CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
AP018443	Bacillus anthracis CZC5 DNA, complete genome	2 crisprs	cas3,csa3,WYL,c2c9_V-U4,DinG,DEDDh,cas14j	1	9
AP018444	Bacillus anthracis CZC5 plasmid pXO1 DNA, complete genome	0 crisprs	RT,c2c4_V-U1,csa3,c2c10_CAS-V-U3	0	1
AP018445	Bacillus anthracis CZC5 plasmid pXO2 DNA, complete genome	1 crisprs	NA	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018443_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018443_3

2710928-2711125

Orphan

Consensus_repeat	Method
TTTCGGAATGAACATTCATTCCT	CRISPRCasFinder

3 spacers

The CRISPR arrays of AP018443_3

>merge|AP018443|3|2710928-2711125|CRISPRCasFinder
TTACGGAATGAATATTCATTCCTATTATTTTGAAAACACCTTTTCGGAATGAACATTCATTCCTCTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGATTTCGGAATGAATATTCATTCCTTTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCTCATCGGAATGAATGTTCATTCCT

>AP018443|3|3|2710928-2711125|CRISPRCasFinder
TTACGGAATGAATATTCATTCCT	ATTATTTTGAAAACACCT
TTTCGGAATGAACATTCATTCCT	CTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGA
TTTCGGAATGAATATTCATTCCT	TTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCT
CATCGGAATGAATGTTCATTCCT

Protein	Signature genes	Signature genes Name	Protein_function
AP018443.1\|BBB73069.1\|2699180_2699441_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236766
AP018443.1\|BBB73080.1\|2713324_2714614_-\|3-phosphoshikimate-1-carboxyvinyltransferase-1	unknown	unknown	gnl\|CDD\|235037
AP018443.1\|BBB73073.1\|2702149_2704123_-\|lipoteichoic-acid-synthase-1	unknown	unknown	gnl\|CDD\|224287
AP018443.1\|BBB73079.1\|2711981_2713139_-\|N-acetyltransferase-Eis	unknown	unknown	gnl\|CDD\|226925
AP018443.1\|BBB73075.1\|2706642_2707491_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
AP018443.1\|BBB73071.1\|2700645_2701308_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378997
AP018443.1\|BBB73087.1\|2723868_2724306_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371204
AP018443.1\|BBB73083.1\|2716842_2718015_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
AP018443.1\|BBB73076.1\|2707776_2708274_-\|putative-membrane-protein-YdgH	unknown	unknown	gnl\|CDD\|225272
AP018443.1\|BBB73068.1\|2698131_2698815_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|132880
AP018443.1\|BBB73077.1\|2708468_2710892_-\|putative-membrane-protein-YdgH	unknown	unknown	gnl\|CDD\|225272
AP018443.1\|BBB73086.1\|2722711_2723719_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238697
AP018443.1\|BBB73074.1\|2704639_2706265_-\|putative-ABC-transporter-ATP-binding-protein-YbiT	unknown	unknown	gnl\|CDD\|237894
AP018443.1\|BBB73082.1\|2715723_2716824_-\|histidinol-phosphate-aminotransferase	unknown	unknown	gnl\|CDD\|134568
AP018443.1\|BBB73070.1\|2699658_2700486_+\|peptidoglycan-N-acetylglucosamine-deacetylase	unknown	unknown	gnl\|CDD\|200569
AP018443.1\|BBB73078.1\|2711145_2711712_-\|HTH-type-transcriptional-repressor-Bm3R1	unknown	unknown	gnl\|CDD\|292911
AP018443.1\|BBB73084.1\|2718299_2719376_-\|phospho-2-dehydro-3-deoxyheptonate-aldolase	unknown	unknown	gnl\|CDD\|183614
AP018443.1\|BBB73072.1\|2701418_2702090_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|163429
AP018443.1\|BBB73081.1\|2714630_2715731_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
AP018443.1\|BBB73085.1\|2720207_2722757_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372518

Protein	Function_ID	Function_description	E-value
AP018443.1\|BBB73069.1\|2699180_2699441_-\|hypothetical-protein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.000712004
AP018443.1\|BBB73080.1\|2713324_2714614_-\|3-phosphoshikimate-1-carboxyvinyltransferase-1	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
AP018443.1\|BBB73073.1\|2702149_2704123_-\|lipoteichoic-acid-synthase-1	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
AP018443.1\|BBB73079.1\|2711981_2713139_-\|N-acetyltransferase-Eis	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	4.70014e-72
AP018443.1\|BBB73075.1\|2706642_2707491_-\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	2.01186e-152
AP018443.1\|BBB73071.1\|2700645_2701308_+\|hypothetical-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	6.87406e-32
AP018443.1\|BBB73087.1\|2723868_2724306_+\|hypothetical-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	3.67802e-44
AP018443.1\|BBB73083.1\|2716842_2718015_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
AP018443.1\|BBB73076.1\|2707776_2708274_-\|putative-membrane-protein-YdgH	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	3.31061e-28
AP018443.1\|BBB73068.1\|2698131_2698815_-\|hypothetical-protein	gnl\|CDD\|132880	cd06561, AlkD_like, A new structural DNA glycosylase. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity.	3.93397e-27
AP018443.1\|BBB73077.1\|2708468_2710892_-\|putative-membrane-protein-YdgH	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	1.55084e-81
AP018443.1\|BBB73086.1\|2722711_2723719_-\|hypothetical-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	4.29264e-62
AP018443.1\|BBB73074.1\|2704639_2706265_-\|putative-ABC-transporter-ATP-binding-protein-YbiT	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
AP018443.1\|BBB73082.1\|2715723_2716824_-\|histidinol-phosphate-aminotransferase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
AP018443.1\|BBB73070.1\|2699658_2700486_+\|peptidoglycan-N-acetylglucosamine-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.21079e-85
AP018443.1\|BBB73078.1\|2711145_2711712_-\|HTH-type-transcriptional-repressor-Bm3R1	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71
AP018443.1\|BBB73084.1\|2718299_2719376_-\|phospho-2-dehydro-3-deoxyheptonate-aldolase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
AP018443.1\|BBB73072.1\|2701418_2702090_+\|hypothetical-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.67512e-74
AP018443.1\|BBB73081.1\|2714630_2715731_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	5.37504e-160
AP018443.1\|BBB73085.1\|2720207_2722757_-\|hypothetical-protein	gnl\|CDD\|372518	pfam13212, DUF4020, Domain of unknown function (DUF4020). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is typically between 176 and 195 amino acids in length.	3.87821e-50

>AP018443.1|BBB73077.1|2708468_2710892_-|putative-membrane-protein-YdgH
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQLVSKDNTTILTQISIDKKHGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPIVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQADELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIERGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQMKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQVLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTA
>AP018443.1|BBB73076.1|2707776_2708274_-|putative-membrane-protein-YdgH
MLIGIAIVLIVITRSLLNTIFIIGSLILAYFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGEPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLALIQVASVVGVALLLLAIIVMPILLPALIGLMSKMKDYAKKLSERK
>AP018443.1|BBB73075.1|2706642_2707491_-|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKNVELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIGSYRSMLKDKLTIQMVK
>AP018443.1|BBB73074.1|2704639_2706265_-|putative-ABC-transporter-ATP-binding-protein-YbiT
MITVSNVSLRFADRKLFEGVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWHESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>AP018443.1|BBB73073.1|2702149_2704123_-|lipoteichoic-acid-synthase-1
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>AP018443.1|BBB73072.1|2701418_2702090_+|hypothetical-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>AP018443.1|BBB73071.1|2700645_2701308_+|hypothetical-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKKWVLWSYFDYWCCAMTDGSTYLHTKNKCTLDEWYIYMDKKYGIIFNFDYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>AP018443.1|BBB73070.1|2699658_2700486_+|peptidoglycan-N-acetylglucosamine-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>AP018443.1|BBB73069.1|2699180_2699441_-|hypothetical-protein
MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKKENE
>AP018443.1|BBB73068.1|2698131_2698815_-|hypothetical-protein
MLLEEVMQQLEEYGTEQNRKTYKNHGAKEPLFGVSFANLKLLKKKIKKDHDLAISLWETKNMDAMTLATMILDPKKVTTELLNKWVQEVDYYCLMDVLMTAICTSPIAIERMEEWTKSDDEWIGRAGWSLLANIAIKNKTLQDDSFSPYLEEIKENIHNEKNRKREAMNSALIAIGIRNEDLEQTAIEIAREIGKVQVDHGATSCKTPDAESYIKKARERAEKKKMK
>AP018443.1|BBB73078.1|2711145_2711712_-|HTH-type-transcriptional-repressor-Bm3R1
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>AP018443.1|BBB73079.1|2711981_2713139_-|N-acetyltransferase-Eis
MNVIRLKEDKFREALRLSEYAFQYKVDEDRLQQQITKMKESHEVYGIMEGENLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKESHPEEVEKLYETFAELFSGMLVRNEKWWLQAVYDDLTLAIYYDENQTAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQHDSMIKDLEMTVSENEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAQWNNITVRIANHEITIIEEPIDKGIKLDINALSTILFGYRRPLELNELELISGSEEEIRAFESVVPVRKPFIYDFF
>AP018443.1|BBB73080.1|2713324_2714614_-|3-phosphoshikimate-1-carboxyvinyltransferase-1
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFLSCVQGDTSIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDRMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>AP018443.1|BBB73081.1|2714630_2715731_-|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>AP018443.1|BBB73082.1|2715723_2716824_-|histidinol-phosphate-aminotransferase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>AP018443.1|BBB73083.1|2716842_2718015_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIEMDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQIITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>AP018443.1|BBB73084.1|2718299_2719376_-|phospho-2-dehydro-3-deoxyheptonate-aldolase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>AP018443.1|BBB73085.1|2720207_2722757_-|hypothetical-protein
MEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKLSPLLWRTICSYLNETKMKMDPLLFARWTLLLLETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSTFSFVEQIWNEKMKPHISYYAVPIMMMGIEKIRMLSLRQAALKKRDKENVEKEFQQNDLAFLIQIVKECLAYLCKNNEKKANYYITEMIEANSVLQNRIAIDAMNKNVFVSADEKMKWLLQEGILLDVTYKHEVFQLIKNHFALSLEKTKEEVIQIVLKDLAEERAFDVCFVLDLLFTCDSNSPSTAKGYELMKQKHPHFHSERYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVQQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLAKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMIARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGGITAREYVMLLRIILFMDEIVERGLLIICKSFSDVGGKGNQTELKQLFHEILEKTESIKMYKELYANVFFTLLQTLQEANLLKTEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVLENLQEEM
>AP018443.1|BBB73086.1|2722711_2723719_-|hypothetical-protein
MTFLGKGESSVWITSEVEIPDELIDHLEKGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAMKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKLKQSATLLNLLTIMNGWNGLKRKGNYKIYF
>AP018443.1|BBB73087.1|2723868_2724306_+|hypothetical-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSSSRTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: AP018443_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018443_5

3257488-3257590

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of AP018443_5

>merge|AP018443|5|3257488-3257590|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>AP018443|5|5|3257488-3257590|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
AP018443.1\|BBB73649.1\|3258228_3258882_-\|hypothetical-protein	unknown	unknown	unknown
AP018443.1\|BBB73639.1\|3248026_3248680_+\|N-hydroxyarylamine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|225073
AP018443.1\|BBB73643.1\|3252476_3253697_-\|hexuronate-transporter	unknown	unknown	gnl\|CDD\|341028
AP018443.1\|BBB73653.1\|3263134_3264601_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234583
AP018443.1\|BBB73641.1\|3250756_3251890_-\|putative-penicillin-binding-protein-PbpX	unknown	unknown	gnl\|CDD\|365903
AP018443.1\|BBB73645.1\|3254650_3255160_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372464
AP018443.1\|BBB73650.1\|3259497_3261117_-\|aklavinone-12-hydroxylase-RdmE	unknown	unknown	gnl\|CDD\|366675
AP018443.1\|BBB73651.1\|3261594_3261939_+\|HTH-type-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
AP018443.1\|BBB73646.1\|3255253_3255931_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99750
AP018443.1\|BBB73648.1\|3257663_3258254_-\|hypothetical-protein	unknown	unknown	unknown
AP018443.1\|BBB73652.1\|3261957_3262956_+\|quinone-oxidoreductase-1	unknown	unknown	gnl\|CDD\|176191
AP018443.1\|BBB73655.1\|3265606_3265951_+\|hypothetical-protein	unknown	unknown	unknown
AP018443.1\|BBB73640.1\|3248933_3250721_+\|oligoendopeptidase-F,-plasmid	unknown	unknown	gnl\|CDD\|341071
AP018443.1\|BBB73656.1\|3265947_3266139_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275222
AP018443.1\|BBB73644.1\|3253806_3254658_+\|HTH-type-transcriptional-regulator-GltR	unknown	unknown	gnl\|CDD\|176133
AP018443.1\|BBB73654.1\|3264856_3265531_+\|response-regulator-aspartate-phosphatase-I	unknown	unknown	gnl\|CDD\|376220
AP018443.1\|BBB73647.1\|3255980_3256925_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
AP018443.1\|BBB73642.1\|3252146_3252377_+\|hypothetical-protein	unknown	unknown	unknown
AP018443.1\|BBB73638.1\|3246269_3247811_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
AP018443.1\|BBB73657.1\|3266212_3266812_-\|protease-synthase-and-sporulation-protein-PAI-2	unknown	unknown	gnl\|CDD\|377290

Protein	Function_ID	Function_description	E-value
AP018443.1\|BBB73639.1\|3248026_3248680_+\|N-hydroxyarylamine-O-acetyltransferase	gnl\|CDD\|225073	COG2162, NhoA, Arylamine N-acetyltransferase [Secondary metabolites biosynthesis, transport, and catabolism].	4.99933e-38
AP018443.1\|BBB73643.1\|3252476_3253697_-\|hexuronate-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.73424e-95
AP018443.1\|BBB73653.1\|3263134_3264601_+\|hypothetical-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
AP018443.1\|BBB73641.1\|3250756_3251890_-\|putative-penicillin-binding-protein-PbpX	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	2.66756e-58
AP018443.1\|BBB73645.1\|3254650_3255160_+\|hypothetical-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	2.0675e-75
AP018443.1\|BBB73650.1\|3259497_3261117_-\|aklavinone-12-hydroxylase-RdmE	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	9.27661e-109
AP018443.1\|BBB73651.1\|3261594_3261939_+\|HTH-type-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.46799e-14
AP018443.1\|BBB73646.1\|3255253_3255931_+\|hypothetical-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	6.43775e-21
AP018443.1\|BBB73652.1\|3261957_3262956_+\|quinone-oxidoreductase-1	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.42217e-150
AP018443.1\|BBB73640.1\|3248933_3250721_+\|oligoendopeptidase-F,-plasmid	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
AP018443.1\|BBB73656.1\|3265947_3266139_+\|hypothetical-protein	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	3.30665e-06
AP018443.1\|BBB73644.1\|3253806_3254658_+\|HTH-type-transcriptional-regulator-GltR	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
AP018443.1\|BBB73654.1\|3264856_3265531_+\|response-regulator-aspartate-phosphatase-I	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	2.3958e-19
AP018443.1\|BBB73647.1\|3255980_3256925_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	3.02275e-148
AP018443.1\|BBB73638.1\|3246269_3247811_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
AP018443.1\|BBB73657.1\|3266212_3266812_-\|protease-synthase-and-sporulation-protein-PAI-2	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.20741e-71

>AP018443.1|BBB73647.1|3255980_3256925_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSINKNIPLVQLLWYYPNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGDLIINESYMKMARQNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHTVLKEK
>AP018443.1|BBB73646.1|3255253_3255931_+|hypothetical-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGGSHPGNWQAPLETYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMENGVPKGAILFEKNSLHSIANVIEAKKIFDFTKINRLLFVCKNLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPEKEVHGLEEYVSYYYNLA
>AP018443.1|BBB73645.1|3254650_3255160_+|hypothetical-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIQPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISIFPTPQLLRFQEVIYDEDTIDEKEIWFIGELS
>AP018443.1|BBB73644.1|3253806_3254658_+|HTH-type-transcriptional-regulator-GltR
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>AP018443.1|BBB73643.1|3252476_3253697_-|hexuronate-transporter
MLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFIGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMSIHTITSGVLYSVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRRNKKIKES
>AP018443.1|BBB73642.1|3252146_3252377_+|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>AP018443.1|BBB73641.1|3250756_3251890_-|putative-penicillin-binding-protein-PbpX
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDTFNQEFRKMANDLIEGNGA
>AP018443.1|BBB73640.1|3248933_3250721_+|oligoendopeptidase-F,-plasmid
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSVDENTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNKLRKEKLNVDELRQYDLSVDLVQGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKCSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSDVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>AP018443.1|BBB73639.1|3248026_3248680_+|N-hydroxyarylamine-O-acetyltransferase
MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNVLEKNFKEISQENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKQMQHKKLLLNTMAHHLTKYLLL
>AP018443.1|BBB73638.1|3246269_3247811_-|alpha-amylase
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>AP018443.1|BBB73648.1|3257663_3258254_-|hypothetical-protein
MGCIMDKYNGNNIVDCIRILIPFDIRNIVGAFMWVIMNFMLLIILFIFPPYDIYSYVALPFYVICNLWGIWVSIYKPRQPQLQHLLYSGFVSLSISFCSFIAVQKLAYEFVKIESPLFFILSLIAYSLIVYKSELFWIKYFTARLRGTTDQDVKIPKIVFFSSLGYMIGQISIGILSQKTMAILLIILLSFFPLCS
>AP018443.1|BBB73649.1|3258228_3258882_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSARSSVVMVWVVINFMILTPFLFPPTFTIYLYVILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFVLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>AP018443.1|BBB73650.1|3259497_3261117_-|aklavinone-12-hydroxylase-RdmE
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARILGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISAEGRGTIGGYYMNIYFEADVSEFMQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWKAAESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTDYAISLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDAVTLHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENIFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMSNLLCDF
>AP018443.1|BBB73651.1|3261594_3261939_+|HTH-type-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>AP018443.1|BBB73652.1|3261957_3262956_+|quinone-oxidoreductase-1
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGPDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>AP018443.1|BBB73653.1|3263134_3264601_+|hypothetical-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEVLKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPVPTNRPYRTFCGT
>AP018443.1|BBB73654.1|3264856_3265531_+|response-regulator-aspartate-phosphatase-I
MNVQLQGNEQITKLFNDWYLAMLKQDVSQATNLKHEIEEKELNFEEDENLALYYSLLDFRYKVLVDSLSISKDCFDKIDSYLISSNHPLAYYYHFFKGIYATLTTDFNLASEHYEQAKLLLVNNTDNLEHAEFYYRMAIFHYHFYQPIESIEYATKAKAIFDKHTGYEVKVGLCKNTLGASFVYLKQYEQAEEQYNSAIHLLQKSNEKELILSVRNNLGWLYAS
>AP018443.1|BBB73655.1|3265606_3265951_+|hypothetical-protein
MQAREHSKLDETSIAEGLIQKGVKICTELNNEEYIYHFKILNELNNNVASEELETIILKGITFFDKELLYNYTQEYSEKLAVKFYSENNHIKASEYFHKALQAKEKTFEKGALK
>AP018443.1|BBB73656.1|3265947_3266139_+|hypothetical-protein
MIKKISSVFLGLSVFGILATGIHSSFTYQAGHADLPAPQRPDLVQSVDASKDYNSTTTAEKAL
>AP018443.1|BBB73657.1|3266212_3266812_-|protease-synthase-and-sporulation-protein-PAI-2
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVARRKLVVEELEKVGSEGSRGIAELMRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	KJ094023	Listeria phage LP-101, complete genome	3876-3902	4	0.852
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NC_022766	Bacillus phage Glittering, complete genome	9024-9050	5	0.815
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	1229260-1229286	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	438058-438084	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	127169-127195	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	1227597-1227623	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	850854-850880	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	513839-513865	6	0.778
AP018443_4	4.1\|3089155\|27\|AP018443\|CRISPRCasFinder	3089155-3089181	27	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	498252-498278	6	0.778

1. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to KJ094023 (Listeria phage LP-101, complete genome) position: , mismatch: 4, identity: 0.852

cgtctttggctcttctggtttctcttc	CRISPR spacer
catttctggctcttctggtttcttttc	Protospacer
*.*.*.*****************.***

2. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NC_022766 (Bacillus phage Glittering, complete genome) position: , mismatch: 5, identity: 0.815

cgtctttggctcttctggtttctcttc	CRISPR spacer
gttcaatggctcttctggtttctcatc	Protospacer
  **  ****************** **

3. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

4. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

5. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

6. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

7. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

8. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

9. spacer 4.1|3089155|27|AP018443|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

259020 : 266968

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB70532.1\|259020_259305_+	10 kDa chaperonin	A0A221S3C8	uncultured_virus	1.2e-20	53.8
BBB70533.1\|259343_260978_+	60 kDa chaperonin	A0A219YK78	uncultured_virus	4.5e-157	58.0
BBB70534.1\|261376_262924_+	GMP synthase [glutamine-hydrolyzing]	A0A1V0SH76	Hokovirus	3.4e-21	31.2
BBB70535.1\|263308_264634_+	guanine/hypoxanthine permease PbuG	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
BBB70536.1\|264778_265480_+	transcriptional regulatory protein WalR	W8CYM9	Bacillus_phage	5.6e-40	36.9
BBB70537.1\|265579_266968_+	alkaline phosphatase synthesis sensor protein PhoR	W8CYF6	Bacillus_phage	1.5e-31	29.1

DBSCAN-SWA_2

438048 : 467278

Bacillus_phage(67.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB70690.1\|438048_439173_-\|transposase	transposase from transposon Tn916	A0A1B0T6A8	Bacillus_phage	1.2e-188	85.8
BBB70691.1\|440767_441943_+	hypothetical protein	A0A1B0T6A5	Bacillus_phage	6.3e-52	33.0
BBB70692.1\|441939_442107_+	hypothetical protein	NA	NA	NA	NA
BBB70693.1\|442274_442409_+	hypothetical protein	NA	NA	NA	NA
BBB70694.1\|442436_442778_-	HTH-type transcriptional regulator Xre	A0A1B0T6A7	Bacillus_phage	1.2e-16	41.2
BBB70695.1\|442985_443174_+	hypothetical protein	NA	NA	NA	NA
BBB70696.1\|443191_443923_+	hypothetical protein	A0A1B1P7T7	Bacillus_phage	1.5e-125	91.8
BBB70697.1\|443967_444318_+	hypothetical protein	A0A1B0T6C2	Bacillus_phage	3.9e-50	79.3
BBB70698.1\|444314_444482_+	hypothetical protein	A0A0U3B230	Bacillus_phage	2.0e-20	92.5
BBB70699.1\|444511_444697_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	2.7e-18	70.7
BBB70700.1\|444693_445566_+	hypothetical protein	A0A0S2GLI6	Bacillus_phage	1.0e-51	61.7
BBB70701.1\|445510_446338_+	primosomal protein DnaI	A0A1B1P7U2	Bacillus_phage	1.5e-145	99.2
BBB70702.1\|446353_446548_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.3e-26	87.5
BBB70703.1\|446572_446746_+	hypothetical protein	A0A1B1P7U5	Bacillus_phage	3.6e-25	96.5
BBB70704.1\|446760_447015_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	2.0e-40	96.4
BBB70705.1\|447026_447443_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	1.4e-14	43.0
BBB70706.1\|447458_447923_+	hypothetical protein	A0A0U4IBD0	Bacillus_phage	7.2e-20	47.7
BBB70707.1\|447960_448140_+	hypothetical protein	A0A1B1P8C9	Bacillus_phage	7.5e-26	93.2
BBB70708.1\|448188_448473_+	hypothetical protein	G9B1P0	Bacillus_phage	4.9e-11	58.5
BBB70709.1\|448672_449272_+	hypothetical protein	A0A0S2SXN5	Bacillus_phage	9.3e-44	45.6
BBB70710.1\|449309_449480_+	hypothetical protein	NA	NA	NA	NA
BBB70711.1\|449492_449678_+	hypothetical protein	NA	NA	NA	NA
BBB70712.1\|449703_449841_+	hypothetical protein	NA	NA	NA	NA
BBB70713.1\|449884_450289_+	hypothetical protein	D0R7I0	Paenibacillus_phage	1.3e-12	52.8
BBB70714.1\|450288_450735_+	hypothetical protein	A0A0A7AQW7	Bacillus_phage	1.7e-58	72.3
BBB70715.1\|450775_450958_+	hypothetical protein	A0A218KC21	Bacillus_phage	2.2e-17	74.1
BBB70716.1\|450989_451364_+	hypothetical protein	NA	NA	NA	NA
BBB70717.1\|451469_451826_+	hypothetical protein	NA	NA	NA	NA
BBB70718.1\|451853_452042_+	hypothetical protein	G9J1S8	Bacillus_phage	1.5e-08	50.8
BBB70719.1\|452046_452169_+	hypothetical protein	NA	NA	NA	NA
BBB70720.1\|452284_452455_+	hypothetical protein	A0A1B1P735	Bacillus_phage	1.0e-08	82.1
BBB70721.1\|452482_452965_+	hypothetical protein	H0USV3	Bacillus_phage	1.1e-71	83.1
BBB70722.1\|452964_453258_+	hypothetical protein	W8CYP1	Bacillus_phage	1.8e-40	86.6
BBB70723.1\|453285_453507_+	hypothetical protein	A0A0S2GLG4	Bacillus_phage	1.4e-34	100.0
BBB70724.1\|454095_454398_+	hypothetical protein	R9TNN2	Paenibacillus_phage	1.6e-31	63.9
BBB70725.1\|454394_454562_+	hypothetical protein	A0A142F1N8	Bacillus_phage	1.6e-09	62.2
BBB70726.1\|454558_454705_+	hypothetical protein	NA	NA	NA	NA
BBB70727.1\|454805_455177_+	hypothetical protein	R9TQ46	Paenibacillus_phage	5.1e-24	54.1
BBB70728.1\|455173_456862_+	hypothetical protein	A0A290GJW3	Caldibacillus_phage	1.1e-243	71.2
BBB70729.1\|457099_458098_+	hypothetical protein	A0A0A8WJ25	Clostridium_phage	8.6e-111	62.3
BBB70730.1\|458054_458636_+	hypothetical protein	A0A2I7SBY1	Paenibacillus_phage	7.9e-32	44.1
BBB70731.1\|458654_459845_+	hypothetical protein	A0A2I4R671	Erysipelothrix_phage	1.0e-09	24.7
BBB70732.1\|459860_460118_+	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	42.0
BBB70733.1\|460114_460387_+	hypothetical protein	R9TMB7	Paenibacillus_phage	1.4e-18	52.8
BBB70734.1\|460383_460683_+	hypothetical protein	NA	NA	NA	NA
BBB70735.1\|460675_461032_+	hypothetical protein	D2XR21	Bacillus_phage	6.5e-29	57.8
BBB70736.1\|461028_461358_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.1e-41	76.1
BBB70737.1\|461358_461928_+	hypothetical protein	A0A0U4JWV5	Exiguobacterium_phage	7.2e-54	58.0
BBB70738.1\|461932_462295_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.6e-28	50.8
BBB70739.1\|462536_466472_+	hypothetical protein	D2XR25	Bacillus_phage	1.5e-153	73.0
BBB70740.1\|466468_467278_+	hypothetical protein	A0A290FZP5	Caldibacillus_phage	3.6e-59	44.5

DBSCAN-SWA_3

1829250 : 1837983

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB72131.1\|1829250_1830513_+	putative peptidoglycan endopeptidase LytE	A0A1V0DZX6	Clostridioides_phage	4.4e-11	31.5
BBB72132.1\|1830611_1831376_-	dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system	NA	NA	NA	NA
BBB72133.1\|1831616_1832243_+	multidrug resistance ABC transporter ATP-binding/permease protein BmrA	W8CYL7	Bacillus_phage	1.3e-101	96.6
BBB72134.1\|1832264_1833377_+	multidrug resistance ABC transporter ATP-binding/permease protein BmrA	W8CYL7	Bacillus_phage	9.2e-154	95.6
BBB72135.1\|1833378_1834143_+	heme response regulator HssR	W8CYM9	Bacillus_phage	1.7e-119	92.7
BBB72136.1\|1834139_1835213_+	alkaline phosphatase synthesis sensor protein PhoR	W8CYF6	Bacillus_phage	2.3e-170	88.2
BBB72137.1\|1835237_1835825_-	hypothetical protein	NA	NA	NA	NA
BBB72138.1\|1836020_1836740_+	3-oxoacyl-[acyl-carrier-protein] reductase FabG	W8CYX9	Bacillus_phage	5.9e-61	100.0
BBB72139.1\|1837110_1837983_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.9e-66	45.9

DBSCAN-SWA_4

2146738 : 2153862

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB72479.1\|2146738_2147944_-	ribonuclease	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-51	47.4
BBB72480.1\|2148125_2149277_-	S-layer protein sap	NA	NA	NA	NA
BBB72481.1\|2149477_2150611_+	hypothetical protein	NA	NA	NA	NA
BBB72482.1\|2150642_2151107_-	Mrr restriction system protein	Q331T5	Clostridium_botulinum_C_phage	1.2e-14	43.2
BBB72483.1\|2151143_2151344_-	hypothetical protein	A0A288WG80	Bacillus_phage	9.0e-20	76.6
BBB72484.1\|2151509_2151812_+	hypothetical protein	A0A288WG38	Bacillus_phage	3.1e-24	51.5
BBB72485.1\|2151808_2151991_+	hypothetical protein	Q2I8E2	Bacillus_phage	2.4e-19	80.0
BBB72486.1\|2152109_2153300_+	DNA translocase FtsK	A0A288WFS1	Bacillus_phage	1.2e-148	64.4
BBB72487.1\|2153241_2153862_+	hypothetical protein	Q2LIA9	Bacillus_phage	1.5e-84	74.9

DBSCAN-SWA_5

3444730 : 3473914

Bacillus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB73828.1\|3444730_3445351_+	LexA repressor	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
BBB73829.1\|3445438_3446242_-	hypothetical protein	NA	NA	NA	NA
BBB73830.1\|3446245_3446788_-	hypothetical protein	NA	NA	NA	NA
BBB73831.1\|3446780_3447104_-	hypothetical protein	NA	NA	NA	NA
BBB73832.1\|3447840_3447990_-	hypothetical protein	NA	NA	NA	NA
BBB73833.1\|3447986_3449075_-	response regulator aspartate phosphatase I	A0A2H4J8G3	uncultured_Caudovirales_phage	6.0e-49	35.9
BBB73834.1\|3449439_3449667_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	6.2e-25	84.3
BBB73835.1\|3450378_3450711_+	hypothetical protein	A0A1C8E989	Bacillus_phage	4.1e-25	60.0
BBB73836.1\|3450739_3450832_+	hypothetical protein	A0A0S2MV85	Bacillus_phage	4.9e-05	80.0
BBB73837.1\|3450879_3451107_-	hypothetical protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	2.6e-31	96.0
BBB73838.1\|3451383_3451554_-	hypothetical protein	A0A2H4J852	uncultured_Caudovirales_phage	1.9e-10	89.3
BBB73839.1\|3451668_3452601_-	N-acetylmuramoyl-L-alanine amidase CwlA	A0A0S2MVR5	Bacillus_phage	8.2e-156	84.2
BBB73840.1\|3452600_3453026_-	hypothetical protein	A0A1B1P787	Bacillus_phage	1.8e-70	98.6
BBB73841.1\|3453137_3453413_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	6.8e-34	78.8
BBB73842.1\|3453430_3455437_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	5.6e-101	48.0
BBB73843.1\|3455512_3458164_-	hypothetical protein	H0USX5	Bacillus_phage	5.8e-223	73.8
BBB73844.1\|3458160_3459069_-	hypothetical protein	Q2LIB8	Bacillus_phage	4.5e-159	88.7
BBB73845.1\|3459131_3459641_-	hypothetical protein	A0A1B1P7W7	Bacillus_phage	6.4e-70	72.8
BBB73846.1\|3459682_3462067_-	hypothetical protein	D2XR26	Bacillus_phage	2.1e-09	60.3
BBB73847.1\|3462332_3463580_-	chromosome partition protein Smc	A0A2H4JAI2	uncultured_Caudovirales_phage	1.5e-181	83.8
BBB73848.1\|3463595_3463757_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	2.0e-22	94.3
BBB73849.1\|3463800_3464172_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	4.7e-46	73.9
BBB73850.1\|3464176_3464770_-	hypothetical protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.3e-92	84.1
BBB73851.1\|3464770_3465100_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.1e-46	81.7
BBB73852.1\|3465096_3465453_-	hypothetical protein	D2XR21	Bacillus_phage	2.7e-30	60.3
BBB73853.1\|3465445_3465745_-	hypothetical protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
BBB73854.1\|3465741_3466020_-	hypothetical protein	R9TMB7	Paenibacillus_phage	6.7e-21	58.4
BBB73855.1\|3466016_3466307_-	hypothetical protein	A6XMJ7	Bacillus_virus	4.8e-06	36.6
BBB73856.1\|3466343_3467507_-	hypothetical protein	H7BUQ0	unidentified_phage	3.2e-80	54.7
BBB73857.1\|3467520_3468105_-	hypothetical protein	A0A2I7SBY1	Paenibacillus_phage	1.0e-39	50.5
BBB73858.1\|3468070_3469282_-	hypothetical protein	J9QE83	Clostridium_phage	1.1e-139	60.7
BBB73859.1\|3469297_3470986_-	hypothetical protein	A0A290GJW3	Caldibacillus_phage	1.9e-251	73.0
BBB73860.1\|3470982_3471354_-	hypothetical protein	A0A2H4JA84	uncultured_Caudovirales_phage	3.3e-15	50.0
BBB73861.1\|3471519_3471816_-	hypothetical protein	R9TNN2	Paenibacillus_phage	2.7e-28	61.5
BBB73862.1\|3472147_3472309_+	hypothetical protein	NA	NA	NA	NA
BBB73863.1\|3472580_3473003_+	hypothetical protein	A0A1L2JY34	Aeribacillus_phage	6.8e-41	59.1
BBB73864.1\|3473089_3473515_-	hypothetical protein	NA	NA	NA	NA
BBB73865.1\|3473635_3473914_-	hypothetical protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8

DBSCAN-SWA_6

3486252 : 3497806

Bacillus_phage(68.42%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB73878.1\|3486252_3486537_-	hypothetical protein	A6M999	Geobacillus_virus	1.8e-34	72.0
BBB73879.1\|3486637_3486802_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.5e-09	55.6
BBB73880.1\|3486931_3487690_-	flavin-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.0e-79	62.1
BBB73881.1\|3487921_3488701_-	modification methylase HhaI	A0A0K2CYZ1	Paenibacillus_phage	3.6e-64	49.0
BBB73882.1\|3488715_3489288_-	hypothetical protein	A0A0A7AQI4	Bacillus_phage	3.4e-80	73.8
BBB73883.1\|3489507_3490137_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	1.3e-27	41.9
BBB73884.1\|3490133_3490304_-	hypothetical protein	NA	NA	NA	NA
BBB73885.1\|3490321_3491104_-	DNA replication protein DnaC	U5PWH5	Bacillus_phage	9.3e-36	38.4
BBB73886.1\|3491087_3491846_-	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	3.6e-61	54.9
BBB73887.1\|3491842_3492115_-	hypothetical protein	A0A0M4S680	Bacillus_phage	2.9e-37	82.0
BBB73888.1\|3492128_3492800_-	hypothetical protein	A0A1B1P7F0	Bacillus_phage	1.0e-27	45.8
BBB73889.1\|3492796_3493279_-	hypothetical protein	E5DV79	Deep-sea_thermophilic_phage	1.1e-34	48.1
BBB73890.1\|3493293_3493518_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	2.5e-10	61.1
BBB73891.1\|3493528_3493846_-	hypothetical protein	NA	NA	NA	NA
BBB73892.1\|3493835_3493997_-	hypothetical protein	NA	NA	NA	NA
BBB73893.1\|3493996_3494263_-	hypothetical protein	S5MC08	Brevibacillus_phage	1.1e-25	55.8
BBB73894.1\|3494371_3495100_-	hypothetical protein	A0A288WFT2	Bacillus_phage	3.1e-49	48.6
BBB73895.1\|3495096_3495297_-	hypothetical protein	A0A0C5AJQ3	Paenibacillus_phage	1.4e-09	52.6
BBB73896.1\|3495572_3495986_+	hypothetical protein	A0A0M4QX29	Bacillus_phage	5.1e-25	47.1
BBB73897.1\|3496008_3496437_+	metallopeptidase ImmA	Q9T201	Bacillus_phage	2.8e-34	55.1
BBB73898.1\|3496452_3496620_+	hypothetical protein	NA	NA	NA	NA
BBB73899.1\|3496661_3497132_+	hypothetical protein	A0A0S2SXS9	Bacillus_phage	3.5e-38	55.2
BBB73900.1\|3497176_3497806_+	tyrosine recombinase XerH	A0A0S2SXP1	Bacillus_phage	2.1e-54	60.3

DBSCAN-SWA_7

3570905 : 3636310

Bacillus_phage(21.43%)

coat,protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB73976.1\|3570905_3571448_-\|coat	spore coat protein E	NA	NA	NA	NA
BBB73977.1\|3571573_3572005_-	hypothetical protein	NA	NA	NA	NA
BBB73978.1\|3572008_3573538_-\|tRNA	tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase	NA	NA	NA	NA
BBB73979.1\|3573965_3574832_-	2-oxoglutarate oxidoreductase subunit KorB	NA	NA	NA	NA
BBB73980.1\|3574818_3576576_-	2-oxoglutarate oxidoreductase subunit KorA	NA	NA	NA	NA
BBB73981.1\|3576803_3577727_-	hypothetical protein	NA	NA	NA	NA
BBB73982.1\|3577786_3578047_-	stage V sporulation protein S	J9PTX7	Bacillus_phage	8.4e-10	43.8
BBB73983.1\|3578196_3578991_-	hypothetical protein	NA	NA	NA	NA
BBB73984.1\|3579156_3580719_-	ribonuclease Y	NA	NA	NA	NA
BBB73985.1\|3581201_3581627_-	protein RecA	A0A0S2MVG1	Bacillus_phage	2.7e-45	70.5
BBB73986.1\|3581933_3582560_-	protein RecA	A0A0S2MVG1	Bacillus_phage	1.6e-83	78.0
BBB73987.1\|3582704_3583943_-	putative competence-damage inducible protein	NA	NA	NA	NA
BBB73988.1\|3583963_3584542_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
BBB73989.1\|3584605_3585517_-	cytoskeleton protein RodZ	NA	NA	NA	NA
BBB73990.1\|3585538_3586324_-	hypothetical protein	NA	NA	NA	NA
BBB73991.1\|3586463_3586712_-	hypothetical protein	NA	NA	NA	NA
BBB73992.1\|3586787_3587501_-	3-oxoacyl-[acyl-carrier-protein] reductase FabG	NA	NA	NA	NA
BBB73993.1\|3587604_3588891_-\|protease	putative zinc protease AlbF	A0A2H4UVM3	Bodo_saltans_virus	2.9e-10	28.4
BBB73994.1\|3588891_3590166_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbE	A0A1X9I714	Streptococcus_phage	2.9e-55	29.6
BBB73995.1\|3590364_3591324_-	hypothetical protein	NA	NA	NA	NA
BBB73996.1\|3591324_3592074_-	D-allose transport system permease protein AlsC	NA	NA	NA	NA
BBB73997.1\|3592101_3592383_-	hypothetical protein	NA	NA	NA	NA
BBB73998.1\|3592375_3593908_-	galactose/methyl galactoside import ATP-binding protein MglA	Q9EMR9	Amsacta_moorei_entomopoxvirus	3.1e-11	26.6
BBB73999.1\|3594016_3595084_-	membrane lipoprotein TmpC	A0A0A7DN02	Lactobacillus_phage	1.1e-50	35.1
BBB74000.1\|3595173_3595899_-	putative transcriptional regulator of 2-aminoethylphosphonate degradation operons	NA	NA	NA	NA
BBB74001.1\|3596436_3598818_-	DNA translocase SpoIIIE	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
BBB74002.1\|3599029_3599233_-	hypothetical protein	NA	NA	NA	NA
BBB74003.1\|3599229_3599979_-	translocation-enhancing protein TepA	NA	NA	NA	NA
BBB74004.1\|3600083_3601754_-	ribonuclease J2	NA	NA	NA	NA
BBB74005.1\|3602519_3603398_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
BBB74006.1\|3603409_3604642_-	aspartokinase	NA	NA	NA	NA
BBB74007.1\|3604665_3605712_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
BBB74008.1\|3605862_3606462_-	dipicolinate synthase subunit B	NA	NA	NA	NA
BBB74009.1\|3606458_3607361_-	dipicolinate synthase subunit A	NA	NA	NA	NA
BBB74010.1\|3607635_3607887_-	hypothetical protein	NA	NA	NA	NA
BBB74011.1\|3608013_3609255_-\|protease	putative zinc protease	G3MBJ8	Bacillus_virus	4.4e-56	34.5
BBB74012.1\|3609341_3610241_-	peptidoglycan-N-acetylmuramic acid deacetylase PdaA	NA	NA	NA	NA
BBB74013.1\|3610392_3612531_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
BBB74014.1\|3612691_3612961_-	30S ribosomal protein S15	NA	NA	NA	NA
BBB74015.1\|3613061_3614033_-	riboflavin biosynthesis protein RibF	A0A1V0SD03	Indivirus	1.9e-06	33.6
BBB74016.1\|3614076_3615000_-\|tRNA	tRNA pseudouridine synthase B	NA	NA	NA	NA
BBB74017.1\|3615086_3615443_-	ribosome-binding factor A	NA	NA	NA	NA
BBB74018.1\|3615458_3615740_-	hypothetical protein	NA	NA	NA	NA
BBB74019.1\|3615736_3617797_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.2e-21	31.7
BBB74020.1\|3617801_3618113_-	putative ribosomal protein YlxQ	NA	NA	NA	NA
BBB74021.1\|3618113_3618386_-	hypothetical protein	NA	NA	NA	NA
BBB74022.1\|3618397_3619504_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
BBB74023.1\|3619521_3619992_-	ribosome maturation factor RimP	NA	NA	NA	NA
BBB74024.1\|3620324_3624626_-	DNA polymerase III PolC-type	A0A0A8WJ41	Clostridium_phage	3.1e-24	38.7
BBB74025.1\|3624750_3626451_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
BBB74026.1\|3626560_3627817_-\|protease	regulator of sigma-W protease RasP	NA	NA	NA	NA
BBB74027.1\|3627833_3628976_-	1-deoxy-D-xylulose 5-phosphate reductoisomerase	NA	NA	NA	NA
BBB74028.1\|3628999_3629791_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
BBB74029.1\|3629808_3630585_-	ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	4.0e-23	43.1
BBB74030.1\|3630670_3631228_-	ribosome-recycling factor	NA	NA	NA	NA
BBB74031.1\|3631230_3631953_-	uridylate kinase	NA	NA	NA	NA
BBB74032.1\|3632019_3632907_-	elongation factor Ts	NA	NA	NA	NA
BBB74033.1\|3633010_3633712_-	30S ribosomal protein S2	NA	NA	NA	NA
BBB74034.1\|3634061_3634841_-	GTP-sensing transcriptional pleiotropic repressor CodY	NA	NA	NA	NA
BBB74035.1\|3634918_3636310_-\|protease	ATP-dependent protease ATPase subunit ClpY	A0A173GFL6	Erwinia_phage	2.5e-47	29.8

DBSCAN-SWA_8

3734911 : 3778531

Bacillus_phage(96.23%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB74128.1\|3734911_3735418_-	prespore-specific transcriptional regulator RsfA	G3MB11	Bacillus_virus	3.0e-11	34.7
BBB74129.1\|3735547_3735721_-	50S ribosomal protein L32	NA	NA	NA	NA
BBB74130.1\|3735782_3736283_-	hypothetical protein	NA	NA	NA	NA
BBB74131.1\|3736699_3737296_+	hypothetical protein	A0A0U3TZ58	Bacillus_phage	1.4e-68	74.2
BBB74132.1\|3737328_3737952_-	hypothetical protein	H0USY2	Bacillus_phage	1.1e-98	83.4
BBB74133.1\|3737893_3739075_-	DNA translocase FtsK	H0USY1	Bacillus_phage	2.5e-186	81.4
BBB74134.1\|3739190_3739373_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.8e-22	90.0
BBB74135.1\|3739375_3739678_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.3e-49	97.0
BBB74136.1\|3739861_3740068_+	hypothetical protein	Q2I8E4	Bacillus_phage	3.2e-20	72.1
BBB74137.1\|3740071_3740254_+	hypothetical protein	A0A288WFV9	Bacillus_phage	1.3e-12	81.6
BBB74138.1\|3740259_3740841_+	hypothetical protein	H0USX9	Bacillus_phage	7.3e-102	93.2
BBB74139.1\|3740904_3741609_-	N-acetylmuramoyl-L-alanine amidase CwlA	Q2I8E6	Bacillus_phage	1.4e-112	82.9
BBB74140.1\|3741608_3742034_-	hypothetical protein	A0A1B1P787	Bacillus_phage	7.5e-72	99.3
BBB74141.1\|3742038_3743007_-	tyrosine recombinase XerC	D2XR30	Bacillus_phage	1.5e-168	91.2
BBB74142.1\|3743162_3743438_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	2.2e-32	77.4
BBB74143.1\|3743462_3745568_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	4.5e-186	59.0
BBB74144.1\|3745564_3747547_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	4.5e-268	76.9
BBB74145.1\|3747543_3749025_-	hypothetical protein	A0A1B1P7W7	Bacillus_phage	4.4e-260	86.8
BBB74146.1\|3749061_3749673_-	hypothetical protein	A0A1B1P7S6	Bacillus_phage	3.8e-109	96.6
BBB74147.1\|3749738_3754076_-	chromosome partition protein Smc	A0A1B1P7S6	Bacillus_phage	0.0e+00	98.4
BBB74148.1\|3754091_3754232_-	hypothetical protein	A0A1B1P7R9	Bacillus_phage	3.8e-17	93.5
BBB74149.1\|3754233_3754680_-	hypothetical protein	A0A1B1P7S9	Bacillus_phage	1.5e-51	81.2
BBB74150.1\|3754703_3755288_-	hypothetical protein	A0A1B1P7S4	Bacillus_phage	8.3e-106	99.0
BBB74151.1\|3755301_3755661_-	hypothetical protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
BBB74152.1\|3755657_3756095_-	hypothetical protein	A0A1B1P7R6	Bacillus_phage	2.3e-76	98.6
BBB74153.1\|3756082_3756439_-	hypothetical protein	A0A1B1P8G2	Bacillus_phage	5.9e-62	98.3
BBB74154.1\|3756416_3756692_-	hypothetical protein	A0A1B1P7Q8	Bacillus_phage	2.3e-42	97.8
BBB74155.1\|3756700_3756901_-	chitinase C	NA	NA	NA	NA
BBB74156.1\|3756977_3758165_-	hypothetical protein	A0A1B1P7R4	Bacillus_phage	2.0e-207	94.4
BBB74157.1\|3758161_3758917_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A0U3U021	Bacillus_phage	2.1e-133	95.6
BBB74158.1\|3758894_3760109_-	hypothetical protein	A0A0U3SQF0	Bacillus_phage	3.1e-219	92.6
BBB74159.1\|3760124_3761900_-	hypothetical protein	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.0
BBB74160.1\|3761877_3762246_-	hypothetical protein	A0A0U3ULP7	Bacillus_phage	5.9e-65	100.0
BBB74161.1\|3762419_3762782_-	hypothetical protein	A0A1B1P8D2	Bacillus_phage	3.0e-61	94.2
BBB74162.1\|3762774_3762990_-	hypothetical protein	NA	NA	NA	NA
BBB74163.1\|3763377_3764199_-	hypothetical protein	NA	NA	NA	NA
BBB74164.1\|3764472_3765015_-	tyrosine recombinase XerC	A0A1B1P746	Bacillus_phage	3.3e-88	88.9
BBB74165.1\|3765011_3765482_-	hypothetical protein	A0A1B1P744	Bacillus_phage	2.9e-48	62.5
BBB74166.1\|3765502_3765673_-	hypothetical protein	A0A1B1P735	Bacillus_phage	1.4e-05	85.7
BBB74167.1\|3765787_3765910_-	hypothetical protein	NA	NA	NA	NA
BBB74168.1\|3765927_3766257_-	hypothetical protein	NA	NA	NA	NA
BBB74169.1\|3766290_3766647_-	hypothetical protein	NA	NA	NA	NA
BBB74170.1\|3766664_3766913_-	hypothetical protein	A0A0S2MV80	Bacillus_phage	2.0e-37	95.1
BBB74171.1\|3767032_3767311_-	hypothetical protein	NA	NA	NA	NA
BBB74172.1\|3767347_3767554_-	hypothetical protein	NA	NA	NA	NA
BBB74173.1\|3768297_3768804_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	3.5e-84	85.7
BBB74174.1\|3769140_3769560_+	metallothiol transferase FosB 2	Q2LI91	Bacillus_phage	4.0e-62	95.2
BBB74175.1\|3769606_3770017_-	hypothetical protein	Q2LI92	Bacillus_phage	3.1e-75	100.0
BBB74176.1\|3770439_3770886_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1B1P7U8	Bacillus_phage	1.9e-70	90.5
BBB74177.1\|3770952_3771147_-	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.0e-28	98.4
BBB74178.1\|3771130_3771274_-	hypothetical protein	A0A1B1P7V2	Bacillus_phage	2.1e-18	100.0
BBB74179.1\|3771282_3772227_-	RNA polymerase sigma-F factor	A0A0U3TKA0	Bacillus_phage	3.1e-171	99.4
BBB74180.1\|3772265_3772553_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.5e-44	100.0
BBB74181.1\|3772565_3772820_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	3.1e-41	97.6
BBB74182.1\|3772834_3773008_-	hypothetical protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	98.2
BBB74183.1\|3773033_3773228_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.4e-30	95.3
BBB74184.1\|3773243_3774071_-	primosomal protein DnaI	A0A1B1P7U2	Bacillus_phage	4.0e-146	99.3
BBB74185.1\|3774015_3774732_-	hypothetical protein	A0A1B1P7T6	Bacillus_phage	1.6e-106	93.1
BBB74186.1\|3774736_3774913_-	hypothetical protein	A0A0U3SQC4	Bacillus_phage	2.6e-23	87.9
BBB74187.1\|3774942_3775107_-	hypothetical protein	A0A0U3B230	Bacillus_phage	2.3e-21	90.7
BBB74188.1\|3775163_3775364_-	hypothetical protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
BBB74189.1\|3775415_3775643_-	hypothetical protein	NA	NA	NA	NA
BBB74190.1\|3775861_3776230_+	HTH-type transcriptional regulator ImmR	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
BBB74191.1\|3776273_3776372_-	hypothetical protein	NA	NA	NA	NA
BBB74192.1\|3776491_3776641_-	hypothetical protein	NA	NA	NA	NA
BBB74193.1\|3776653_3777751_-	hypothetical protein	NA	NA	NA	NA
BBB74194.1\|3778186_3778531_+	HTH-type transcriptional regulator ImmR	A0A1B1P888	Bacillus_phage	9.5e-17	38.4

DBSCAN-SWA_9

4841539 : 4851418

Staphylococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB75359.1\|4841539_4843111_+	hypothetical protein	W5RV59	Staphylococcus_phage	1.5e-48	25.4
BBB75360.1\|4843110_4843296_+	hypothetical protein	NA	NA	NA	NA
BBB75361.1\|4844070_4845381_+	hypothetical protein	A0A060AFC9	Staphylococcus_phage	1.8e-71	37.7
BBB75362.1\|4845352_4845850_+	hypothetical protein	A0A060AB24	Staphylococcus_phage	5.2e-40	52.5
BBB75363.1\|4845909_4846950_+	hypothetical protein	A0A1G5SCB8	Enterococcus_phage	1.3e-45	37.6
BBB75364.1\|4847036_4848017_+	hypothetical protein	A0A1I9KK60	Lactobacillus_phage	4.5e-11	26.4
BBB75365.1\|4848084_4848951_-	hypothetical protein	NA	NA	NA	NA
BBB75366.1\|4849073_4849979_-	tyrosine recombinase XerD	A0A1B1IQT7	uncultured_Mediterranean_phage	7.8e-18	27.1
BBB75367.1\|4850122_4851418_-	enolase	A0A1X9I5Z8	Streptococcus_phage	6.4e-183	75.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. AP018445

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018445_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018445_1

34178-34498

Orphan

Consensus_repeat	Method
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA	PILER-CR

3 spacers

The CRISPR arrays of AP018445_1

>merge|AP018445|1|34178-34498|PILER-CR
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAATTTTTCTTTTTCCATCTCTCTCTCTTCTATTATATTAAACGTACAATCTTTTAATTTACACATGTGTACATTTACACATGTGTAAATGTACACAACAAAAAAACTATAATCCCTATAAACACTGGTCTGAATCATTTCAACACGAAATTTGTGTAAATGTGTAAATGTGTAAATGTGTAAATGTGTAAAATATACATTGATGTTGGATTGCTTAAGGTATATAATGGATTTATAGGTAATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA

>AP018445|1|1|34178-34498|PILER-CR
AATTTACACATGTGTAAATGTGTAAATGTGTAAATGTGTAAA	TTTTTCTTTTTCCATCTCTCTCTCTTCTATTATATTAAACGTACAATCTTTT
AATTTACACATGTGTACATTTACACATGTGTAAATGTACACA	ACAAAAAAACTATAATCCCTATAAACACTGGTCTGAATCATTTCAACACGAAATTTGTGTAAATGTG
TAAATGTGTAAATGTGTAAATGTGTAAAATATACATTGATGT	TGGATTGCTTAAGGTATATAATGGATTTATAGGTAATTTACACATGTG
TAAATGTGTAAATGTGTAAATGTGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
AP018445.1\|BBB75950.1\|26846_27062_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75961.1\|35980_36214_+\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75965.1\|39644_39803_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222853
AP018445.1\|BBB75967.1\|40494_40824_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75966.1\|40278_40476_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75968.1\|41406_41718_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|105987
AP018445.1\|BBB75963.1\|38858_39017_+\|N-acetylmuramoyl-L-alanine-amidase-AmiB	unknown	unknown	gnl\|CDD\|119407
AP018445.1\|BBB75959.1\|34528_35395_+\|sporulation-initiation-inhibitor-protein-Soj	unknown	unknown	gnl\|CDD\|224113
AP018445.1\|BBB75956.1\|31120_31894_-\|RNA-binding-protein-Hfq	unknown	unknown	unknown
AP018445.1\|BBB75954.1\|29391_30243_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75953.1\|29240_29423_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75957.1\|32087_33626_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378031
AP018445.1\|BBB75962.1\|37422_38658_+\|S-layer-protein-sap	unknown	unknown	gnl\|CDD\|119407
AP018445.1\|BBB75948.1\|26067_26184_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75952.1\|28061_28364_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
AP018445.1\|BBB75951.1\|27024_27555_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75960.1\|35387_35774_+\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75964.1\|39257_39635_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366234
AP018445.1\|BBB75955.1\|30239_30608_-\|hypothetical-protein	unknown	unknown	unknown
AP018445.1\|BBB75949.1\|26261_26750_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340346

Protein	Function_ID	Function_description	E-value
AP018445.1\|BBB75957.1\|32087_33626_-\|hypothetical-protein	gnl\|CDD\|378031	pfam08708, PriCT_1, Primase C terminal 1 (PriCT-1). This alpha helical domain is found at the C terminal of primases.	3.78357e-09
AP018445.1\|BBB75965.1\|39644_39803_-\|hypothetical-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	0.000102979
AP018445.1\|BBB75962.1\|37422_38658_+\|S-layer-protein-sap	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	1.11237e-09
AP018445.1\|BBB75952.1\|28061_28364_-\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	8.56948e-35
AP018445.1\|BBB75963.1\|38858_39017_+\|N-acetylmuramoyl-L-alanine-amidase-AmiB	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	6.08463e-15
AP018445.1\|BBB75968.1\|41406_41718_-\|hypothetical-protein	gnl\|CDD\|105987	PRK12856, PRK12856, hypothetical protein; Provisional.	9.6017e-48
AP018445.1\|BBB75959.1\|34528_35395_+\|sporulation-initiation-inhibitor-protein-Soj	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	4.13842e-44
AP018445.1\|BBB75964.1\|39257_39635_-\|hypothetical-protein	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.44767e-22
AP018445.1\|BBB75949.1\|26261_26750_-\|hypothetical-protein	gnl\|CDD\|340346	pfam17631, DUF5512, Family of unknown function (DUF5512). This is a family of unknown function found in Bacillus.	2.236e-90

>AP018445.1|BBB75957.1|32087_33626_-|hypothetical-protein
MNTVQKAIELILHKGLRKYKSKNSKAGLVSIANQEKFESKVLNGKKNKKGSIFITRKKEDLRAKFGTRGVVLSSEEAVLDHVGQASHWTPNVYNFGTYGQNGLRTIVGHTEKNLQQINCFVIDIDSKSFPMTAINDVALNAGFGVPTMILETTKGYQVYYVLDKAVYVSNNKNFIAIKSAKRISQNLREMFADSLPNVDLTCNHFGFFRMPSVQNIVMFFEENVYTFKELQEWSKRQDDNKGNEQFHNVIESPFAKNAPVEQPKQMDELWFKQVISCTNVSPKQTKAGRNNAIFTLSLACFQSQYAIKDTMDLMDQFNSNLEQPLEHTEVRGIVMSAYSGKYQAAHKDYIERLLQTYGMGQASAFRAPSVLWKKHKKQRKDRVRSHWHEWEADIITFLSMNSNNKPVLYFTQSELCEALNVPRSTLNTVLKKSTKIYKTVEGKGKTAKTGLSTLGMLIAFALKENGKRRESYLNYLQGLFPKTGNILEQAKTSNVMEEQETLYGILEGLPAG
>AP018445.1|BBB75956.1|31120_31894_-|RNA-binding-protein-Hfq
MLKLGKNYPIDRDSRGRYRHSYVFMRGANVEVKLLNHEELLKGKITTIEEYYCVLDVEGTSGSYQVTVNFSEVKYIKHEEFPTVEERSPKYSKGDKKTSFVFKIGEKIGCVFKDGKGIKGTLLSEDAYYLYVKSEKENYYTIMKGALSYIAHVKHEPLLLTNDFYTEEMKLADYKKPTEYVFSVGDTITVYFPSGKNVSGVVLDESKYWVLLQTEKRQITIFKGSYSYFKHETYETKAYLYVENRKLRKQLRSGDTN
>AP018445.1|BBB75955.1|30239_30608_-|hypothetical-protein
MNLKQNENVESKKTLTKFLGSLIDTIDFQRRSQGDLAKEMGVAGGTLSKNLTGKTQFGFWTLVKLLNILYDDINKRQEMLYTFCSVTTSKINLRIAMEYANAKGDLGLLKLIVDREKILLWQ
>AP018445.1|BBB75954.1|29391_30243_-|hypothetical-protein
MNREWAYAYELVWMRSCGILQGKALLDELEERKKRKIIKTEEIKVLYGILTFYTMYDLEKFNSLFDYAEVMQPNIELITDEFVRTAYSGRIKEGLSYAYLMQDNIDKSREICHEILNFKDDKNCFSLLRASALVYLAESYTFESYERASWYINKSLETLELCQSERANRRKENVLNTYAFIKLVNRQGLDSISIYHPAEESFFEIVKGNYKKAEIILNNIKNENGSLKPIEYCYLGLATNDITLLEKSIELFECEGNRFYCKFPKKMLVNLSKNGTMCEGGAK
>AP018445.1|BBB75953.1|29240_29423_-|hypothetical-protein
MVQCVRVVQNEKIIFVVTSIALVAGIMFATASNKDQSNNIVKKDSEKLVAKMVGPGGGMG
>AP018445.1|BBB75952.1|28061_28364_-|hypothetical-protein
MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNGNLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK
>AP018445.1|BBB75951.1|27024_27555_-|hypothetical-protein
MSMEYQERYVRKVATILSSKTKHTTGCLIEGESDVCLEFQIELINALQDNHGLVYHLDFNDYTSETDCLAALKKARKQLRSNKQDGKTLFLSLASFERVEKKTMDAVKILIGSRSLGINLVVSANKRFVHLVGLTEYLVTMNKSDVVLSELYRYSTQKILASLKNENVSWGEANES
>AP018445.1|BBB75950.1|26846_27062_-|hypothetical-protein
MKMYHGGKQMNHKVEKILRTKSIHVDLFELDEKYDLGQKIDVCCNKMNVIHTFKVFNITLLRGNHWLVHLQ
>AP018445.1|BBB75949.1|26261_26750_-|hypothetical-protein
MCKRFKFLLAVSALFISITVVLAGCGGSSVPYKKDDTYKDSKDNFITITAENEWRVKGSQNSEANYKVESTEYKGDSHSVVAISVKEKINGSDPLLVVNDYHYYILSPRENGFSLTPIGTSHPNSAQWKEFQEGFKGANDKEEFLKKEVANVNKQNIFKKTN
>AP018445.1|BBB75948.1|26067_26184_-|hypothetical-protein
MLGQNRLIFPAMIIVMMVLLVVFDLLLSFIISFTEKLV
>AP018445.1|BBB75959.1|34528_35395_+|sporulation-initiation-inhibitor-protein-Soj
MEHKRPLTITVANSKGGVGKSTIVRHLSYHLALKGYKVLTADMDPQANTTKTMILTRKRVNDEYFAFDKTLMRAVQDGSLENMQLNIIENLDLLPSHSDFENFESLLTSKFGHAETSDPNYHEIETNKINYFRNLLEPLKQNYDFIIIDSPPTASYYTKSSAMASDYVLVAFQTQSDSLDGANDYITRFLARLVEEYNAQLDVVGILPNQLHSAGKIDTTVLQDAKDIFGENNLFKNLIPYAKRIQSVPRIGLNVDQYWDKKLFNEVFEPFTDEFLERINKMEELRNE
>AP018445.1|BBB75960.1|35387_35774_+|hypothetical-protein
MSNEQGKGMGFFGNKGKPASEKKDEKKTKLDLDYKPDLNPSTPYDPTLPVKATLVNGDKRGTLRIPLETKHEFDALLEISEYQYTYELLGEMLDTWMKKLTPEQLRLFHASLENIKRKAAIKEAKKKK
>AP018445.1|BBB75961.1|35980_36214_+|hypothetical-protein
MRTLIIITLVVIGLVFFNVISLHTIGTLAAIIGVIIAIALGAYFLYRLALGFFALFATFIGVILVICLITYAVTNLV
>AP018445.1|BBB75962.1|37422_38658_+|S-layer-protein-sap
MNTKGIIAKLTAGALIANLLICPANTSAEKKTFTDVPNWAQQSVNYLMKKALDGKPDGTFSPSEKIDRGSAAKLMAMVLGLQINKQAKPSFQDAKNHWASPYIAAVEKAGVIYGDGSGNFNPSKDIDRASMASMLVEAYKLNNRIIGDLPTQFEDLKGHWGAKLANALVALGISKGTGDGWKPNGIVTRAEAVQFIAQTDMKKADTSKRMYMNRHFITYHQPSLSSGVTSNQHAPQIIVVKEQRADGWIKIVTNIGDKWTPLYEKRETIHSTFTTYPEASHSSKVLGTHSPQTVTVIEEKGSWIRIRTNASFQWLDKNQLTLPKKQNNFLEGKTIIIDPGHGGIDGGHKGIYMNESPVVYDTAVRVQKLFAQKTPFTALLTRDAYSRPGKNATDSLGKRVEFAKKIKGIYL
>AP018445.1|BBB75963.1|38858_39017_+|N-acetylmuramoyl-L-alanine-amidase-AmiB
MPSVLTELGFVDNKADGKKLDSPEWRQRAAEAIYAGILDYYEWKGHNMSAYY
>AP018445.1|BBB75964.1|39257_39635_-|hypothetical-protein
MYLSTIMDDFNREIISYVINESQNLTLVMKTVKQVMRGRKVKDAILHLDQGSIYTAKEFQVYAKQNGIITSMSRKGNCHDNAFMESFFSHLKSEAFYSQKVTKVSNTTVRIQEKLNHLSLKEFRE
>AP018445.1|BBB75965.1|39644_39803_-|hypothetical-protein
MKQYHILSKVCRQKKKYMNGAEAVIAPHRLERQFEASVPNEKRFTDVTYLLF
>AP018445.1|BBB75966.1|40278_40476_-|hypothetical-protein
MKNDRIGNLAVSFADSLLFIQVYPFHKQKLEQRKYDEYGIRIIFCTGACLYISHHFYREICGNGE
>AP018445.1|BBB75967.1|40494_40824_-|hypothetical-protein
MRGVVNQNVLHHIGYEVLQETFVLIRNVFSYSNQGEYSVTYVREIADALYNIPHSIQKQHDTFLEFEFKLLEETLMQMEFGKVAAQNIPHFRMYAARVQQLLRKRYKEV
>AP018445.1|BBB75968.1|41406_41718_-|hypothetical-protein
MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGGRAGAYESKLKEARDIAMDEMKELAKQKGVNAIVGIDVDYAIIRAGMLMVAVSGTAVRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69555-69606	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	289-340	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66280-66331	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	174-225	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39240-39291	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35254-35305	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32655-32706	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34219-34270	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34560-34611	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64427-64478	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70212-70263	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34220-34271	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22497-22548	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35262-35313	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34219-34270	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34386-34437	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9737-9788	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34146-34197	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34154-34205	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34215-34266	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34219-34270	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34709-34760	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34219-34270	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41067-41118	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34219-34270	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56733-56784	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19196-19247	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53509-53560	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61820-61871	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31401-31452	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68494-68545	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34218-34269	0	1.0
AP018445_1	1.1\|34220\|52\|AP018445\|PILER-CR	34220-34271	52	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34147-34198	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34191-34238	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32844-32891	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34408-34455	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64616-64663	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34409-34456	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35451-35498	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34408-34455	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34575-34622	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34404-34451	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34408-34455	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34898-34945	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34409-34456	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41256-41303	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34408-34455	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56922-56969	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53698-53745	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	62009-62056	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	104-151	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66095-66142	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68683-68730	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39055-39102	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34407-34454	0	1.0
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35443-35490	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34749-34796	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70401-70448	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22686-22733	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9926-9973	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34335-34382	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34343-34390	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19385-19432	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69370-69417	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31590-31637	1	0.979
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34336-34383	1	0.979
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	69451-69517	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	185-251	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	66176-66242	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	70-136	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	39136-39202	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	35343-35409	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	32744-32810	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	34308-34374	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	34649-34715	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	64516-64582	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	70301-70367	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	34309-34375	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	22586-22652	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	35351-35417	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	34308-34374	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	34475-34541	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	9826-9892	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	34235-34301	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	34243-34309	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	34304-34370	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	34308-34374	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	34798-34864	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	41156-41222	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	34308-34374	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	56822-56888	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	19285-19351	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	53598-53664	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	61909-61975	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	31490-31556	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	68583-68649	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	34307-34373	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	34236-34302	7	0.896
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	34091-34157	9	0.866
AP018445_1	1.2\|34314\|67\|AP018445\|PILER-CR	34314-34380	67	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	34309-34375	9	0.866
AP018445_1	1.3\|34423\|48\|AP018445\|PILER-CR	34423-34470	48	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	1-36	12	0.75

1. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

2. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

3. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

4. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

5. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

6. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

7. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

8. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

9. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

10. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

11. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

12. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

13. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

14. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

15. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

16. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

17. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

18. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

19. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

20. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

21. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

22. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

23. spacer 1.1|34220|52|AP018445|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

24. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

25. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

26. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

27. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

28. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

29. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

30. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

31. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

32. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

33. spacer 1.1|34220|52|AP018445|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	CRISPR spacer
tttttctttttccatctctctctcttctattatattaaacgtacaatctttt	Protospacer
****************************************************

34. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

35. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

36. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

37. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

38. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

39. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

40. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

41. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

42. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

43. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

44. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

45. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

46. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

47. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

48. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

49. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

50. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

51. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

52. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

53. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

54. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

55. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 0, identity: 1.0

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataatggatttataggt	Protospacer
************************************************

56. spacer 1.3|34423|48|AP018445|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

57. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

58. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

59. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

60. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

61. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

62. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

63. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

64. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

65. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

66. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 1, identity: 0.979

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattacttaaggtatataatggatttataggt	Protospacer
********************.***************************

67. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

68. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

69. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

70. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

71. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

72. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

73. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

74. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

75. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

76. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

77. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

78. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

79. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

80. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

81. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

82. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

83. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

84. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

85. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

86. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

87. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

88. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

89. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

90. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

91. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

92. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

93. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

94. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

95. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

96. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

97. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

98. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 7, identity: 0.896

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	Protospacer
************************************************************

99. spacer 1.2|34314|67|AP018445|PILER-CR matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.866

acacaacaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaatt	CRISPR spacer
acccaacaaaaaaactataatccctataaacactggtttgaatcatttcaacacgaaatt	Protospacer
** **********************************.**********************

100. spacer 1.2|34314|67|AP018445|PILER-CR matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 9, identity: 0.866

acacaac-aaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaat	CRISPR spacer
-cacaacaaaaaaaactataatccctataaacactggtctgaatcatttcaacacgaaat	Protospacer
 ****** ****************************************************

101. spacer 1.3|34423|48|AP018445|PILER-CR matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 12, identity: 0.75

atatacattgatgttggattgcttaaggtatataatggatttataggt	CRISPR spacer
atatacattgatgttggattgcttaaggtatataat------------	Protospacer
************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. AP018444

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

160207 : 164212

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBB75890.1\|160207_161440_+	ribonuclease	A0A2H4J389	uncultured_Caudovirales_phage	8.0e-66	58.9
BBB75891.1\|161452_161905_+	hypothetical protein	NA	NA	NA	NA
BBB75892.1\|162026_162242_-	hypothetical protein	A0A2I6AZV9	Macacine_betaherpesvirus	1.7e-11	56.5
BBB75893.1\|162205_162886_-	hypothetical protein	A0A1B1P773	Bacillus_phage	5.4e-24	40.1
BBB75894.1\|162870_163191_-	hypothetical protein	A0A0N7GFG6	Staphylococcus_phage	3.1e-22	51.5
BBB75895.1\|163298_163604_+	hypothetical protein	A0A0N7GFG6	Staphylococcus_phage	6.6e-22	52.6
BBB75896.1\|163570_164212_+	hypothetical protein	A0A1B1P773	Bacillus_phage	9.0e-29	39.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. AP018443

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. AP018445

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. AP018444

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection