CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	0 crisprs	csa3,RT,c2c4_V-U1	0	0	0	0
CP022044	Bacillus anthracis strain FDAARGOS_341 chromosome, complete genome	3 crisprs	csa3,DEDDh,cas14j,cas3,WYL,c2c9_V-U4,cas14k,DinG	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022044_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022044_1

291853-292050

Orphan

Consensus_repeat	Method
TTTCGGAATGAACATTCATTCCT	CRISPRCasFinder

3 spacers

The CRISPR arrays of CP022044_1

>merge|CP022044|1|291853-292050|CRISPRCasFinder
TTACGGAATGAATATTCATTCCTATTATTTTGAAAACACCTTTTCGGAATGAACATTCATTCCTCTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGATTTCGGAATGAATATTCATTCCTTTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCTCATCGGAATGAATGTTCATTCCT

>CP022044|1|1|291853-292050|CRISPRCasFinder
TTACGGAATGAATATTCATTCCT	ATTATTTTGAAAACACCT
TTTCGGAATGAACATTCATTCCT	CTCGTTCTATTAATTTACTTTTTAGCTCTATTAAACTATGGA
TTTCGGAATGAATATTCATTCCT	TTAATTGTACAGATTGATCATCTCCTACTTTTCTTTTTCACACCCT
CATCGGAATGAATGTTCATTCCT

Protein	Signature genes	Signature genes Name	Protein_function
CP022044.2\|ASE27847.1\|285564_287190_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|237894
CP022044.2\|ASE27849.2\|289393_291817_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
CP022044.2\|ASE27853.1\|295555_296656_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
CP022044.2\|ASE27848.1\|287567_288416_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
CP022044.2\|ASE27858.1\|301132_303682_-\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|372518
CP022044.2\|ASE27854.1\|296648_297749_-\|histidinol-phosphate-aminotransferase	unknown	unknown	gnl\|CDD\|134568
CP022044.2\|ASE27843.1\|280355_280478_-\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE27856.1\|299062_299161_-\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE27846.1\|283074_285048_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
CP022044.2\|ASE27857.1\|299224_300301_-\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
CP022044.2\|ASE27855.1\|297767_298940_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
CP022044.2\|ASE27844.1\|280583_281411_+\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
CP022044.2\|ASE27851.1\|292906_294079_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
CP022044.2\|ASE27859.1\|303725_304643_-\|protein-deacetylase	unknown	unknown	gnl\|CDD\|238697
CP022044.2\|AVK72895.1\|281570_282233_+\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
CP022044.2\|ASE27852.1\|294249_295539_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
CP022044.2\|AVK72896.1\|288701_289274_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225272
CP022044.2\|AVK72897.1\|289240_289393_-\|multidrug-transporter	unknown	unknown	gnl\|CDD\|225272
CP022044.2\|ASE27845.1\|282343_283015_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
CP022044.2\|ASE27850.1\|292070_292637_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911

Protein	Function_ID	Function_description	E-value
CP022044.2\|ASE27847.1\|285564_287190_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
CP022044.2\|ASE27849.2\|289393_291817_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	1.55084e-81
CP022044.2\|ASE27853.1\|295555_296656_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	5.37504e-160
CP022044.2\|ASE27848.1\|287567_288416_-\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	2.01186e-152
CP022044.2\|ASE27858.1\|301132_303682_-\|DUF4020-domain-containing-protein	gnl\|CDD\|372518	pfam13212, DUF4020, Domain of unknown function (DUF4020). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is typically between 176 and 195 amino acids in length.	3.87821e-50
CP022044.2\|ASE27854.1\|296648_297749_-\|histidinol-phosphate-aminotransferase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
CP022044.2\|ASE27851.1\|292906_294079_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	1.00795e-71
CP022044.2\|ASE27846.1\|283074_285048_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
CP022044.2\|ASE27857.1\|299224_300301_-\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
CP022044.2\|ASE27855.1\|297767_298940_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
CP022044.2\|ASE27844.1\|280583_281411_+\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.21079e-85
CP022044.2\|ASE27859.1\|303725_304643_-\|protein-deacetylase	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	9.43057e-63
CP022044.2\|AVK72895.1\|281570_282233_+\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	6.87406e-32
CP022044.2\|ASE27852.1\|294249_295539_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
CP022044.2\|AVK72896.1\|288701_289274_-\|hypothetical-protein	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	9.58984e-34
CP022044.2\|AVK72897.1\|289240_289393_-\|multidrug-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	0.000695577
CP022044.2\|ASE27845.1\|282343_283015_+\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.67512e-74
CP022044.2\|ASE27850.1\|292070_292637_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71

>CP022044.2|ASE27849.2|289393_291817_-|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQLVSKDNTTILTQISIDKKHGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPIVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQADELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIERGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQMKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQVLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTA
>CP022044.2|AVK72897.1|289240_289393_-|multidrug-transporter
MTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNNAKKQLEGPQLETLT
>CP022044.2|AVK72896.1|288701_289274_-|hypothetical-protein
MGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLILAYFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGEPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLALIQVASVVGVALLLLAIIVMPILLPALIGLMSKMKDYAKKLSERK
>CP022044.2|ASE27848.1|287567_288416_-|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKNVELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIGSYRSMLKDKLTIQMVK
>CP022044.2|ASE27847.1|285564_287190_-|ABC-transporter-ATP-binding-protein
MITVSNVSLRFADRKLFEGVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWHESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>CP022044.2|ASE27846.1|283074_285048_-|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>CP022044.2|ASE27845.1|282343_283015_+|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>CP022044.2|AVK72895.1|281570_282233_+|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKKWVLWSYFDYWCCAMTDGSTYLHTKNKCTLDEWYIYMDKKYGIIFNFDYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>CP022044.2|ASE27844.1|280583_281411_+|polysaccharide-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>CP022044.2|ASE27843.1|280355_280478_-|hypothetical-protein
MQDFKGMAFLKKRHKKLDKLNYKLETIQEILILGGALIEL
>CP022044.2|ASE27850.1|292070_292637_-|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>CP022044.2|ASE27851.1|292906_294079_-|GNAT-family-N-acetyltransferase
MEEKYMNVIRLKEDKFREALRLSEYAFQYKVDEDRLQQQITKMKESHEVYGIMEGENLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKESHPEEVEKLYETFAELFSGMLVRNEKWWLQAVYDDLTLAIYYDENQTAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQHDSMIKDLEMTVSENEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAQWNNITVRIANHEITIIEEPIDKGIKLDINALSTILFGYRRPLELNELELISGSEEEIRAFESVVPVRKPFIYDFF
>CP022044.2|ASE27852.1|294249_295539_-|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFLSCVQGDTSIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDRMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>CP022044.2|ASE27853.1|295555_296656_-|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>CP022044.2|ASE27854.1|296648_297749_-|histidinol-phosphate-aminotransferase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>CP022044.2|ASE27855.1|297767_298940_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIEMDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQIITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>CP022044.2|ASE27856.1|299062_299161_-|hypothetical-protein
MVGVNQYKDKHELQPWSIFSANFWRERRSNDR
>CP022044.2|ASE27857.1|299224_300301_-|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>CP022044.2|ASE27858.1|301132_303682_-|DUF4020-domain-containing-protein
MEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKLSPLLWRTICSYLNETKMKMDPLLFARWTLLLLETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSTFSFVEQIWNEKMKPHISYYAVPIMMMGIEKIRMLSLRQAALKKRDKENVEKEFQQNDLAFLIQIVKECLAYLCKNNEKKANYYITEMIEANSVLQNRIAIDAMNKNVFVSADEKMKWLLQEGILLDVTYKHEVFQLIKNHFALSLEKTKEEVIQIVLKDLAEERAFDVCFVLDLLFTCDSNSPSTAKGYELMKQKHPHFHSERYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVQQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLAKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMIARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGGITAREYVMLLRIILFMDEIVERGLLIICKSFSDVGGKGNQTELKQLFHEILEKTESIKMYKELYANVFFTLLQTLQEANLLKTEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVLENLQEEM
>CP022044.2|ASE27859.1|303725_304643_-|protein-deacetylase
MTFLGKGESSVWITSEVEIPDELIDHLEKGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAMKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022044_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022044_3

838733-838835

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of CP022044_3

>merge|CP022044|3|838733-838835|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>CP022044|3|3|838733-838835|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
CP022044.2\|ASE28391.1\|848742_849090_-\|DUF4260-domain-containing-protein	unknown	unknown	gnl\|CDD\|379455
CP022044.2\|ASE28383.1\|837225_838170_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
CP022044.2\|ASE28384.1\|839473_840127_-\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE28389.1\|847457_848057_-\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377290
CP022044.2\|ASE28386.1\|842839_843184_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP022044.2\|ASE28381.1\|835895_836405_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
CP022044.2\|ASE28378.1\|830178_831966_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
CP022044.2\|ASE28385.1\|840742_842377_-\|FAD-binding-monooxygenase	unknown	unknown	gnl\|CDD\|366675
CP022044.2\|ASE28380.1\|835051_835903_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
CP022044.2\|ASE32753.1\|840143_840401_-\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE28382.1\|836498_837176_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
CP022044.2\|ASE28377.1\|827514_829056_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
CP022044.2\|AVK72919.1\|832001_833135_-\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|365903
CP022044.2\|ASE32752.1\|833721_834936_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
CP022044.2\|ASE28387.1\|843202_844201_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
CP022044.2\|ASE28379.1\|833391_833622_+\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE28390.1\|848191_848719_-\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
CP022044.2\|ASE28388.1\|844379_845846_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
CP022044.2\|ASE32754.2\|847192_847384_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
CP022044.2\|ASE28376.1\|826790_827420_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP022044.2\|ASE28391.1\|848742_849090_-\|DUF4260-domain-containing-protein	gnl\|CDD\|379455	pfam14079, DUF4260, Domain of unknown function (DUF4260). This family of integral membrane proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 114 and 126 amino acids in length. There is a conserved GLK sequence motif.	2.33749e-49
CP022044.2\|ASE28383.1\|837225_838170_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	3.02275e-148
CP022044.2\|ASE32754.2\|847192_847384_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	3.30665e-06
CP022044.2\|ASE28389.1\|847457_848057_-\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.20741e-71
CP022044.2\|ASE28386.1\|842839_843184_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.46799e-14
CP022044.2\|ASE28378.1\|830178_831966_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
CP022044.2\|ASE28385.1\|840742_842377_-\|FAD-binding-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	7.15748e-109
CP022044.2\|ASE28380.1\|835051_835903_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50852e-87
CP022044.2\|ASE28382.1\|836498_837176_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	6.43775e-21
CP022044.2\|ASE28377.1\|827514_829056_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
CP022044.2\|AVK72919.1\|832001_833135_-\|penicillin-binding-protein	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	2.66756e-58
CP022044.2\|ASE32752.1\|833721_834936_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.4678e-96
CP022044.2\|ASE28387.1\|843202_844201_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.42217e-150
CP022044.2\|ASE28390.1\|848191_848719_-\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	6.28806e-55
CP022044.2\|ASE28388.1\|844379_845846_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
CP022044.2\|ASE28381.1\|835895_836405_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	2.0675e-75

>CP022044.2|ASE28383.1|837225_838170_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLKKIHSINKNIPLVQLLWYYPNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGDLIINESYMKMARQNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHTVLKEK
>CP022044.2|ASE28382.1|836498_837176_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDVIFVFGGSHPGNWQAPLETYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMENGVPKGAILFEKNSLHSIANVIEAKKIFDFTKINRLLFVCKNLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPEKEVHGLEEYVSYYYNLA
>CP022044.2|ASE28381.1|835895_836405_+|DUF3916-domain-containing-protein
MHEKKIRGMKRKTNAMIKRIEEHTKMFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIQPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISIFPTPQLLRFQEVIYDEDTIDEKEIWFIGELS
>CP022044.2|ASE28380.1|835051_835903_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHDVSFNPLPNSFNKVPTTFITRNDIFRSAALQKFMEVTHNA
>CP022044.2|ASE32752.1|833721_834936_-|MFS-transporter
MEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFIGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHIKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRVALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMSIHTITSGVLYSVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRRNKKIKES
>CP022044.2|ASE28379.1|833391_833622_+|hypothetical-protein
MKNTDKRNRLDDMMFHYRVTKNNIVLIEYYGKQIMILKGTAAEKFLNKINHAHNDTEKQLIMAKVTGNFKRGNERQ
>CP022044.2|AVK72919.1|832001_833135_-|penicillin-binding-protein
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDTFNQEFRKMANDLIEGNGA
>CP022044.2|ASE28378.1|830178_831966_+|oligoendopeptidase-F
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSVDENTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNKLRKEKLNVDELRQYDLSVDLVQGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKCSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSDVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>CP022044.2|ASE28377.1|827514_829056_-|alpha-amylase
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDRNHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>CP022044.2|ASE28376.1|826790_827420_+|exosporium-leader-peptide-containing-protein
MSEKYIILHGTALEPNLIGPTLPPIPPFTFPNGPTGITGPTGATGFTGIGITGPTGVTGPTGIGITGPTGATGLGILPVFGTITTDVGIGFSVIVNTNINFTLPGPVSGTTLNPVDNSIIINTTGVYSVSFSIVFVIQAISSSILNLTINDSIQFAIESRIGGGPGVRATSARTDLLSLNQGDVLRVRIREATGDIIYSNASLVVSKVD
>CP022044.2|ASE28384.1|839473_840127_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSARSSVVMVWVVINFMILTPFLFPPTFTIYLYVILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFVLYIFTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>CP022044.2|ASE32753.1|840143_840401_-|hypothetical-protein
MGVGTTAVSAFAGAKLGVAAAVGTVFGGPIGTVAGACIGFGVSIGSSIVTDGIKFNKGDWNHNGKQDSIKDKVKTGIGAALDKIF
>CP022044.2|ASE28385.1|840742_842377_-|FAD-binding-monooxygenase
MEDKYMESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARILGGELSFYHELVSYEQNEQGVIATIRNRETEKESVIHCDYVIAADGAKSKIREQLGISAEGRGTIGGYYMNIYFEADVSEFMQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWKAAESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKAKPKLLETYHEERYPVAKLTTDYAISLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDAVTLHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENIFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMSNLLCDF
>CP022044.2|ASE28386.1|842839_843184_+|ArsR-family-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>CP022044.2|ASE28387.1|843202_844201_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGPDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNARFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>CP022044.2|ASE28388.1|844379_845846_+|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEVLKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPVPTNRPYRTFCGT
>CP022044.2|ASE32754.2|847192_847384_+|Phr-family-secreted-Rap-phosphatase-inhibitor
MIKKISSVFLGLSVFGILATGIHSSFTYQAGHADLPAPQRPDLVQSVDASKDYNSTTTAEKAL
>CP022044.2|ASE28389.1|847457_848057_-|FMN-binding-negative-transcriptional-regulator
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVARRKLVVEELEKVGSEGSRGIAELMRK
>CP022044.2|ASE28390.1|848191_848719_-|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYGFFPKVVTKLGAIGYYHQAEWSYKGREAFGRKDAFVPWDGESTDWMEHHLYVCDKESEELRRHIAFRDYLREYEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN
>CP022044.2|ASE28391.1|848742_849090_-|DUF4260-domain-containing-protein
MQKRIVHFEGLVVFVATIYMYSLYEFSWIIFLIFLLAPDLSMLAYGINNHIGANIYNLFHTYIISILIVIIGVYFKVDTVIMIGLIWTAHIGMDRMFGYGLKYETEFKGTHIQRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022044_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022044_5

3976898-3977006

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022044_5

>merge|CP022044|5|3976898-3977006|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>CP022044|5|5|3976898-3977006|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
CP022044.2\|ASE31495.1\|3982699_3983902_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
CP022044.2\|ASE31486.1\|3973837_3974476_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
CP022044.2\|ASE31489.1\|3976249_3976867_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371823
CP022044.2\|ASE31498.1\|3986702_3987383_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
CP022044.2\|ASE31494.1\|3981731_3982577_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
CP022044.2\|ASE31483.1\|3972143_3972542_-\|globin	unknown	unknown	gnl\|CDD\|381281
CP022044.2\|AVK73021.1\|3985317_3986007_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
CP022044.2\|ASE31488.1\|3975307_3976201_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
CP022044.2\|ASE31492.1\|3979894_3980830_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
CP022044.2\|ASE31481.1\|3970847_3971021_-\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE31493.1\|3980836_3981604_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
CP022044.2\|ASE31482.1\|3971250_3972144_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
CP022044.2\|ASE31496.1\|3984067_3985180_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
CP022044.2\|ASE31487.1\|3974494_3975292_+\|NAD(+)-kinase	unknown	unknown	gnl\|CDD\|235317
CP022044.2\|ASE31491.1\|3977777_3978518_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE-[asymmetrical]	unknown	unknown	gnl\|CDD\|184187
CP022044.2\|ASE31497.1\|3986003_3986690_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
CP022044.2\|ASE31484.1\|3972722_3973301_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
CP022044.2\|ASE31485.1\|3973447_3973807_+\|hypothetical-protein	unknown	unknown	unknown
CP022044.2\|ASE31480.1\|3968901_3970728_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
CP022044.2\|ASE31490.1\|3977274_3977637_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP022044.2\|ASE31495.1\|3982699_3983902_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.53819e-17
CP022044.2\|ASE31486.1\|3973837_3974476_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
CP022044.2\|ASE31489.1\|3976249_3976867_-\|hypothetical-protein	gnl\|CDD\|371823	pfam11962, Peptidase_G2, Peptidase_G2, IMC autoproteolytic cleavage domain. This domain is found at the very C-terminus of bacteriophage parallel beta-helical tailspike proteins. It carries the enzymic residues that induce autoproteolytic cleavage to bring about maturation of the folding process of the helix in a chaperone-like manner. The domain thus mediates the assembly of a large tailspike protein and then releases itself after maturation. These C-terminal regions that autoproteolytically release themselves after maturation are exchangeable between functionally unrelated N-terminal proteins and have been identified in a number of bacteriophage tailspike proteins.	3.23443e-33
CP022044.2\|ASE31494.1\|3981731_3982577_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	7.45097e-148
CP022044.2\|ASE31483.1\|3972143_3972542_-\|globin	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	3.57374e-69
CP022044.2\|AVK73021.1\|3985317_3986007_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
CP022044.2\|ASE31492.1\|3979894_3980830_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.94506e-22
CP022044.2\|ASE31498.1\|3986702_3987383_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	6.29242e-108
CP022044.2\|ASE31493.1\|3980836_3981604_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.59471e-20
CP022044.2\|ASE31482.1\|3971250_3972144_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	1.47887e-91
CP022044.2\|ASE31496.1\|3984067_3985180_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	8.16909e-55
CP022044.2\|ASE31487.1\|3974494_3975292_+\|NAD(+)-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
CP022044.2\|ASE31491.1\|3977777_3978518_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE-[asymmetrical]	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
CP022044.2\|ASE31497.1\|3986003_3986690_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
CP022044.2\|ASE31484.1\|3972722_3973301_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
CP022044.2\|ASE31480.1\|3968901_3970728_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
CP022044.2\|ASE31488.1\|3975307_3976201_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.12116e-100

>CP022044.2|ASE31489.1|3976249_3976867_-|hypothetical-protein
MGRFGTAEESYSWFIANGTNETDHNIGAKWLAHNGEMYIDGASYNASGTDFAQMFEAVDNTLIDVGYFVTFSSEEKIRIATSNDSFILGISSATPALIGNSGALSWQKRYKTDSFGKRQYVRTESQDIQPLLNTEWDPACKYIARKDRTEWLPVGLIGQMLVRDDGTCETHGYCRPNDNGIATKSESGFFVIKRTGDNQILILFR
>CP022044.2|ASE31488.1|3975307_3976201_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLPSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHLAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>CP022044.2|ASE31487.1|3974494_3975292_+|NAD(+)-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>CP022044.2|ASE31486.1|3973837_3974476_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>CP022044.2|ASE31485.1|3973447_3973807_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>CP022044.2|ASE31484.1|3972722_3973301_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>CP022044.2|ASE31483.1|3972143_3972542_-|globin
MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>CP022044.2|ASE31482.1|3971250_3972144_-|DsbA-family-protein
MDKQEAKHINMPSPSACEYKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSYDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPSLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>CP022044.2|ASE31481.1|3970847_3971021_-|hypothetical-protein
MKKTYILLIILAVIVSFFLYILSLLQAFPKMIAFPLLFGVIVIALSYFNHKKRFKGF
>CP022044.2|ASE31480.1|3968901_3970728_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSTSSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>CP022044.2|ASE31490.1|3977274_3977637_-|hypothetical-protein
MKKKSSKQKRKCPPFYLPMYGINNWCSIRAAALEELEGQEASLKNKARPKYVSLENAVMSRIIDNRKTKRQQKNKPLSTHTEQIVPSEQTEKKTEENIPVAINKKAESEIPAAIINQVKK
>CP022044.2|ASE31491.1|3977777_3978518_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE-[asymmetrical]
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHILDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>CP022044.2|ASE31492.1|3979894_3980830_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>CP022044.2|ASE31493.1|3980836_3981604_-|class-I-SAM-dependent-methyltransferase
MNFWNENKKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>CP022044.2|ASE31494.1|3981731_3982577_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRVGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>CP022044.2|ASE31495.1|3982699_3983902_-|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>CP022044.2|ASE31496.1|3984067_3985180_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANECMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGLWEKAVESCVKSFRYAIPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSIFDQQKNRYRLFF
>CP022044.2|AVK73021.1|3985317_3986007_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>CP022044.2|ASE31497.1|3986003_3986690_+|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>CP022044.2|ASE31498.1|3986702_3987383_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	KJ094023	Listeria phage LP-101, complete genome	3876-3902	4	0.852
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NC_022766	Bacillus phage Glittering, complete genome	9024-9050	5	0.815
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	1229260-1229286	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	438058-438084	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	127169-127195	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	1227597-1227623	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	850854-850880	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	513839-513865	6	0.778
CP022044_2	2.1\|670403\|27\|CP022044\|CRISPRCasFinder	670403-670429	27	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	498252-498278	6	0.778

1. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to KJ094023 (Listeria phage LP-101, complete genome) position: , mismatch: 4, identity: 0.852

cgtctttggctcttctggtttctcttc	CRISPR spacer
catttctggctcttctggtttcttttc	Protospacer
*.*.*.*****************.***

2. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NC_022766 (Bacillus phage Glittering, complete genome) position: , mismatch: 5, identity: 0.815

cgtctttggctcttctggtttctcttc	CRISPR spacer
gttcaatggctcttctggtttctcatc	Protospacer
  **  ****************** **

3. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

4. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

5. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

6. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

7. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

8. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctat	Protospacer
*.   ******************** .

9. spacer 2.1|670403|27|CP022044|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 6, identity: 0.778

cgtctttggctcttctggtttctcttc	CRISPR spacer
cagggttggctcttctggtttctctgt	Protospacer
*.   ******************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1018290 : 1055165

uncultured_Caudovirales_phage(32.26%)

protease,head,tail,portal,terminase,holin,capsid,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE28546.1\|1018290_1019403_-\|transposase	transposase	A0A286QQB7	Streptococcus_phage	2.0e-79	44.7
ASE28547.1\|1019480_1019696_-	hypothetical protein	NA	NA	NA	NA
ASE28548.1\|1019701_1020505_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
ASE28549.1\|1020504_1021299_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
ASE28550.1\|1021295_1022069_-	phosphonates import ATP-binding protein PhnC	W5SAS9	Pithovirus	1.6e-11	27.5
ASE28551.1\|1022152_1023091_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
ASE28552.1\|1024898_1025138_-	DUF896 domain-containing protein	NA	NA	NA	NA
ASE28553.1\|1025183_1025840_-	resolvase	NA	NA	NA	NA
ASE28554.2\|1025792_1026602_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	1.4e-18	62.2
ASE28555.1\|1026689_1027496_-	GNAT family acetyltransferase	NA	NA	NA	NA
ASE28556.1\|1027496_1028039_-	DUF1700 domain-containing protein	NA	NA	NA	NA
ASE28557.1\|1028031_1028361_-	PadR family transcriptional regulator	NA	NA	NA	NA
ASE28558.1\|1029091_1029241_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
AVK72930.1\|1029237_1030326_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.0e-49	35.9
ASE28559.1\|1030690_1030918_-	DNA-binding protein	A0A1Z1LZP5	Bacillus_phage	6.2e-25	84.3
ASE28560.1\|1031423_1031546_-	hypothetical protein	NA	NA	NA	NA
ASE28561.1\|1031629_1031962_+	hypothetical protein	A0A1C8E989	Bacillus_phage	4.1e-25	60.0
ASE28562.1\|1032130_1032400_-	DNA-binding protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	2.3e-34	95.1
ASE28563.1\|1032634_1032859_-	hypothetical protein	A0A2H4J852	uncultured_Caudovirales_phage	1.9e-10	89.3
AVK72931.1\|1032919_1033852_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	8.2e-156	84.2
ASE28564.1\|1033851_1034277_-\|holin	holin	A0A1B1P787	Bacillus_phage	1.8e-70	98.6
ASE28565.1\|1034388_1034664_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P7E8	Bacillus_phage	6.8e-34	78.8
ASE28566.1\|1034681_1036688_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	5.6e-101	48.0
ASE28567.1\|1036763_1039415_-	hypothetical protein	H0USX5	Bacillus_phage	5.8e-223	73.8
ASE28568.1\|1040933_1043369_-	hypothetical protein	D2XR26	Bacillus_phage	2.1e-09	60.3
ASE28569.1\|1043583_1044834_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.5e-181	83.8
ASE28570.1\|1044846_1045008_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	2.0e-22	94.3
ASE28571.1\|1045051_1045423_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	4.7e-46	73.9
ASE28572.1\|1045427_1046021_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.3e-92	84.1
ASE28573.1\|1046021_1046351_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.1e-46	81.7
ASE28574.1\|1046347_1046704_-	hypothetical protein	D2XR21	Bacillus_phage	2.7e-30	60.3
ASE28575.1\|1046696_1046996_-\|head,tail	phage head-tail adapter protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
ASE28576.1\|1046992_1047271_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	6.7e-21	58.4
ASE28577.1\|1047267_1047558_-	hypothetical protein	A6XMJ7	Bacillus_virus	4.8e-06	36.6
ASE28578.1\|1047594_1048758_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	3.2e-80	54.7
ASE28579.1\|1048771_1049356_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.0e-39	50.5
ASE28580.1\|1049321_1050533_-\|portal	phage portal protein	J9QE83	Clostridium_phage	1.1e-139	60.7
ASE28581.1\|1050548_1052237_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.9e-251	73.0
ASE28582.1\|1052233_1052605_-	hypothetical protein	A0A2H4JA84	uncultured_Caudovirales_phage	3.3e-15	50.0
ASE28583.1\|1052770_1053067_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	2.7e-28	61.5
ASE28584.1\|1053398_1053560_+	hypothetical protein	NA	NA	NA	NA
ASE28585.1\|1053831_1054254_+	pilus assembly protein HicB	A0A1L2JY34	Aeribacillus_phage	6.8e-41	59.1
ASE28586.1\|1054340_1054766_-	hypothetical protein	NA	NA	NA	NA
ASE28587.1\|1054886_1055165_-	DNA-binding protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8

DBSCAN-SWA_2

1067503 : 1079057

Bacillus_phage(68.42%)

integrase

attL 1061596:1061612|attR 1085392:1085408

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1061596:1061612	attL	NA	NA	NA	NA
ASE28601.1\|1067503_1067788_-	hypothetical protein	A6M999	Geobacillus_virus	1.8e-34	72.0
ASE28602.1\|1067888_1068053_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.5e-09	55.6
ASE28603.1\|1068182_1068956_-	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.4e-79	62.1
AVK72933.1\|1068903_1069083_-	hypothetical protein	NA	NA	NA	NA
ASE28604.1\|1069172_1069952_-	DNA (cytosine-5-)-methyltransferase	A0A0K2CYZ1	Paenibacillus_phage	3.6e-64	49.0
ASE28605.1\|1069966_1070539_-	dUTPase	A0A0A7AQI4	Bacillus_phage	3.4e-80	73.8
ASE28606.1\|1070633_1070756_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
ASE28607.1\|1070758_1071388_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	1.3e-27	41.9
ASE28608.1\|1071384_1071555_-	hypothetical protein	NA	NA	NA	NA
ASE28609.1\|1071572_1072403_-	hypothetical protein	U5PWH5	Bacillus_phage	1.7e-35	38.4
ASE28610.1\|1072338_1073097_-	replication protein	A0A1W6JNI1	Staphylococcus_phage	3.6e-61	54.9
ASE28611.1\|1073093_1073366_-	hypothetical protein	A0A0M4S680	Bacillus_phage	2.9e-37	82.0
ASE28612.1\|1073379_1074051_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	1.0e-27	45.8
ASE28613.1\|1074047_1074530_-	ATPase	E5DV79	Deep-sea_thermophilic_phage	1.1e-34	48.1
ASE28614.1\|1074544_1074808_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	2.9e-10	61.1
ASE28615.1\|1074779_1075127_-	hypothetical protein	NA	NA	NA	NA
ASE28616.1\|1075086_1075272_-	hypothetical protein	NA	NA	NA	NA
ASE28617.1\|1075247_1075514_-	group-specific protein	S5MC08	Brevibacillus_phage	1.1e-25	55.8
ASE32758.1\|1075622_1076336_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	3.0e-49	48.6
ASE28618.1\|1076347_1076548_-	XRE family transcriptional regulator	A0A0C5AJQ3	Paenibacillus_phage	1.4e-09	52.6
ASE28619.1\|1076823_1077237_+	XRE family transcriptional regulator	A0A0M4QX29	Bacillus_phage	5.1e-25	47.1
ASE28620.1\|1077259_1077688_+	hypothetical protein	Q9T201	Bacillus_phage	2.8e-34	55.1
ASE28621.1\|1077703_1077871_+	hypothetical protein	NA	NA	NA	NA
ASE28622.1\|1077912_1078383_+\|integrase	integrase	A0A0S2SXS9	Bacillus_phage	3.5e-38	55.2
ASE28623.1\|1078427_1079057_+\|integrase	site-specific integrase	A0A0S2SXP1	Bacillus_phage	2.1e-54	60.3
1085392:1085408	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1285463 : 1361652

Bacillus_phage(92.98%)

protease,head,tRNA,tail,portal,terminase,holin,capsid,integrase

attL 1318861:1318877|attR 1363443:1363459

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE28809.1\|1285463_1288229_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	1.0e-84	27.9
ASE28810.1\|1288576_1289083_-	septum formation initiator	NA	NA	NA	NA
ASE28811.1\|1289172_1289940_-	RNA-binding protein	NA	NA	NA	NA
ASE28812.1\|1289955_1290219_-	YggT family protein	NA	NA	NA	NA
ASE28813.1\|1290225_1290696_-	cell division protein SepF	NA	NA	NA	NA
ASE28814.1\|1290715_1291390_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
ASE28815.1\|1291386_1292205_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
ASE28816.1\|1292321_1292606_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
ASE28817.1\|1292774_1293554_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
ASE28818.1\|1293711_1294431_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
ASE28819.1\|1294450_1295377_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
ASE28820.1\|1295680_1296841_-	cell division protein FtsZ	NA	NA	NA	NA
ASE28821.1\|1296880_1298182_-	cell division protein FtsA	NA	NA	NA	NA
ASE28822.1\|1298554_1299352_-	cell division protein DivIB	NA	NA	NA	NA
ASE28823.1\|1299450_1300356_-	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
ASE32760.1\|1300417_1301512_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
ASE28824.1\|1301617_1302709_-	stage V sporulation protein E	NA	NA	NA	NA
ASE28825.1\|1302799_1304152_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
ASE28826.1\|1304152_1305127_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
ASE28827.1\|1305149_1306625_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
ASE28828.1\|1306833_1308750_-	stage V sporulation protein D	NA	NA	NA	NA
ASE28829.1\|1308831_1310982_-	penicillin-binding protein	NA	NA	NA	NA
ASE28830.1\|1311003_1311366_-	cell division protein FtsL	NA	NA	NA	NA
ASE28831.1\|1311381_1312314_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase	NA	NA	NA	NA
ASE28832.1\|1312684_1314301_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
ASE28833.1\|1314380_1315271_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
ASE28834.1\|1315645_1316119_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
ASE28835.1\|1316153_1316660_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	3.0e-11	34.7
ASE28836.1\|1316789_1316963_-	50S ribosomal protein L32	NA	NA	NA	NA
ASE28837.1\|1317024_1317525_-	DUF177 domain-containing protein	NA	NA	NA	NA
ASE28838.1\|1317941_1318538_+	hypothetical protein	A0A0U3TZ58	Bacillus_phage	1.4e-68	74.2
ASE28839.1\|1318570_1319194_-	hypothetical protein	H0USY2	Bacillus_phage	1.1e-98	83.4
1318861:1318877	attL	NA	NA	NA	NA
ASE28840.1\|1319135_1320317_-	cell division protein FtsK	H0USY1	Bacillus_phage	2.5e-186	81.4
ASE28841.1\|1320432_1320615_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.8e-22	90.0
ASE28842.1\|1320617_1320920_-	hypothetical protein	Q2I8E3	Bacillus_phage	6.3e-49	97.0
ASE28843.1\|1321103_1321310_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	3.2e-20	72.1
ASE28844.1\|1321313_1321496_+	hypothetical protein	A0A288WFV9	Bacillus_phage	1.3e-12	81.6
ASE28845.1\|1321501_1322083_+	hypothetical protein	H0USX9	Bacillus_phage	7.3e-102	93.2
ASE28846.1\|1322146_1322851_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	1.4e-112	82.9
ASE28847.1\|1322850_1323276_-\|holin	holin	A0A1B1P787	Bacillus_phage	7.5e-72	99.3
ASE28848.1\|1323280_1324258_-\|integrase	integrase	D2XR30	Bacillus_phage	2.8e-170	91.6
ASE28849.1\|1324404_1324680_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	2.2e-32	77.4
ASE28850.1\|1324704_1326819_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	4.6e-186	59.0
ASE28851.1\|1326806_1328789_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	7.6e-268	76.8
ASE28852.1\|1328785_1330270_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	1.1e-260	86.8
ASE28853.1\|1335332_1335473_-	LysR family transcriptional regulator	A0A1B1P7R9	Bacillus_phage	3.8e-17	93.5
ASE28854.1\|1335474_1335921_-	hypothetical protein	A0A1B1P7S9	Bacillus_phage	1.5e-51	81.2
ASE28855.1\|1335944_1336529_-\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	7.5e-107	99.5
ASE28856.1\|1336542_1336902_-	structural protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
ASE28857.1\|1336898_1337336_-	hypothetical protein	A0A1B1P7R6	Bacillus_phage	2.3e-76	98.6
ASE28858.1\|1337323_1337680_-\|head,tail	head-tail adaptor protein	A0A1B1P8G2	Bacillus_phage	5.9e-62	98.3
ASE28859.1\|1337657_1337933_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	2.3e-42	97.8
ASE28860.1\|1337941_1338241_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
ASE28861.1\|1338218_1339406_-\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	2.0e-207	94.4
ASE28862.1\|1339402_1340158_-\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	2.1e-133	95.6
ASE28863.1\|1340135_1341350_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	3.1e-219	92.6
ASE28864.1\|1341365_1343138_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.0
ASE28865.1\|1343118_1343499_-\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
ASE28866.1\|1343660_1344023_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	3.0e-61	94.2
ASE28867.1\|1344015_1344231_-	hypothetical protein	NA	NA	NA	NA
ASE28868.1\|1344618_1345440_-	hypothetical protein	NA	NA	NA	NA
ASE28869.1\|1345713_1346256_-\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.3e-88	88.9
ASE28870.1\|1346252_1346723_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	2.9e-48	62.5
ASE28871.1\|1346743_1346914_-	hypothetical protein	A0A1B1P735	Bacillus_phage	1.4e-05	85.7
ASE28872.1\|1347028_1347151_-	DUF3983 domain-containing protein	NA	NA	NA	NA
ASE28873.1\|1347168_1347498_-	permease	NA	NA	NA	NA
ASE28874.1\|1347531_1347888_-	hypothetical protein	NA	NA	NA	NA
ASE28875.1\|1347905_1348154_-	XRE family transcriptional regulator	A0A0S2MV80	Bacillus_phage	2.0e-37	95.1
ASE28876.1\|1348146_1348329_-	hypothetical protein	NA	NA	NA	NA
ASE28877.1\|1348273_1348558_-	hypothetical protein	NA	NA	NA	NA
ASE28878.1\|1348588_1348795_-	hypothetical protein	NA	NA	NA	NA
ASE28879.1\|1349539_1350046_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	3.5e-84	85.7
ASE28880.1\|1350107_1350299_+	hypothetical protein	Q3HKS8	Bacillus_phage	4.3e-19	83.9
ASE28881.1\|1350382_1350802_+	fosfomycin resistance bacillithiol transferase FosB2	Q2LI91	Bacillus_phage	4.0e-62	95.2
ASE28882.1\|1350848_1351268_-	hypothetical protein	Q2LI92	Bacillus_phage	4.5e-77	100.0
ASE28883.1\|1351425_1351656_-	hypothetical protein	Q2LI93	Bacillus_phage	9.7e-34	100.0
ASE28884.1\|1351681_1352128_-	dUTP diphosphatase	A0A1B1P7U8	Bacillus_phage	1.9e-70	90.5
ASE28885.1\|1352194_1352398_-	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.2e-30	100.0
ASE28886.1\|1352372_1352516_-	Fur-regulated basic protein FbpA	A0A1B1P7V2	Bacillus_phage	2.1e-18	100.0
ASE32762.1\|1352524_1353424_-	RNA polymerase subunit sigma-70	A0A1B1P7V3	Bacillus_phage	6.1e-164	99.7
ASE28887.1\|1353507_1353795_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	1.5e-44	100.0
ASE28888.1\|1353807_1354062_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	3.1e-41	97.6
ASE28889.1\|1354076_1354250_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	98.2
ASE28890.1\|1354275_1354470_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.4e-30	95.3
ASE28891.1\|1354485_1355289_-	hypothetical protein	A0A1B1P7U2	Bacillus_phage	3.0e-146	99.3
ASE28892.1\|1355257_1355974_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.6e-106	93.1
ASE28893.1\|1355978_1356155_-	hypothetical protein	A0A0U3SQC4	Bacillus_phage	2.6e-23	87.9
ASE28894.1\|1356184_1356349_-	hypothetical protein	A0A0U3B230	Bacillus_phage	2.3e-21	90.7
ASE28895.1\|1356405_1356606_-	DNA-binding protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
ASE28896.1\|1356657_1356885_-	XRE family transcriptional regulator	NA	NA	NA	NA
ASE28897.1\|1357104_1357473_+	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
AVK72946.1\|1357516_1357630_-	hypothetical protein	NA	NA	NA	NA
ASE28898.1\|1357734_1357884_-	hypothetical protein	NA	NA	NA	NA
ASE28899.1\|1357896_1358994_-	hypothetical protein	NA	NA	NA	NA
ASE28900.1\|1359429_1359774_+	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	9.5e-17	38.4
AVK72947.1\|1359863_1359998_-	hypothetical protein	NA	NA	NA	NA
ASE28901.1\|1360000_1360189_-	hypothetical protein	NA	NA	NA	NA
ASE28902.1\|1360210_1360456_-	hypothetical protein	NA	NA	NA	NA
ASE28903.1\|1360521_1361652_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	1.4e-64	39.1
1363443:1363459	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2390261 : 2432495

Staphylococcus_phage(26.67%)

protease,head,tRNA,portal,terminase,holin,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE29989.1\|2390261_2391521_-\|tRNA	Tyrosine--tRNA ligase 2	K4F5T3	Cronobacter_phage	2.0e-88	42.4
ASE29990.1\|2391885_2392803_-	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
ASE29991.1\|2393191_2393596_-	SET domain-containing protein	NA	NA	NA	NA
ASE29992.1\|2393753_2395256_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.3e-08	27.0
ASE29993.1\|2395281_2396340_-	endonuclease	NA	NA	NA	NA
ASE32799.1\|2396651_2397065_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
ASE29994.1\|2397061_2397418_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
ASE29995.1\|2397445_2397685_-	DUF3947 domain-containing protein	NA	NA	NA	NA
ASE29996.1\|2397763_2398066_-	DUF3955 domain-containing protein	NA	NA	NA	NA
ASE29997.1\|2398136_2398652_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
ASE29998.1\|2398795_2399200_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
ASE29999.1\|2399249_2400212_-	NERD domain-containing protein	NA	NA	NA	NA
ASE30001.1\|2400647_2401613_+	lipoprotein	NA	NA	NA	NA
ASE30002.1\|2401837_2402590_-	siderophore ABC transporter ATP-binding protein	NA	NA	NA	NA
ASE30003.1\|2402586_2403651_-	iron ABC transporter permease	NA	NA	NA	NA
ASE30004.1\|2403647_2404664_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.3e-58	37.1
ASE30005.1\|2404683_2405697_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
ASE30006.1\|2406111_2406789_-	DNA-binding response regulator	NA	NA	NA	NA
ASE30007.1\|2407677_2408145_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.4e-47	61.3
AVK72976.1\|2408186_2408294_-	hypothetical protein	NA	NA	NA	NA
ASE30008.1\|2408393_2410820_-	ribonuclease R	Q0GXV6	Lactococcus_phage	9.8e-92	41.2
ASE30009.1\|2410962_2411706_-	carboxylesterase	NA	NA	NA	NA
ASE30010.1\|2411864_2412098_-	preprotein translocase subunit SecG	NA	NA	NA	NA
ASE30011.1\|2412192_2412885_-	LrgB family protein	NA	NA	NA	NA
ASE30012.1\|2412881_2413250_-\|holin	holin-like protein	NA	NA	NA	NA
ASE30013.1\|2413525_2414476_+	nucleoside hydrolase	NA	NA	NA	NA
ASE30014.1\|2414964_2415477_-	hypothetical protein	NA	NA	NA	NA
ASE30015.1\|2415634_2416093_-	hypothetical protein	NA	NA	NA	NA
ASE30016.2\|2416203_2416401_-	hypothetical protein	NA	NA	NA	NA
ASE30017.1\|2416403_2416538_-	hypothetical protein	NA	NA	NA	NA
ASE30018.1\|2416509_2417319_-	endonuclease	B3GVX7	Streptococcus_phage	1.4e-13	41.9
ASE30019.1\|2417493_2418123_-	hypothetical protein	NA	NA	NA	NA
ASE30020.1\|2418310_2418661_-	DUF2513 domain-containing protein	NA	NA	NA	NA
ASE30021.1\|2418805_2419282_+	hypothetical protein	NA	NA	NA	NA
ASE30022.1\|2419347_2419524_-	hypothetical protein	NA	NA	NA	NA
ASE30023.1\|2419520_2419733_-	hypothetical protein	NA	NA	NA	NA
ASE30024.1\|2419738_2419984_-	DNA-binding protein	A0A290FZJ4	Caldibacillus_phage	3.9e-09	39.5
ASE30025.1\|2419980_2420226_-	hypothetical protein	NA	NA	NA	NA
ASE30026.1\|2420363_2420582_+	hypothetical protein	NA	NA	NA	NA
ASE30027.1\|2420600_2421338_+	transcriptional regulator	NA	NA	NA	NA
ASE30028.1\|2421673_2421940_+	hypothetical protein	NA	NA	NA	NA
ASE30029.1\|2422036_2422624_+	hypothetical protein	NA	NA	NA	NA
AVK72977.1\|2422610_2424188_+\|terminase	terminase	W5RV59	Staphylococcus_phage	1.5e-48	25.4
ASE30030.1\|2424242_2424731_+	HNH endonuclease	A0A1G5SA96	Enterococcus_phage	7.1e-18	38.9
ASE30031.1\|2425147_2426458_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	1.8e-71	37.7
ASE30032.1\|2426429_2426927_+\|head,protease	HK97 family phage prohead protease	A0A060AB24	Staphylococcus_phage	5.2e-40	52.5
ASE30033.1\|2426947_2428027_+\|capsid	phage major capsid protein	A0A1G5SCB8	Enterococcus_phage	1.4e-45	37.6
ASE30034.1\|2428113_2429094_+\|capsid	phage major capsid protein	A0A1I9KK60	Lactobacillus_phage	4.5e-11	26.4
ASE30035.1\|2429161_2430028_-	hypothetical protein	NA	NA	NA	NA
ASE30036.1\|2430150_2431056_-	recombinase	A0A1B1IQT7	uncultured_Mediterranean_phage	7.8e-18	27.1
ASE30037.1\|2431199_2432495_-	enolase	A0A1X9I5Z8	Streptococcus_phage	6.4e-183	75.4

DBSCAN-SWA_5

3097325 : 3105702

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE30634.1\|3097325_3098633_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
ASE30635.1\|3098721_3099441_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
ASE30636.1\|3099433_3099688_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
ASE30637.1\|3099684_3100368_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
ASE30638.1\|3100351_3102571_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.7e-162	41.2
ASE30639.1\|3102555_3103971_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
ASE30640.1\|3104077_3105118_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
ASE30641.1\|3105114_3105702_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1

DBSCAN-SWA_6

3246100 : 3276770

Bacillus_phage(70.73%)

protease,head,tail,terminase,capsid,integrase

attL 3250442:3250457|attR 3265106:3265121

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE30766.1\|3246100_3247480_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.0e-85	38.3
ASE30767.1\|3247540_3248665_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.2e-188	85.8
ASE30768.1\|3249380_3249725_-	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	7.2e-33	61.3
ASE30769.1\|3250259_3251435_+	hypothetical protein	A0A1B0T6A5	Bacillus_phage	6.3e-52	33.0
3250442:3250457	attL	NA	NA	NA	NA
ASE30770.1\|3251431_3251599_+	complement C1q protein	NA	NA	NA	NA
ASE30771.1\|3251766_3251901_+	hypothetical protein	NA	NA	NA	NA
ASE30772.1\|3251928_3252270_-	XRE family transcriptional regulator	A0A1B0T6A7	Bacillus_phage	1.2e-16	41.2
ASE30773.1\|3252444_3252666_+	XRE family transcriptional regulator	NA	NA	NA	NA
ASE30774.1\|3252683_3253415_+	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	1.5e-125	91.8
ASE30775.1\|3253459_3253810_+	DNA-binding protein	A0A1B0T6C2	Bacillus_phage	3.9e-50	79.3
ASE32820.1\|3253809_3253974_+	hypothetical protein	A0A0U3B230	Bacillus_phage	1.9e-20	92.5
ASE30776.1\|3254003_3254189_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	2.7e-18	70.7
ASE30777.1\|3254185_3255058_+	DNA replication protein DnaD	A0A0S2GLI6	Bacillus_phage	1.0e-51	61.7
ASE30778.1\|3255026_3255830_+	hypothetical protein	A0A1B1P7U2	Bacillus_phage	1.1e-145	99.2
ASE30779.1\|3255845_3256040_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.3e-26	87.5
ASE30780.1\|3256064_3256238_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	3.6e-25	96.5
ASE30781.1\|3256252_3256507_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	2.0e-40	96.4
ASE30782.1\|3256518_3256935_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	1.4e-14	43.0
ASE32821.1\|3256950_3257415_+	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	7.2e-20	47.7
ASE30783.1\|3257452_3257632_+	hypothetical protein	A0A1B1P8C9	Bacillus_phage	7.5e-26	93.2
ASE30784.1\|3257674_3257965_+	transcriptional regulator	G9B1P0	Bacillus_phage	5.0e-11	58.5
ASE30785.1\|3258164_3258764_+	hypothetical protein	A0A0S2SXN5	Bacillus_phage	9.3e-44	45.6
ASE30786.1\|3258801_3258972_+	hypothetical protein	NA	NA	NA	NA
ASE30787.1\|3258984_3259170_+	hypothetical protein	NA	NA	NA	NA
ASE30788.1\|3259195_3259333_+	hypothetical protein	NA	NA	NA	NA
ASE30789.1\|3259376_3259781_+	hypothetical protein	D0R7I0	Paenibacillus_phage	1.3e-12	52.8
ASE30790.1\|3259780_3260227_+	hypothetical protein	A0A0A7AQW7	Bacillus_phage	1.7e-58	72.3
ASE30791.1\|3260261_3260450_+	hypothetical protein	A0A218KC21	Bacillus_phage	2.3e-17	74.1
ASE30792.1\|3260481_3260856_+	hypothetical protein	NA	NA	NA	NA
ASE30793.1\|3260961_3261318_+	hypothetical protein	NA	NA	NA	NA
ASE30794.1\|3261345_3261534_+	hypothetical protein	G9J1S8	Bacillus_phage	1.5e-08	50.8
ASE30795.1\|3261508_3261661_+	DUF3983 domain-containing protein	NA	NA	NA	NA
ASE30796.1\|3261776_3261947_+	hypothetical protein	A0A1B1P735	Bacillus_phage	1.0e-08	82.1
ASE30797.1\|3261974_3262457_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.1e-71	83.1
ASE30798.1\|3262456_3262750_+\|integrase	integrase	W8CYP1	Bacillus_phage	1.8e-40	86.6
ASE30799.1\|3262777_3262999_+	hypothetical protein	A0A0S2GLG4	Bacillus_phage	1.4e-34	100.0
ASE30800.1\|3263131_3263242_+	hypothetical protein	NA	NA	NA	NA
ASE30801.1\|3263310_3263409_-	hypothetical protein	NA	NA	NA	NA
ASE30802.1\|3263587_3263890_+	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.6e-31	63.9
ASE30803.1\|3263886_3264054_+	DNA-binding protein	A0A142F1N8	Bacillus_phage	1.6e-09	62.2
ASE30804.1\|3264050_3264197_+	hypothetical protein	NA	NA	NA	NA
ASE30805.1\|3264297_3264669_+	hypothetical protein	R9TQ46	Paenibacillus_phage	5.1e-24	54.1
ASE30806.1\|3264665_3266354_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.1e-243	71.2
3265106:3265121	attR	NA	NA	NA	NA
ASE32822.1\|3267537_3268128_+\|head,protease	HK97 family phage prohead protease	Q2I8F8	Bacillus_phage	2.8e-32	44.3
ASE30807.1\|3268146_3269337_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.0e-09	24.7
ASE30808.1\|3269352_3269610_+	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	42.0
ASE30809.1\|3269606_3269879_+	DNA-packaging protein	R9TMB7	Paenibacillus_phage	1.4e-18	52.8
ASE30810.1\|3269875_3270175_+\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
ASE30811.1\|3270167_3270524_+	hypothetical protein	D2XR21	Bacillus_phage	6.5e-29	57.8
ASE30812.1\|3270520_3270850_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.1e-41	76.1
ASE30813.1\|3270850_3271420_+\|tail	phage tail protein	A0A0U4JWV5	Exiguobacterium_phage	7.2e-54	58.0
ASE30814.1\|3271424_3271787_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.6e-28	50.8
ASE30815.1\|3271897_3272011_+	hypothetical protein	NA	NA	NA	NA
ASE30816.1\|3272028_3275964_+	tape measure protein	D2XR25	Bacillus_phage	1.5e-153	73.0
ASE30817.1\|3275960_3276770_+\|tail	phage tail family protein	A0A290FZP5	Caldibacillus_phage	3.6e-59	44.5

DBSCAN-SWA_7

3280658 : 3284526

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE30820.1\|3280658_3282293_+	hypothetical protein	A0A2H4JG80	uncultured_Caudovirales_phage	1.1e-152	59.6
ASE30821.1\|3282310_3282790_+	hypothetical protein	A0A2H4J980	uncultured_Caudovirales_phage	1.1e-52	84.4
ASE30822.1\|3282884_3283124_+	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
ASE30823.1\|3283196_3283340_+	hypothetical protein	D2XR32	Bacillus_phage	8.4e-20	97.9
ASE30824.1\|3283339_3284137_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.4e-109	68.7
ASE30825.1\|3284190_3284526_-	hypothetical protein	A0A1C8E989	Bacillus_phage	6.2e-21	52.7

DBSCAN-SWA_8

4638565 : 4647298

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE32134.1\|4638565_4639828_+	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	4.4e-11	31.5
ASE32135.1\|4639926_4640691_-	alpha/beta hydrolase	NA	NA	NA	NA
ASE32138.1\|4642693_4643458_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.7e-119	92.7
ASE32860.1\|4643472_4644528_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-167	88.3
ASE32139.1\|4644552_4645146_-	DUF3139 domain-containing protein	NA	NA	NA	NA
ASE32140.1\|4645326_4646055_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	6.0e-61	100.0
ASE32141.1\|4646171_4646285_+	methyltransferase	W8CYT3	Bacillus_phage	1.6e-05	95.8
ASE32142.1\|4646425_4647298_+	aminoglycoside adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.9e-66	45.9

DBSCAN-SWA_9

4956434 : 4963558

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
ASE32465.1\|4956434_4957697_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	1.1e-51	47.4
ASE32466.1\|4957821_4958973_-	S-layer homology domain-containing protein	NA	NA	NA	NA
ASE32467.1\|4959173_4960307_+	ATPase	NA	NA	NA	NA
ASE32468.1\|4960338_4960803_-	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	1.2e-14	43.2
ASE32469.1\|4960839_4961040_-	transcriptional regulator	A0A288WG80	Bacillus_phage	9.0e-20	76.6
ASE32470.1\|4961093_4961279_+	hypothetical protein	NA	NA	NA	NA
ASE32471.1\|4961205_4961508_+	hypothetical protein	A0A288WG38	Bacillus_phage	3.1e-24	51.5
ASE32472.1\|4961504_4961687_+	hypothetical protein	Q2I8E2	Bacillus_phage	2.4e-19	80.0
ASE32473.1\|4961805_4962996_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.2e-148	64.4
ASE32474.1\|4962937_4963558_+	hypothetical protein	Q2LIA9	Bacillus_phage	1.5e-84	74.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection