CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP028798	Acinetobacter junii strain WCHAJ59 plasmid p1_010059, complete sequence	0 crisprs	NA	0	1
CP028799	Acinetobacter junii strain WCHAJ59 plasmid p2_010059, complete sequence	0 crisprs	NA	0	0
CP028800	Acinetobacter junii strain WCHAJ59 chromosome, complete genome	1 crisprs	TnsE_C,csa3,RT,cas3,DEDDh,WYL,PrimPol	1	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP028800_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028800_2

1612481-1612632

Orphan

Consensus_repeat	Method
CTTACAAGAATGATCATCACCAAATAGGGCAACAACACCACCATGTTCGGCTGTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028800_2

>merge|CP028800|2|1612481-1612632|CRISPRCasFinder
CTTACAAGAATGATCATCACCAAATAGGGCAACAACACCACCATGTTCGGCTGTAACCCATCATCACATGTTCAGACTGGTGCGGAACAGTAGAAGACTTACAAGAATGATCATCACCAAATAGGGCAACAACACCACCATGTTCGGCTGTA

>CP028800|2|1|1612481-1612632|CRISPRCasFinder
CTTACAAGAATGATCATCACCAAATAGGGCAACAACACCACCATGTTCGGCTGTA	ACCCATCATCACATGTTCAGACTGGTGCGGAACAGTAGAAGA
CTTACAAGAATGATCATCACCAAATAGGGCAACAACACCACCATGTTCGGCTGTA

Protein	Signature genes	Signature genes Name	Protein_function
CP028800.1\|AWA47914.1\|1606515_1608711_+\|OsmC-domain/YcaO-domain-containing-protein	unknown	unknown	gnl\|CDD\|132588
CP028800.1\|AWA49463.1\|1624448_1625735_+\|DcaP-like-protein	unknown	unknown	unknown
CP028800.1\|AWA47907.1\|1598398_1599415_-\|NADH-oxidase	unknown	unknown	gnl\|CDD\|99805
CP028800.1\|AWA47912.1\|1602823_1603939_-\|muconate-cycloisomerase	unknown	unknown	gnl\|CDD\|162905
CP028800.1\|AWA47905.1\|1596338_1597556_-\|benzoate-transporter	unknown	unknown	gnl\|CDD\|129923
CP028800.1\|AWA47910.1\|1601456_1602377_-\|catechol-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|274134
CP028800.1\|AWA47913.1\|1604050_1604983_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176136
CP028800.1\|AWA47915.1\|1614319_1615222_-\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|163676
CP028800.1\|AWA47922.1\|1623463_1624165_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
CP028800.1\|AWA47918.1\|1618034_1619636_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
CP028800.1\|AWA47916.1\|1615218_1617210_-\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	unknown	unknown	gnl\|CDD\|227111
CP028800.1\|AWA47917.1\|1617221_1618025_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235664
CP028800.1\|AWA47908.1\|1599485_1599986_-\|benzoate-1,2-dioxygenase-small-subunit	unknown	unknown	gnl\|CDD\|132276
CP028800.1\|AWA47911.1\|1602520_1602811_-\|muconolactone-delta-isomerase	unknown	unknown	gnl\|CDD\|213786
CP028800.1\|AWA47919.1\|1619660_1620833_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
CP028800.1\|AWA47920.1\|1620978_1621596_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP028800.1\|AWA47909.1\|1599997_1601374_-\|benzoate-1,2-dioxygenase-large-subunit	unknown	unknown	gnl\|CDD\|132273
CP028800.1\|AWA47921.1\|1621704_1623420_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
CP028800.1\|AWA47906.1\|1597595_1598381_-\|1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate-dehydrogenase	unknown	unknown	gnl\|CDD\|183772
CP028800.1\|AWA49462.1\|1613263_1614220_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114

Protein	Function_ID	Function_description	E-value
CP028800.1\|AWA47914.1\|1606515_1608711_+\|OsmC-domain/YcaO-domain-containing-protein	gnl\|CDD\|132588	TIGR03549, TIGR03549, YcaO domain protein. This family consists of remarkably well-conserved proteins from gamma and beta Proteobacteria, heavily skewed towards organisms of marine environments. Its gene neighborhood is not conserved. This family has an OsmC-like N-terminal domain. It shares a YcaO domain, frequently associated with ATP-dependent cyclodehydration for peptide modification. The function is unknown. Fifteen of the first sixteen members of this family are from selenouridine-positive genomes, but this correlation may not be meaningful.	0
CP028800.1\|AWA47907.1\|1598398_1599415_-\|NADH-oxidase	gnl\|CDD\|99805	cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain. In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.	9.77217e-134
CP028800.1\|AWA47912.1\|1602823_1603939_-\|muconate-cycloisomerase	gnl\|CDD\|162905	TIGR02534, Muconate_cycloisomerase_1-2, muconate and chloromuconate cycloisomerases. This model encompasses muconate cycloisomerase (EC 5.5.1.1) and chloromuconate cycloisomerase (EC 5.5.1.7), enzymes that often overlap in specificity. It excludes more distantly related proteins such as mandelate racemase (5.1.2.2).	0
CP028800.1\|AWA47905.1\|1596338_1597556_-\|benzoate-transporter	gnl\|CDD\|129923	TIGR00843, Benzoate_membrane_transport_protein, benzoate transporter. The benzoate transporter family contains only a single characterised member, the benzoate transporter of Acinetobacter calcoaceticus, which functions as a benzoate/proton symporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.01749e-174
CP028800.1\|AWA47910.1\|1601456_1602377_-\|catechol-1,2-dioxygenase	gnl\|CDD\|274134	TIGR02439, Catechol_12-dioxygenase_1, catechol 1,2-dioxygenase, proteobacterial. Members of this family known so far are catechol 1,2-dioxygenases of the Proteobacteria. They are distinct from catechol 1,2-dioxygenases and chlorocatechol 1,2-dioxygenases of the Actinobacteria, which are quite similar to each other and resolved by separate models. This enzyme catalyzes intradiol cleavage in which catechol + O2 becomes cis,cis-muconate. Catechol is an intermediate in the catabolism of many different aromatic compounds, as is the alternative intermediate protocatechuate. In Acinetobacter lwoffii, two isozymes are present with abilities, differing somewhat, to act on catechol analogs 3-methylcatechol, 4-methylcatechol, 4-methoxycatechol, and 4-chlorocatechol. [Energy metabolism, Other].	5.70847e-178
CP028800.1\|AWA47913.1\|1604050_1604983_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176136	cd08445, PBP2_BenM_CatM_CatR, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes of the ortho-pathway required for benzoate catabolism: muconate lactonizing enzyme I, muconolactone isomerase, and catechol 1,2-dioxygenase. CatR normally responds to benzoate and cis,cis-muconate, an inducer molecule, to activate transcription of the catBCA operon, whose gene products convert benzoate to catechol. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.95348e-95
CP028800.1\|AWA47915.1\|1614319_1615222_-\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|163676	cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain. 3-hydroxy-3-methylglutaryl-CoA lyase (HMGL) catalyzes the cleavage of HMG-CoA to acetyl-CoA and acetoacetate, one of the terminal steps in ketone body generation and leucine degradation, and is a key enzyme in the pathway that supplies metabolic fuel to extrahepatic tissues. Mutations in HMGL cause a human autosomal recessive disorder called primary metabolic aciduria that affects ketogenesis and leucine catabolism and can be fatal due to an inability to tolerate hypoglycemia. HMGL has a TIM barrel domain with a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. The cleavage of HMG-CoA requires the presence of a divalent cation like Mg2+ or Mn2+, and the reaction is thought to involve general acid/base catalysis. This family belongs to the DRE-TIM metallolyase superfamily. DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC. These members all share a conserved triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices. The domain has a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. In addition, the catalytic site includes three invariant residues - an aspartate (D), an arginine (R), and a glutamate (E) - which is the basis for the domain name "DRE-TIM".	8.14293e-163
CP028800.1\|AWA47922.1\|1623463_1624165_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.50328e-19
CP028800.1\|AWA47918.1\|1618034_1619636_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
CP028800.1\|AWA47916.1\|1615218_1617210_-\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
CP028800.1\|AWA47917.1\|1617221_1618025_-\|enoyl-CoA-hydratase	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	9.3568e-124
CP028800.1\|AWA47908.1\|1599485_1599986_-\|benzoate-1,2-dioxygenase-small-subunit	gnl\|CDD\|132276	TIGR03232, benzo_1_2_benB, benzoate 1,2-dioxygenase, small subunit. Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family should all act on benzoate, but several have additional known activities on various benozate analogs. Some members actually may be named more suitably according to such alternate an activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13).	6.72471e-105
CP028800.1\|AWA47911.1\|1602520_1602811_-\|muconolactone-delta-isomerase	gnl\|CDD\|213786	TIGR03221, muco_delta, muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol. [Energy metabolism, Other].	1.40423e-56
CP028800.1\|AWA47919.1\|1619660_1620833_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
CP028800.1\|AWA47920.1\|1620978_1621596_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.06085e-15
CP028800.1\|AWA47909.1\|1599997_1601374_-\|benzoate-1,2-dioxygenase-large-subunit	gnl\|CDD\|132273	TIGR03229, benzo_1_2_benA, benzoate 1,2-dioxygenase, large subunit. Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family all act on benzoate, but may have additional activities on various benozate analogs. This model describes the large subunit. Between the trusted and noise cutoffs are similar enzymes, likely to act on benzoate but perhaps best identified according to some other activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13). [Energy metabolism, Other].	0
CP028800.1\|AWA47921.1\|1621704_1623420_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
CP028800.1\|AWA47906.1\|1597595_1598381_-\|1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate-dehydrogenase	gnl\|CDD\|183772	PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional.	1.44587e-173
CP028800.1\|AWA49462.1\|1613263_1614220_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.11772e-70

>CP028800.1|AWA47914.1|1606515_1608711_+|OsmC-domain/YcaO-domain-containing-protein
MEIKVNYLDNLRQEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKVYCAARDIPTDNIRLSQNNIVDPENRYKQIFKIQVELPADISEKDRQGILRSIDRCTVKKVIQTGPEFVIEEVESIDADAQALLMPNLASESTTYIQGKDLPLEETIANMSAILAGLGMKIEIASWRNIVPNVWSLHIRDAQSPMCFTNGKGSTKESALASALGEFIERLNCNFFYNDQFWGEEIANAEFVHYPDEKWFKPGPNGELPKEILDEYCLEIYDPEKELLGTHLYDTNSGNIERGICSLPFVRQSDGETVYFPSNLIENLYLSNGMSAGNTLEEAQVQCLSEIFERAVKREIIEGEIALPDVPEEVLAKYPSIVAGIQGLEEQGFPVLVKDASLGGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPQPTFQSEAVTEPNNFVEHFIDSSGLVSWRFFSSKSDYDFVEWDFTNEGENSNADEAAELFGILEEMGKEVYMAVYEHLGATACRILVPDYSEIYLVEDLIWDNTNKALAFREDILNIHRLDDARLEALVERLEECELDDYTEITTLIGIEFDDNTVWGQLTLLELKLLIYIALKQFEEAKDLVEQFLQYNTNTVERGLFYQCMNVVLEVILDDEMELQDYEKNFRRMFGDERMDAVIGSVEGNVRFYGLTPTSMKLEGLDRHLRLIESYKKLHAARAKAVS
>CP028800.1|AWA47913.1|1604050_1604983_+|LysR-family-transcriptional-regulator
MELRFLRYFVAVVEEQSFTKAAERLFIAQPPLSRQIQNLENELGVQLFERGSRPLQTTTAGQFLYQHALKLLSNAEEVKSMTKRIGLIERTLTIGFVGSLLFGLLPRIIYLYRQQHPHLNIQLIELSTTEQLQALKEGRIDVGFGRLRISDPAVKRVLLRKERLVVAAHSSHPIAQRVEGVHLADLVDEKLFVYPNTPKPNFSSQLLNIFAEHSLVPKNVRELREIQLALGLVAAGEGLCVIPASADTIRFPHLLYIPILDSGAVSPIFITARAMDNSEDIQSLYDTIYQVYDLEGIEYKRTTFQWAQTE
>CP028800.1|AWA47912.1|1602823_1603939_-|muconate-cycloisomerase
MYKTIETILVDIPTIRPHKLSVTTMQTQTLVLVKITTTDGFVGWGEATTIGGLNYGEESPESVKANIDTYFAPLLLSIKSSINVAQTLKLIRKTINGNRFAKCAIQTALLDIQAKQLNLPLSEVLGGRLRDRLPVLWTLASGDTEKDIAEAKKMIELKRHNIFKLKIGSNPVQHDVDHVIAIKKALGPEISIRVDVNRAWSELECIQGIQQLQDGGIDLIEQPCAIEQTQVLARLTQRFDVAIMADEALTGPDSAYRLAKQHASDVFAVKVEQSGGLIEACEVAKIAKLAGIDLYGGTMLEGPIGSIASAHAFSTFDSLAFGTELFGPLLLTQDILKTPLRYENFELVVPNTAGLGIDIDEDKIEQLRRKA
>CP028800.1|AWA47911.1|1602520_1602811_-|muconolactone-delta-isomerase
MLFQVRMDVHLPVEMPAEQANQIKAVEKAYSQDLQRQGKWRHIWRITGQYSNISIFDVESNEELHNILQGLPLYPYMDIEVMALNRHPSSIREDDR
>CP028800.1|AWA47910.1|1601456_1602377_-|catechol-1,2-dioxygenase
MNRQDIDALVKKMNVDTATGAVDQRVQSIVVRLLGDLFQAIEDLDIQASEVWKGLEYFTDAGQANELGLLAAGLGLEHYLDLRADEADAKAGVSGGTPRTIEGPLYVAGAPESVGFARMDDGSESDKIDTLIIEGTVTDTDGNIIEGAKVEMWHANSLGNYSFFDKSQSDFNLRRTILSDVNGKYVALTTMPVGYGCPPEGTTQFVLNKLGRHGNRPSHVHYFVSAPGFRKLTTQFNIEGDKYLWDDFAFATRDGLVATAVDVTDEAEIQRRGLDKPFKHITFNIELVKEAASAPSTEVDRRRASA
>CP028800.1|AWA47909.1|1599997_1601374_-|benzoate-1,2-dioxygenase-large-subunit
MPKIPVINTTHLDRIDELLVDNEETGEYKLHRSVFTDQAMFDLEMKYIFEGNWVYLAHESQIPKNNDFYTTYIGRQPIIIARNRNGELNAMINACSHRGAQLCRHKRGNKATYTCPFHGWTFNNSGKLLKVKDPTDAGYSDCFNQDGSHDLKKVAKFESYKGFLFGSLNPDVPSLKEFLGETTKIIDMIVGQSEQGLEVLRGSSTYTYEGNWKLTAENGADGYHVSAVHWNYAATTQHRKETEAGDNIRAMSAGSWGKQGGGSYGFEHGHMLLWTQWANPEDRPNYPKADEYTEKFGAAMSKWMIERSRNLCLYPNVYLMDQFGSQIRVLRPLSVNKTEVTIYCIAPVGEEPEARARRIRQYEDFFNASGMATPDDLEEFRACQAGYAGLELEWNDMCRGSKHWIHGPDDAANEIGLKPKLSGIKTEDEGLYLAQHQYWLKSMKNAIATEKKLAESQI
>CP028800.1|AWA47908.1|1599485_1599986_-|benzoate-1,2-dioxygenase-small-subunit
MNTTTQATLENIAQFLYREARFLDDEQWDEWLSCYSPEASFWMPAWDDDDQLTEDPQSEISLIYYPNRQGLEDRVFRIKTERSSATMPDTRTSHNISNIEVLERDGDKVTVRFNWNTLSFRYKTNYSYFGMSRYVIDFSNEQPKIISKYVVLKNDYINQVIDIYHL
>CP028800.1|AWA47907.1|1598398_1599415_-|NADH-oxidase
MSNHNVALQFEDGVTRFITVTQGETLSDAAYRQKINIPLDCRDGACGTCRAFCESGSYNMPEETYIEDALTPEEAEQGYILACQCRPTSDAVFQIQASSDVCKTEIHSFQGTLSRVENLSDSTITFDIQLDDGQPEIHFLAGQYVNVGIPGTSETRSYSFSSKPGNRLTGFVVRNVPNGQMSEFLSKNAKAGDKMHFTGPFGSFYLRPVTKPVLMLAGGTGIAPFMSMLQVLEEKGSDHPIRLVFGVTNDFDLVAIEKLDELQSKYPWFEYRTVVAHPESQHERKGYVTGHIENDWLNNGDVDVYLCGPVPMVEAVRSWLDQEGIKPANFLFEKFSAN
>CP028800.1|AWA47906.1|1597595_1598381_-|1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate-dehydrogenase
MIFQDRFKNKIVIVTGAAQGIGRSVAIRVAAENGYVVLADRSELVDEVASEIRSTGGHAITVQADLERYDGAQAVVDKAIQEFGRVDVLINNVGGAIWMKPFDEFSEEQIIKEINRSLFPTLWCCRAVLPEMLKHQYGVIVNVSSIATRGINRIPYSAAKGGVNALTASLAFEHAKNGIRVNAIATGGTDAPPRKVPRNSTPLSEDEKVWMQQVVDQTKERSLMGRYGTIDEQVNAILFLASEESSYMTGSVIAVGGGDQG
>CP028800.1|AWA47905.1|1596338_1597556_-|benzoate-transporter
MTNLLTSLKNDWSISATIAGFLAVLISYSGPLIIFFQAAQKANISTEMMISWIWGISIGAAVAGIYLSIRYKTPVITAWSAPGTALLVSLFPNISLNEVVAAYITSAIVIFIVGATGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFVATDSMPLIVFSMLLCYLLAKRYSPRYTMLWVLLCGVSLSLIWGKMNPVEMQFSFAIPHFIYPEWTWHSTFNLALPLILVSLTGQFLPGMAIMKLSGYDTPAKPIITASSIASLAVACVGGITIVLAAITAALCMGKDAHELKEKRYIAGVANGIFYILGGLFAGSIVMLFSLLPKELIAALAGLALLGAIGTNVMIAMKDDHQRDAALITFLATVSGMHFLGLSSVFWGICIGVIAQILLNPHAHPNTVMTQSSSEK
>CP028800.1|AWA49462.1|1613263_1614220_+|LysR-family-transcriptional-regulator
MRKNLDGGLLHAMHAFLKVIDSGSFTAAAEQMDLTTAQVSRLISELESRLGVKLMQRSTRQHALTDIGALYAERCRQVLSIIDEAESEATGTATKPKGRLRILSMASFGHYYISPVMAKFCQSYPDLTVEYRTSQNTPDLLGKGIDVSLYLTESLTDSRFVSRRIGTIFSVLCASPAYLEKHGIPNSPEDLYNHACLRLVNPSITPEWHLINEKGGFHEISTSGQIVADTPELLLDVVQQDMGIALLPMFSVIEAVRAGRLCHVLPDWRSPDIGVYTLLPSRDYVDAKTRAWLDWVEQYISPKIKSDTSYFYQLTHTE
>CP028800.1|AWA47915.1|1614319_1615222_-|hydroxymethylglutaryl-CoA-lyase
MSDYVKIVEVGPRDGLQNEKQALSIEQRLSFINDLIDAGLKSIEVGSCVSAKWVPQMAQSDELFKLLPQRDELNLSLLTPNLKGFEAALAVGCKEVAVFTAASESFTRKNINCSIDESLERFSEIFQAAQANNVRVRGYVSCMVDCPYEGAIDPKQVVNVVKRLHDMGCYEISLGETIGTATPDRVQKVWQACLAELDSKILAGHFHNTYGMAIANIYQSLQQGIRVFDSSLAGLGGCPYAKGSSGNVATEDLYYLLSHIGYETGIHLEKLMLASQNINQTLNRKNLSNYANTYLQQSCA
>CP028800.1|AWA47916.1|1615218_1617210_-|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha
MFEKILIANRGEIACRVIRTAKKLGIATVAVYSDADAHAQHVKLADEAIYIGQSPATQSYLQVDRIIQAAIDTGSQAIHPGYGFLSENDQFALACQQHNICFIGPPVDAILAMGLKATSKALMEKAGVPLTPGYHGTNQDAEFLKQQADRIGYPVLIKASAGGGGKGMSLVERSEDFLHSLASCKREAKSSFGNDDVLIERYVIQPRHIEVQVFGDTHGNYVHLFERDCSVQRRHQKVLEEAPAPQMPSEKLDAMRQAAIDAARAVNYVGAGTVEFIVEQDGTAYFMEMNTRLQVEHPVTEMITGEDLVEWQLRVAYGEPLPKLQHELQIHGHALEARIYAEEPEKGFLPAIGKIDYLRYPTQNQYVRVDSGIVEGDEITTFYDPMIAKLIVWGKNREAALIQMQHALSQFHVDGLGNNIAFLEKIVRCDSFKQAKLDTNLIQREEQFLFSPANIKPEFVVATAFIEFLSQMQSNQSTQKQLWLAQPLWRINVSYQHSIKLNYLNQNIQIKFSAAEQGFNSEFNGQQYHITGQLTDQHSANIQIGGIQQKLAFNRGVQGITLFNAGQSYKFSYLRQDYNQTDGQSEQGHLKAPMPGVVTQLLVGANHTVKKDDVLLTLEAMKMEYTIRAPKDGVILDAYFQVGDQVKAGDELVDFQAAEEEVA
>CP028800.1|AWA47917.1|1617221_1618025_-|enoyl-CoA-hydratase
MSYQFLQVEQHDQVAYVWLNRPELHNAFNTTVIEELHTCFKQIAIRDDIRVVVLAGRGKSFSAGADLNWMKQAGQASAEENEADALKLAKMLEALATLNQPTIARVHGIAFGGGIGLASACDICIASTDAKFATSEVRLGLAPSTISPYVIRAIGARQASRYFLTAERISAHEAKQIGLAHEIADAEDLDKKVQEIIDALLLGGPHAQAASKQLIQMVSNQSMNDELLRQTAQHIAQVRQGSEAKEGLTAFLNKQAPAWTSNSNNNN
>CP028800.1|AWA47918.1|1618034_1619636_-|methylcrotonoyl-CoA-carboxylase
MNQLQSKINVRSEDFKTNQQAMQTLVNDLTQVAQNIALGGGENARQKHLARGKLLPRERIDQLIDVGTAFLEIGQLAAYKVYEDDIPAAGVIAGIGQVNGVTCMIVANDATVKGGTYYPLTVKKHLRAQEIAEQNHLPCIYLVDSGGAYLPMQDQVFPDRDHFGRIFYNQARMSSQGIAQIAVVMGSCTAGGAYVPAMSDETIIVRNQGTIFLGGPPLVKAATGEVVSSEDLGGGDVHTRLSGVADHLAENDEHAIAIARNIVANLNKKSNELNKQIDEPLFDAKELYGVVPTDARKLFDVREVIARIVDGSRFDEFKARFGSTLITGFASLYGMPVGIIANNGILFSESAQKGAHFIELCTQRNIPLLFIQNITGFMVGRQYENEGIAKHGAKLVMAVATANVPKLTLIIGGSFGAGNYGMCGRAYSPRFLWTWPNSRISVMGGEQAASVLSTLKRDQIEQKGTEWSAQEEDEFKQPIRDQYERQGHPYYASARLWDDGVIDPAQTRQVLGLSLAAALNAPIQPTKFGVFRM
>CP028800.1|AWA47919.1|1619660_1620833_-|isovaleryl-CoA-dehydrogenase
MNLRSLNFGLDETLIALQDSVAAFCAKEIAPIAQQVDQDNKFPSHLWKKFGDMGLLGLTVSEEYGGTNLGYLAHIIVMQEISRASAAIALSYGAHSNLCINQINRNGNEQQKQKYLPKLISGEYVGALAMSEPNAGSDVVSMKLRAEQKDDHFVLNGSKMWITNGGDADVLVVYAKTDPHAGAKGMTAFLIEKDMKGFSHGHHLDKLGMRGSNTYPLFFDNVEVPVENVLGGVGNGAKVLMSGLDYERAVLSAGPLGIMDACMDVVIPYLHQREQFGQALGEFQLMQGKLADMYSTWLACKALVYAVGTACDKADHDRSLRKDAASAILYAAEKATWMAGEAIQTLGGNGYINEFPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFNETK
>CP028800.1|AWA47920.1|1620978_1621596_+|TetR/AcrR-family-transcriptional-regulator
MSYKRSSLMQERMEQNRKSILSSARKLISEGGFKDAQIQTIAEQAGVSSGLVYRYFDNKSQVLIEVLSEAINTELLVIDAITESDLTAEQKLHKAVTTFVKRALNSPQLAYSLMFEPVDSLVEHERFRVKQLIKQSIIKILADGNASGEFVLEDLNTTALCVVGAMTFVVVEPLDPAQNTKFDQQHKDYFSKQIADFCVDAVRKK
>CP028800.1|AWA47921.1|1621704_1623420_+|AMP-binding-protein
MQQQRLSYASGPSTQPLLGMTIGEKFDQACQQYADQEAIVSSHQNRRLTYKQLQNEVKAFACSLLKLGLKKGDRLGIWSPNCVEWTITQFAAFKAGIILVNLNPAYKSHELEYVLNKVSCKGLIIASQFKTTDYQELLTRIAPEIVFCTDKIIHSERLPFLKFVIKIDEKQHTGIHRFSDLVVPPTQEQFDQLQLATQQLQFDETINIQFTSGTTGNPKGTMLTHHNILNNGYFVGEGIRLTPQDKVCISVPLFHCFGMVMGNLACITHGSTMVYPSAVFNPLETLKTIHNERCTAAYGVPTMFIATLEHEQFNEFDLSSLRTGIMAGSPCPREIMQRVIDRMHMSEITICYGMTETSPVSLQSSVSDTIDKRVSTVGHVHPHVEIKIVDPEGQLVPQGTLGELCVRGYSVMAGYWGEEEKTREVIDAAGWMHTGDIAEMDAEGFVKIKGRIKDVVIRGGENLFPKEIEDFLYTHPAICDVQVIGLPDTRYGEELCACIILHEHHQTDEDNIRSFCKEHISHNKVPRYVKFFNEFPMTASGKAQKFKLQEIMRAELNLTGNVFDLMIFYIA
>CP028800.1|AWA47922.1|1623463_1624165_+|class-I-SAM-dependent-methyltransferase
MAKDFNSPKIVEEYDQHIRKLIPGYEIIHQQVDAILQSVLQPIAHILIVGCGTGYELEYLLNRHPNWKFTALDPSLAMLEKAEIRVKQMGKSAQVQFVHGDHFALTEGAGFDAALSILVAHFIADEQKTDFYSSIHRCLKNSGLLLTYDLMPCSNPQHLQALRYLCMAQGLTELQCQKMLDRMENDFFTISFSEYQQRLQGIGFEDVHSYSQILIYQGLIAKKAEIAEFAQAS
>CP028800.1|AWA49463.1|1624448_1625735_+|DcaP-like-protein
MKRFILTVQQSVLALSVLTAMSGSYAGSENAEIEQLRQEVKELRAMLQNYVQQTPPAQPTTQVMVAQTSEPVQTTTPKLSLTKSGAEVNLYGYLRADASYQAKGASTMYNNISGVPLEGTAEEAQQKDRLHSTASVSRIGLNFKTPTAMGDVGGKLEMDFFGSASRDQFRIRHAYLTFDKWLLGQTWSTFIAPEYYPETIDAATYVGGALQRSPLVRYSDNITANTSFALAVEDPKYTASSDPDNEMRLPAFVGRVNHKFANGSMLSGRSFVAEKKTSQDEEWAWGVGIGGKYQLTPKTFLKADYNHIKGDGRFLMWTNSSYVIDDQKHIQSNEFDSISTGITHQFNTQFRSTLGYGYMKAKDNNAFARINKDNTAQNKELWQGWINGMYNPYKPITLGMEYVYGERETFDGRTGTDNRINMMASYDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP028800_1	1.2\|423986\|33\|CP028800\|CRT	423986-424018	33	NZ_CP030363	Salinibacter ruber strain SP73 plasmid pSR118, complete sequence	70669-70701	8	0.758

1. spacer 1.2|423986|33|CP028800|CRT matches to NZ_CP030363 (Salinibacter ruber strain SP73 plasmid pSR118, complete sequence) position: , mismatch: 8, identity: 0.758

cgaattcaattctgatcgtccacg------tcgtgaagg	CRISPR spacer
cgaattccattctgatcgaccacggccatctcg------	Protospacer
******* ********** *****      ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31262 : 102331

Tupanvirus(18.18%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA46598.1\|31262_32225_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	6.6e-07	34.1
AWA46599.1\|32436_34266_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AWA46600.1\|34427_35714_+	hypothetical protein	NA	NA	NA	NA
AWA46601.1\|35756_36164_+	DUF4259 domain-containing protein	NA	NA	NA	NA
AWA46602.1\|36204_37101_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWA46603.1\|37223_37979_+	KR domain-containing protein	A0A0M4JSW6	Mollivirus	5.3e-12	24.9
AWA46604.1\|38032_39187_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWA46605.1\|39315_40605_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	3.7e-146	64.1
AWA46606.1\|40905_43587_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AWA46607.1\|43671_44295_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWA46608.1\|44448_45549_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AWA46609.1\|45551_48680_+	AcrB/AcrD/AcrF family protein	NA	NA	NA	NA
AWA46610.1\|48812_49190_+	hypothetical protein	NA	NA	NA	NA
AWA46611.1\|49331_50444_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.2e-23	38.1
AWA46612.1\|50694_51516_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
AWA46613.1\|51616_52264_+	hypothetical protein	NA	NA	NA	NA
AWA46614.1\|52299_53487_-	MFS transporter	NA	NA	NA	NA
AWA46615.1\|54428_55331_+	LysR family transcriptional regulator	NA	NA	NA	NA
AWA46616.1\|55278_55689_-	hypothetical protein	NA	NA	NA	NA
AWA46617.1\|55779_57207_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AWA46618.1\|57203_58229_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	7.9e-43	28.7
AWA46619.1\|58258_58813_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AWA46620.1\|58848_59094_-	hypothetical protein	NA	NA	NA	NA
AWA46621.1\|59103_59640_-	M23 family peptidase	W8ED04	Mycobacterium_phage	2.1e-07	32.2
AWA46622.1\|59679_60717_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
AWA46623.1\|60938_61676_-	dienelactone hydrolase family protein	NA	NA	NA	NA
AWA46624.1\|61837_61996_-	DUF1328 domain-containing protein	A0A0R6PJ30	Moraxella_phage	1.1e-09	72.3
AWA46625.1\|62180_62633_+	YcgN family cysteine cluster protein	NA	NA	NA	NA
AWA46626.1\|62743_63901_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
AWA46627.1\|63890_65114_+	class C beta-lactamase	NA	NA	NA	NA
AWA46628.1\|65194_66472_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-80	40.8
AWA49400.1\|66572_67457_+	drug/metabolite DMT transporter permease	NA	NA	NA	NA
AWA46629.1\|67633_68095_+	hypothetical protein	NA	NA	NA	NA
AWA46630.1\|68078_69365_+	amidohydrolase	NA	NA	NA	NA
AWA46631.1\|69435_70155_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SPE1	Cyanophage	6.3e-39	36.8
AWA46632.1\|70191_70794_-	lipoprotein-34 precursor (NlpB)	NA	NA	NA	NA
AWA46633.1\|70809_71703_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AWA46634.1\|71992_72625_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	3.9e-24	37.6
AWA46635.1\|72703_73168_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AWA46636.1\|73381_74020_+	YitT family protein	NA	NA	NA	NA
AWA46637.1\|74400_75539_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.9e-84	59.0
AWA49401.1\|75550_75997_-	hypothetical protein	NA	NA	NA	NA
AWA46638.1\|76085_76298_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWA46639.1\|76335_77304_-	hypothetical protein	NA	NA	NA	NA
AWA46640.1\|77306_79316_-	hypothetical protein	NA	NA	NA	NA
AWA46641.1\|79323_80286_-	hypothetical protein	NA	NA	NA	NA
AWA46642.1\|80380_81802_-	hypothetical protein	NA	NA	NA	NA
AWA46643.1\|81919_83536_-	hypothetical protein	NA	NA	NA	NA
AWA46644.1\|83510_85052_-	hypothetical protein	NA	NA	NA	NA
AWA46645.1\|85065_86712_-	transcriptional antiterminator	NA	NA	NA	NA
AWA46646.1\|86712_88800_-\|transposase	transposase	NA	NA	NA	NA
AWA46647.1\|88783_89617_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
AWA46648.1\|89885_90338_-	hypothetical protein	NA	NA	NA	NA
AWA46649.1\|91635_94689_+	hypothetical protein	NA	NA	NA	NA
AWA46650.1\|94688_95402_+	hypothetical protein	NA	NA	NA	NA
AWA46651.1\|95405_96977_-	hypothetical protein	NA	NA	NA	NA
AWA46652.1\|96976_98494_-\|transposase	transposase	NA	NA	NA	NA
AWA46653.1\|98494_100162_-	transcriptional antiterminator	NA	NA	NA	NA
AWA46654.1\|100189_102331_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

842820 : 894606

Escherichia_phage(18.18%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA47293.1\|842820_843834_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AWA47294.1\|843997_844921_+	DUF808 domain-containing protein	NA	NA	NA	NA
AWA47295.1\|844958_845849_+	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	4.0e-35	37.4
AWA47296.1\|846093_847593_+	sodium:proton antiporter	A0A2H4J178	uncultured_Caudovirales_phage	2.3e-19	33.2
AWA47297.1\|848383_848821_-	universal stress protein	NA	NA	NA	NA
AWA47298.1\|849032_849659_-	chloramphenicol acetyltransferase CAT	M1HS53	Paramecium_bursaria_Chlorella_virus	1.1e-07	31.7
AWA47299.1\|849727_850204_-	transcription elongation factor GreA	NA	NA	NA	NA
AWA47300.1\|850296_853530_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
AWA47301.1\|853544_854684_-	carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
AWA47302.1\|855044_855653_+	hypothetical protein	NA	NA	NA	NA
AWA47303.1\|855699_856236_-	hypothetical protein	NA	NA	NA	NA
AWA47304.1\|856243_856567_-	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
AWA47305.1\|856798_857449_+	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
AWA47306.1\|857585_859481_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	3.4e-108	46.6
AWA47307.1\|859660_860518_+	dihydropteroate synthase	NA	NA	NA	NA
AWA47308.1\|860637_862251_+	DUF3520 domain-containing protein	NA	NA	NA	NA
AWA47309.1\|862362_862677_+	hypothetical protein	NA	NA	NA	NA
AWA47310.1\|862705_864310_-	peptidase S15	NA	NA	NA	NA
AWA47311.1\|864420_865365_-	EamA/RhaT family transporter	NA	NA	NA	NA
AWA47312.1\|865747_866317_+	nicotinamide riboside transporter PnuC	V5KSH6	Escherichia_phage	9.8e-11	28.4
AWA47313.1\|866351_867488_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
AWA47314.1\|867640_869254_-	sulfatase	NA	NA	NA	NA
AWA47315.1\|869572_872677_+	hydrophobe/amphiphile efflux-1 family RND transporter	NA	NA	NA	NA
AWA49438.1\|872880_873971_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWA47316.1\|874165_875503_+	magnesium transporter	NA	NA	NA	NA
AWA47317.1\|875581_876166_+	DUF4112 domain-containing protein	NA	NA	NA	NA
AWA47318.1\|876240_877146_-\|protease	protease HtpX	NA	NA	NA	NA
AWA47319.1\|877360_878221_-	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	1.7e-35	54.7
AWA47320.1\|878713_879619_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	6.2e-92	64.6
AWA47321.1\|879816_880200_+	SCP-2 sterol transfer family protein	NA	NA	NA	NA
AWA47322.1\|880254_881364_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWA47323.1\|881962_882250_+	hypothetical protein	NA	NA	NA	NA
AWA47324.1\|884974_885256_+	DNA-binding protein	NA	NA	NA	NA
AWA47325.1\|885291_885861_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AWA47326.1\|885955_888805_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	1.0e-127	40.9
AWA47327.1\|889365_889686_-	helix-turn-helix domain-containing protein	A0A218MNC9	uncultured_virus	2.3e-17	52.1
AWA49439.1\|889718_890006_-\|transposase	transposase	NA	NA	NA	NA
AWA47328.1\|890038_890386_-\|transposase	transposase	NA	NA	NA	NA
AWA47329.1\|890528_890777_+	diguanylate cyclase	NA	NA	NA	NA
AWA47330.1\|890788_891277_+	diguanylate cyclase	NA	NA	NA	NA
AWA47331.1\|891263_892124_+\|protease	Zn-dependent protease	NA	NA	NA	NA
AWA47332.1\|892143_893295_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	3.7e-25	30.2
AWA47333.1\|893859_894606_-\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.1e-15	35.9

DBSCAN-SWA_3

898743 : 991103

Enterobacteria_phage(20.0%)

protease,integrase,transposase

attL 903439:903455|attR 954068:954084

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA47337.1\|898743_901503_-\|integrase	integrase	NA	NA	NA	NA
AWA47338.1\|902948_903266_+	transcription elongation factor GreAB	NA	NA	NA	NA
903439:903455	attL	NA	NA	NA	NA
AWA49440.1\|904251_904512_+	hypothetical protein	NA	NA	NA	NA
AWA47339.1\|904530_905112_+	hypothetical protein	NA	NA	NA	NA
AWA47340.1\|905123_905504_+	hypothetical protein	NA	NA	NA	NA
AWA47341.1\|905623_905926_+	hypothetical protein	NA	NA	NA	NA
AWA47342.1\|905986_907033_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.0e-57	37.1
AWA47343.1\|907176_908220_+	YqaJ-like viral recombinase	A0A139ZPJ9	Marinitoga_camini_virus	1.2e-41	42.5
AWA47344.1\|908362_909295_+	hydrolase or metal-binding protein	NA	NA	NA	NA
AWA47345.1\|909385_910513_-	hypothetical protein	NA	NA	NA	NA
AWA47346.1\|910503_911718_-	inovirus Gp2 family protein	NA	NA	NA	NA
AWA47347.1\|912189_912456_-	AlpA family phage regulatory protein	NA	NA	NA	NA
AWA47348.1\|912585_913860_-	hypothetical protein	NA	NA	NA	NA
AWA47349.1\|914726_915383_+	DUF4433 domain-containing protein	NA	NA	NA	NA
AWA47350.1\|915382_916462_+	Appr-1-p processing protein	B0FIJ9	Escherichia_phage	4.2e-18	38.6
AWA47351.1\|916623_917556_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.5
AWA47352.1\|917656_918694_-	murein L,D-transpeptidase	NA	NA	NA	NA
AWA47353.1\|918878_919808_-\|transposase	IS5/IS1182 family transposase	Q1MVF0	Enterobacteria_phage	4.2e-51	37.9
AWA47354.1\|919985_945323_+	hypothetical protein	NA	NA	NA	NA
AWA47355.1\|947111_949247_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.9e-28	26.7
AWA47356.1\|949243_950683_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
AWA47357.1\|950811_951429_-	CAP domain-containing protein	NA	NA	NA	NA
AWA47358.1\|951633_952605_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AWA49441.1\|952638_953919_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	2.6e-75	38.7
AWA47359.1\|954574_955864_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
954068:954084	attR	NA	NA	NA	NA
AWA47360.1\|955875_956805_-\|transposase	IS5/IS1182 family transposase	Q1MVF0	Enterobacteria_phage	2.5e-51	37.9
AWA47361.1\|957030_957921_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWA47362.1\|958056_959472_+	aspartate ammonia-lyase	NA	NA	NA	NA
AWA47363.1\|959857_960484_+	MarC family protein	NA	NA	NA	NA
AWA47364.1\|960684_961206_+	acyl-CoA thioesterase	NA	NA	NA	NA
AWA47365.1\|961327_961540_-	hypothetical protein	NA	NA	NA	NA
AWA47366.1\|962014_963016_+	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
AWA47367.1\|963096_963627_+	hypothetical protein	NA	NA	NA	NA
AWA47368.1\|963659_964001_+	peptidylprolyl isomerase	NA	NA	NA	NA
AWA49442.1\|964389_964785_+	hypothetical protein	NA	NA	NA	NA
AWA47369.1\|965007_967005_+	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB	NA	NA	NA	NA
AWA47370.1\|967018_968275_+	poly-beta-1,6 N-acetyl-D-glucosamine synthase	NA	NA	NA	NA
AWA47371.1\|968307_968724_+	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
AWA47372.1\|970850_971597_-\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.1e-15	35.9
AWA47373.1\|971583_971772_+	hypothetical protein	NA	NA	NA	NA
AWA47374.1\|972212_973061_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.8e-25	34.8
AWA47375.1\|973116_973791_+	methyltransferase	NA	NA	NA	NA
AWA47376.1\|974300_974723_-	hypothetical protein	NA	NA	NA	NA
AWA47377.1\|974987_976502_+	glycerol kinase	NA	NA	NA	NA
AWA47378.1\|976548_977307_+	HTH domain-containing protein	A0A077SK06	Escherichia_phage	1.4e-20	29.1
AWA47379.1\|977561_979082_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AWA47380.1\|979167_980997_-	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
AWA47381.1\|981392_982331_+	diacylglycerol kinase	NA	NA	NA	NA
AWA47382.1\|982311_983082_+	3',5'-cyclic-nucleotide phosphodiesterase	NA	NA	NA	NA
AWA47383.1\|983257_983548_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	2.3e-16	51.1
AWA47384.1\|983605_985240_+	chaperonin GroEL	A0A219YK78	uncultured_virus	8.1e-175	60.9
AWA47385.1\|985501_986137_+	hypothetical protein	NA	NA	NA	NA
AWA47386.1\|986203_986578_-	diacylglycerol kinase	NA	NA	NA	NA
AWA47387.1\|986770_987838_+	DUF3410 domain-containing protein	A0A1J0F959	Only_Syngen_Nebraska_virus	1.8e-10	26.8
AWA47388.1\|987834_988818_+	EF-P lysine aminoacylase GenX	A0A1V0SFI4	Hokovirus	7.1e-25	27.7
AWA47389.1\|988823_989951_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AWA47390.1\|990485_991103_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_4

1831842 : 1891254

Staphylococcus_phage(14.29%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA48119.1\|1831842_1832376_+\|holin	phosphatidylcholine--retinol O-acyltransferase	NA	NA	NA	NA
AWA48120.1\|1833216_1833474_+	hypothetical protein	NA	NA	NA	NA
AWA48121.1\|1833552_1834059_+	N-acetyltransferase	NA	NA	NA	NA
AWA48122.1\|1834140_1834719_-	polyisoprenoid-binding protein	NA	NA	NA	NA
AWA48123.1\|1834946_1835354_+	OsmC family peroxiredoxin	NA	NA	NA	NA
AWA48124.1\|1835408_1837397_-	transketolase	NA	NA	NA	NA
AWA48125.1\|1837781_1838948_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	7.2e-125	61.6
AWA48126.1\|1839016_1839694_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
AWA48127.1\|1839745_1840003_-	hypothetical protein	NA	NA	NA	NA
AWA48128.1\|1840246_1840429_+	hypothetical protein	NA	NA	NA	NA
AWA48129.1\|1840472_1841036_-	FxsA protein	NA	NA	NA	NA
AWA48130.1\|1841224_1841659_-	DUF333 domain-containing protein	NA	NA	NA	NA
AWA48131.1\|1841864_1842134_-	hypothetical protein	NA	NA	NA	NA
AWA48132.1\|1842150_1843305_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWA48133.1\|1843744_1843963_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	2.1e-17	66.7
AWA48134.1\|1844338_1844557_-\|transposase	transposase	NA	NA	NA	NA
AWA48135.1\|1845087_1845633_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AWA48136.1\|1845636_1847139_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AWA48137.1\|1847162_1848287_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
AWA48138.1\|1848366_1849356_+	biotin synthase BioB	NA	NA	NA	NA
AWA48139.1\|1849405_1849618_-	hypothetical protein	NA	NA	NA	NA
AWA48140.1\|1849742_1850090_-	hypothetical protein	NA	NA	NA	NA
AWA48141.1\|1850564_1851098_+	type 1 fimbrial protein	NA	NA	NA	NA
AWA48142.1\|1851717_1852356_-	glutathione S-transferase	NA	NA	NA	NA
AWA48143.1\|1853533_1854142_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWA48144.1\|1854363_1854663_-	DUF1330 domain-containing protein	NA	NA	NA	NA
AWA48145.1\|1854666_1855350_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
AWA48146.1\|1855435_1856593_-	NADH-dependent alcohol dehydrogenase	NA	NA	NA	NA
AWA48147.1\|1857185_1857500_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AWA48148.1\|1857833_1858664_-	S-formylglutathione hydrolase	NA	NA	NA	NA
AWA48149.1\|1858892_1860005_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.8e-33	30.1
AWA48150.1\|1860026_1860302_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
AWA48151.1\|1860769_1861765_+	quinone oxidoreductase	NA	NA	NA	NA
AWA48152.1\|1861754_1862771_+	NADPH:quinone reductase	NA	NA	NA	NA
AWA49471.1\|1862821_1863721_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWA48153.1\|1863856_1864597_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AWA48154.1\|1864670_1865669_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
AWA48155.1\|1865689_1865974_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AWA48156.1\|1866075_1867230_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWA49472.1\|1868185_1869886_-	D-lactate dehydrogenase	NA	NA	NA	NA
AWA48157.1\|1870116_1871262_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AWA48158.1\|1871265_1872009_-	transcriptional regulator LldR	NA	NA	NA	NA
AWA48159.1\|1872026_1873691_-	L-lactate permease	NA	NA	NA	NA
AWA48160.1\|1874114_1874846_+	Fic family protein	A0A1V0E025	Clostridioides_phage	5.7e-11	27.8
AWA48161.1\|1876924_1877908_-	hypothetical protein	NA	NA	NA	NA
AWA48162.1\|1878010_1878883_+	hypothetical protein	NA	NA	NA	NA
AWA48163.1\|1879794_1880730_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-23	26.5
AWA48164.1\|1880726_1881500_+	ABC transporter permease	NA	NA	NA	NA
AWA48165.1\|1881496_1882312_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A126HHM5	Vibrio_phage	9.4e-39	35.3
AWA48166.1\|1882345_1883005_+	hypothetical protein	NA	NA	NA	NA
AWA48167.1\|1883170_1884313_+	rod shape-determining protein RodA	NA	NA	NA	NA
AWA48168.1\|1884332_1885334_+	lytic murein transglycosylase B	NA	NA	NA	NA
AWA48169.1\|1885621_1886233_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.3e-21	55.1
AWA48170.1\|1886377_1886830_+	DUF962 domain-containing protein	NA	NA	NA	NA
AWA48171.1\|1886869_1887343_-	DUF3465 domain-containing protein	NA	NA	NA	NA
AWA48172.1\|1887423_1888839_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
AWA48173.1\|1889030_1890044_+	lipoyl synthase	NA	NA	NA	NA
AWA48174.1\|1890099_1891254_-\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP028798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

16326 : 25240

Salmonella_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA46558.1\|16326_16893_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.1e-25	50.0
AWA46559.1\|17385_17535_+	DUF4113 domain-containing protein	A0A0P0IVV3	Acinetobacter_phage	2.5e-06	46.9
AWA46560.1\|17695_17983_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	9.0e-21	53.8
AWA46561.1\|17972_18221_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AWA46562.1\|18223_18649_-	hypothetical protein	NA	NA	NA	NA
AWA46563.1\|18915_19155_-	hypothetical protein	NA	NA	NA	NA
AWA46564.1\|19151_19781_-	cobyrinic acid ac-diamide synthase	A0A222YXS3	Escherichia_phage	1.3e-59	53.8
AWA46565.1\|20231_21146_+	RepB family plasmid replication initiator protein	A0A218MNI2	uncultured_virus	9.2e-51	38.5
AWA46566.1\|21694_25240_+	hypothetical protein	Q6UAU7	Klebsiella_phage	8.6e-12	21.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP028800

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP028798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection