.6
WP_074626922.1\|610_2365_+\|terminase	terminase large subunit	J7KKD1	Streptococcus_phage	1.1e-267	77.6
WP_074626923.1\|2535_3762_+\|portal	phage portal protein	A0A2H4JGQ4	uncultured_Caudovirales_phage	2.8e-180	78.0
WP_074626924.1\|3718_4396_+\|protease	Clp protease ClpP	M1Q115	Streptococcus_phage	5.3e-88	75.1
WP_074626925.1\|4433_5612_+\|capsid	phage major capsid protein	J7KJ82	Streptococcus_phage	1.1e-141	66.2
WP_074626926.1\|5754_6066_+\|head,tail	phage head-tail connector protein	J7KC36	Streptococcus_phage	1.2e-39	80.6
WP_074626927.1\|6052_6406_+\|head	phage head closure protein	M1PFA2	Streptococcus_phage	3.5e-35	62.8
WP_074626928.1\|6402_6777_+	HK97 gp10 family phage protein	J7KDM3	Streptococcus_phage	1.2e-41	68.8
WP_074626929.1\|6773_7202_+	hypothetical protein	J7KBZ9	Streptococcus_phage	1.0e-52	70.7
WP_074626930.1\|7225_7777_+\|tail	phage tail protein	M1PRQ7	Streptococcus_phage	2.8e-71	73.5
WP_074626931.1\|7825_8155_+	hypothetical protein	M1NRL6	Streptococcus_phage	2.7e-37	68.8
WP_074626932.1\|8151_8355_+	hypothetical protein	M1PF97	Streptococcus_phage	3.5e-11	68.6
WP_074626933.1\|8367_12552_+\|tail	phage tail tape measure protein	A0A2H4JEN9	uncultured_Caudovirales_phage	4.3e-196	52.2
WP_074627085.1\|12551_14033_+\|tail	phage tail family protein	A0A286QN53	Streptococcus_phage	9.4e-37	28.7
WP_074626934.1\|19000_19330_+	hypothetical protein	A0A1S5S8I0	Streptococcus_phage	3.1e-25	51.0
WP_074626935.1\|19348_19648_+	hypothetical protein	NA	NA	NA	NA
WP_074626936.1\|19644_19971_+\|holin	phage holin	NA	NA	NA	NA
WP_074626937.1\|19976_21110_+	CHAP domain-containing protein	A0A286QRL0	Streptococcus_phage	2.6e-31	45.3
WP_074626938.1\|21133_21502_+	hypothetical protein	NA	NA	NA	NA
WP_074627086.1\|21717_22263_+	hypothetical protein	NA	NA	NA	NA
WP_074626939.1\|22275_22662_+	hypothetical protein	A0A240FHV6	Streptococcus_phage	4.0e-32	57.1
WP_141768243.1\|22746_23916_+	DEAD/DEAH box helicase	A0A220GFH1	Streptococcus_phage	3.0e-147	66.8
WP_074627087.1\|23941_25189_+	DUF3440 domain-containing protein	A0A220GKF8	Streptococcus_phage	1.0e-206	80.2
WP_074626941.1\|25172_25688_+	ParB-like nuclease domain-containing protein	A0A220GKT8	Streptococcus_phage	2.0e-79	82.2
WP_074626942.1\|25708_25888_+	hypothetical protein	NA	NA	NA	NA
WP_074626943.1\|25933_26236_+	hypothetical protein	NA	NA	NA	NA
WP_039692288.1\|26813_27230_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.5e-24	45.6

DBSCAN-SWA_2

203472 : 216017

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074627034.1\|203472_204678_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.6e-42	48.5
WP_074627035.1\|204674_206546_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.3e-64	32.1
WP_074627036.1\|206623_208363_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-38	26.6
WP_074627037.1\|208365_210135_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-56	29.7
WP_074581134.1\|210374_211028_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.8e-61	54.7
WP_074627038.1\|211027_211474_+	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	2.0e-43	57.7
WP_141768241.1\|211463_212180_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	8.2e-63	47.5
WP_074627039.1\|212192_212684_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	2.1e-46	62.3
WP_074581132.1\|212741_213239_-	DUF308 domain-containing protein	NA	NA	NA	NA
WP_012962073.1\|213485_214835_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_074627040.1\|215100_215610_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013643186.1\|215606_216017_+	peptide deformylase	A0A2I7QLT9	Vibrio_phage	2.2e-12	38.2

Anti-CRISPR protein detection

Acr_ID: NZ_FOGM01000001.1|WP_074627086.1|21717_22263_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_FOGM01000001.1|WP_074626943.1|25933_26236_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_FOGM01000001.1|WP_074627086.1|21717_22263_+|hypothetical-protein

21717_22263_+

181 aa aa

AcrIIA18

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3636\|WP_074627086.1\|AcrIIA18\|II-A\|Verified\|Streptococcus-gallolyticus	1.0	1	1.0

127-27230

NZ_FOGM01000001.1|WP_074626943.1|25933_26236_+|hypothetical-protein

25933_26236_+

100 aa aa

AcrIIA17

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR3634\|WP_074626943.1\|AcrIIA17\|II-A\|Verified\|Streptococcus-gallolyticus	1.0	1	1.0

127-27230

6. NZ_FOGM01000014

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

68061 : 79067

Streptococcus_phage(92.31%)

integrase

attL 60055:60067|attR 70331:70343

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
60055:60067	attL	NA	NA	NA	NA
WP_074628042.1\|68061_69222_-\|integrase	site-specific integrase	A0A1S5SFX6	Streptococcus_phage	1.5e-77	41.9
WP_074628043.1\|69460_69784_-	hypothetical protein	NA	NA	NA	NA
WP_074628044.1\|69801_70086_-	hypothetical protein	I2E8X0	Clostridium_phage	2.4e-18	74.6
WP_074628045.1\|70088_70874_-	helix-turn-helix transcriptional regulator	M1NS52	Streptococcus_phage	1.7e-93	70.1
70331:70343	attR	NA	NA	NA	NA
WP_074628046.1\|71089_71296_+	helix-turn-helix transcriptional regulator	A0A1S5SFQ0	Streptococcus_phage	4.8e-16	61.8
WP_074628047.1\|71589_71841_+	helix-turn-helix domain-containing protein	A3F618	Streptococcus_phage	9.3e-22	60.0
WP_074628048.1\|71875_72262_+	hypothetical protein	NA	NA	NA	NA
WP_074628049.1\|72282_72600_+	ParB N-terminal domain-containing protein	A0A141E1C9	Streptococcus_phage	5.3e-14	42.5
WP_074628050.1\|72571_73060_+	hypothetical protein	NA	NA	NA	NA
WP_177159402.1\|73081_73258_+	hypothetical protein	NA	NA	NA	NA
WP_074628060.1\|73382_73691_+	hypothetical protein	A0A1S5PRW6	Streptococcus_phage	1.2e-39	83.0
WP_074628051.1\|73687_74362_+	AAA family ATPase	A0A286QRM1	Streptococcus_phage	1.4e-101	78.8
WP_074628052.1\|74351_75695_+	DEAD/DEAH box helicase	A0A2I6QQP9	Streptococcus_phage	5.4e-193	72.9
WP_074628053.1\|75701_76160_+	DUF669 domain-containing protein	J7KDQ7	Streptococcus_phage	4.0e-55	69.7
WP_074628062.1\|76168_76972_+	bifunctional DNA primase/polymerase	A0A1P8VVM6	Streptococcus_phage	1.4e-108	70.9
WP_074628061.1\|76967_78482_+	DNA primase	A0A1P8VVM0	Streptococcus_phage	1.0e-203	69.9
WP_074628054.1\|78740_79067_+	VRR-NUC domain-containing protein	J7KC03	Streptococcus_phage	6.2e-42	81.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_FOGM01000021

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 28051

Streptococcus_phage(96.55%)

terminase,capsid,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074628224.1\|0_3401_-	hypothetical protein	A0A1C9LX80	Streptococcus_phage	1.2e-188	46.5
WP_074628225.1\|3403_4912_-\|tail	phage tail family protein	A0A1P8VVL3	Streptococcus_phage	1.7e-211	69.0
WP_074628226.1\|4908_8265_-	tape measure protein	A7J2A5	Streptococcus_phage	1.5e-85	64.9
WP_074628227.1\|8281_8866_-	bacteriophage Gp15 family protein	M1IEU4	Streptococcus_phage	2.2e-74	71.0
WP_074628228.1\|8865_9243_-	hypothetical protein	A0A1P8VVP0	Streptococcus_phage	6.1e-25	48.0
WP_074628229.1\|9256_9715_-\|tail	phage tail protein	K4JTI5	Streptococcus_phage	5.1e-58	73.0
WP_074628230.1\|9726_10128_-\|capsid	minor capsid protein	M1I9U2	Streptococcus_phage	2.8e-52	71.8
WP_074628231.1\|10124_10475_-\|capsid	minor capsid protein	A0A1P8VVL8	Streptococcus_phage	1.8e-31	62.6
WP_074628232.1\|10474_10801_-\|capsid	capsid protein	M1IEU8	Streptococcus_phage	3.1e-33	58.9
WP_074628233.1\|10790_11180_-	hypothetical protein	A0A1P8VVN9	Streptococcus_phage	1.3e-46	73.8
WP_074628234.1\|11209_11425_-	hypothetical protein	A0A1P8VVQ1	Streptococcus_phage	8.8e-13	54.7
WP_074628235.1\|11427_12318_-\|capsid	phage capsid protein	A0A1P8VVM7	Streptococcus_phage	9.0e-136	84.9
WP_074628236.1\|12335_12902_-	phage scaffolding protein	A0A1C9LX53	Streptococcus_phage	1.1e-62	69.1
WP_074628237.1\|13064_13277_-	hypothetical protein	NA	NA	NA	NA
WP_081350189.1\|13263_14772_-\|capsid	phage minor capsid protein	M1IEV1	Streptococcus_phage	1.1e-157	72.1
WP_074628238.1\|14764_16315_-\|portal	phage portal protein	M1IFC5	Streptococcus_phage	1.0e-235	77.8
WP_074628239.1\|16324_17635_-\|terminase	PBSX family phage terminase large subunit	K4JW72	Streptococcus_phage	4.5e-216	80.9
WP_074628240.1\|17624_18107_-\|terminase	terminase small subunit	M1HNV8	Streptococcus_phage	7.5e-44	61.8
WP_074628241.1\|18187_18568_-	hypothetical protein	K4JTJ9	Streptococcus_phage	2.2e-43	67.7
WP_074628242.1\|18548_18974_-	endodeoxyribonuclease RusA	A0A1P8VVN4	Streptococcus_phage	2.4e-38	58.0
WP_074628243.1\|19433_19679_-	hypothetical protein	A0A1S5SEE7	Streptococcus_phage	4.2e-19	56.6
WP_177159407.1\|20217_20379_-	hypothetical protein	NA	NA	NA	NA
WP_177159408.1\|20375_20546_-	hypothetical protein	A0A1S5SEF3	Streptococcus_phage	2.7e-09	57.1
WP_074628245.1\|20555_21539_-	DUF1351 domain-containing protein	K4JU67	Streptococcus_phage	3.0e-84	53.6
WP_074628246.1\|21549_22188_-	ERF family protein	K4JXN5	Streptococcus_phage	1.4e-58	57.5
WP_177159409.1\|22175_22322_-	hypothetical protein	NA	NA	NA	NA
WP_074628247.1\|22318_22528_-	hypothetical protein	NA	NA	NA	NA
WP_074628248.1\|22530_22785_-	hypothetical protein	NA	NA	NA	NA
WP_074628249.1\|22787_23693_-	phage replisome organizer N-terminal domain-containing protein	M1PS00	Streptococcus_phage	1.6e-79	67.5
WP_177159410.1\|23798_23939_-	hypothetical protein	NA	NA	NA	NA
WP_177159411.1\|23935_24082_-	hypothetical protein	A0A141E1R4	Streptococcus_phage	2.4e-06	47.5
WP_141768279.1\|24316_24652_+	hypothetical protein	NA	NA	NA	NA
WP_074628251.1\|24795_25011_-	phage repressor protein	E8ZDN3	Streptococcus_phage	7.2e-23	77.5
WP_074628252.1\|25182_25914_+	helix-turn-helix transcriptional regulator	A0A1S5S8T5	Streptococcus_phage	6.6e-60	52.4
WP_074628253.1\|25964_26468_+	hypothetical protein	A8ASM1	Listeria_phage	1.0e-06	32.4
WP_074628254.1\|26605_28051_+	recombinase family protein	E8ZDY7	Streptococcus_phage	2.3e-181	66.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_FOGM01000027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5176

Streptococcus_phage(57.14%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074628305.1\|0_455_-	elongation factor G	Q9XJC1	Streptococcus_virus	5.8e-38	55.9
WP_074628306.1\|476_815_-	hypothetical protein	O21984	Streptococcus_virus	3.8e-26	57.5
WP_081350192.1\|1020_2010_-	hypothetical protein	A0A286QN95	Streptococcus_phage	1.7e-79	58.1
WP_074628307.1\|1996_2323_-\|holin	phage holin	NA	NA	NA	NA
WP_074628308.1\|2367_2700_-	hypothetical protein	Q56S82	Streptococcus_virus	1.7e-42	80.9
WP_177159414.1\|2721_2877_-	hypothetical protein	A0A2I6QR42	Streptococcus_phage	4.0e-15	89.6
WP_074628310.1\|2902_3244_-	DUF1366 domain-containing protein	A0A2I6QR31	Streptococcus_phage	6.9e-36	70.8
WP_074628311.1\|3259_5176_-	hypothetical protein	A0A286QQU9	Streptococcus_phage	1.7e-123	42.4

Anti-CRISPR protein detection

Acr_ID: NZ_FOGM01000027.1|WP_074628305.1|0_455_-|elongation-factor-G

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_FOGM01000027.1|WP_074628305.1|0_455_-|elongation-factor-G

0_455_-

151 aa aa

AcrIIA6

hit_Aca_id	identity	query_coverage	hit_coverage
anti_CRISPR1284\|AVO22749.1\|AcrIIA6\|II-A\|Verified\|Streptococcus-phage-D1811	0.5657894736842105	1	0.825136612021858

0-5176

9. NZ_FOGM01000012

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

47832 : 55972

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074627928.1\|47832_48489_-	transglycosylase SLT domain-containing protein	Q4Z8Z7	Staphylococcus_phage	6.4e-22	75.0
WP_039694760.1\|48695_49286_-	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.1e-20	76.9
WP_012962644.1\|49418_50216_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_074627929.1\|50208_51051_-	energy-coupling factor transporter ATPase	W6JKT0	Anomala_cuprea_entomopoxvirus	8.0e-17	28.4
WP_074627930.1\|51026_51869_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	1.3e-19	30.0
WP_039694766.1\|51865_52420_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_009855209.1\|52429_53374_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_074627931.1\|53437_54727_-	insulinase family protein	A0A2K9LA15	Tupanvirus	1.0e-15	26.4
WP_009855211.1\|54727_55972_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	7.2e-91	42.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage