CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP015444	Lactobacillus helveticus strain FAM8627 chromosome, complete genome	2 crisprs	csa3,cas14j,cas14k,RT,DinG,Cas14u_CAS-V,DEDDh,cas3,cas2,cas4,cas5,cas7,cas8b2,cas6	0	10	15	0
CP015445	Lactobacillus helveticus strain FAM8627 plasmid pFAM8627, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP015444_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015444_1

314545-314723

TypeV

Consensus_repeat	Method
CGTGGGTTCAAATCCCACAT	PILER-CR

2 spacers

cas14k,cas14j

The CRISPR arrays of CP015444_1

>merge|CP015444|1|314545-314723|PILER-CR
CGTGGGTTCAAATCCCACATCCTCCTCTGATTGGTCCATTGGAGCAGTGGTTTATCTCGCCTCCCTGTCACGGAGGAGATCGTGGGTTCAAATCCCACATGGACCGTTTATGGCGGAATTGGTGAAGGGGTTAACACACTGGTTTGTGGATCCAGCATACGTGGGTTCGAATCCCACAT

>CP015444|1|1|314545-314723|PILER-CR
CGTGGGTTCAAATCCCACAT	CCTCCTCTGATTGGTCCATTGGAGCAGTGGTTTATCTCGCCTCCCTGTCACGGAGGAGAT
CGTGGGTTCAAATCCCACAT	GGACCGTTTATGGCGGAATTGGTGAAGGGGTTAACACACTGGTTTGTGGATCCAGCATA
CGTGGGTTCGAATCCCACAT

Protein	Signature genes	Signature genes Name	Protein_function
CP015444.1\|AUJ27271.1\|315825_317016_+\|transposase	cas14j	-	gnl\|CDD\|223747
CP015444.1\|AUJ28654.1\|306516_307302_-\|hydrolase	unknown	unknown	gnl\|CDD\|143607
CP015444.1\|AUJ27278.1\|326694_327363_+\|GMP-synthase	unknown	unknown	gnl\|CDD\|153212
CP015444.1\|AUJ27275.1\|321592_322798_-\|multidrug-transporter	unknown	unknown	gnl\|CDD\|340949
CP015444.1\|AUJ27263.1\|304336_305299_-\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|235821
CP015444.1\|AUJ27273.1\|319278_319809_-\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235365
CP015444.1\|AUJ27267.1\|309375_309579_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
CP015444.1\|AUJ27270.1\|312816_314142_+\|transposase	cas14k	-	gnl\|CDD\|223747
CP015444.1\|AUJ27279.1\|327405_328224_-\|glutamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270407
CP015444.1\|AUJ27274.1\|320099_321569_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
CP015444.1\|AUJ27276.1\|322924_324007_+\|peptidase-M42	unknown	unknown	gnl\|CDD\|349906
CP015444.1\|AUJ27269.1\|311576_312077_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP015444.1\|AUJ27264.1\|305317_306496_-\|aspartate-aminotransferase	unknown	unknown	gnl\|CDD\|181219
CP015444.1\|AUJ27266.1\|308266_309049_+\|integrase	unknown	unknown	gnl\|CDD\|225382
CP015444.1\|AUJ27280.1\|328365_328827_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378956
CP015444.1\|AUJ27265.1\|307622_307928_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235507
CP015444.1\|AUJ27272.1\|317937_319266_-\|uracil-permease	unknown	unknown	gnl\|CDD\|236744
CP015444.1\|AUJ27277.1\|324111_325734_+\|ABC-F-family-ATPase	unknown	unknown	gnl\|CDD\|237894
CP015444.1\|AUJ27262.1\|303315_304251_+\|integrase	unknown	unknown	gnl\|CDD\|225382
CP015444.1\|AUJ27268.1\|309789_310236_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP015444.1\|AUJ27271.1\|315825_317016_+\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.41504e-46
CP015444.1\|AUJ28654.1\|306516_307302_-\|hydrolase	gnl\|CDD\|143607	cd07583, nitrilase_5, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	1.91264e-143
CP015444.1\|AUJ27278.1\|326694_327363_+\|GMP-synthase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	2.3354e-54
CP015444.1\|AUJ27275.1\|321592_322798_-\|multidrug-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.09163e-154
CP015444.1\|AUJ27263.1\|304336_305299_-\|2-dehydropantoate-2-reductase	gnl\|CDD\|235821	PRK06522, PRK06522, 2-dehydropantoate 2-reductase; Reviewed.	3.31665e-66
CP015444.1\|AUJ27273.1\|319278_319809_-\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase	gnl\|CDD\|235365	PRK05205, PRK05205, bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR.	6.77217e-98
CP015444.1\|AUJ27267.1\|309375_309579_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	5.8942e-35
CP015444.1\|AUJ27270.1\|312816_314142_+\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.0182e-19
CP015444.1\|AUJ27279.1\|327405_328224_-\|glutamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270407	cd13689, PBP2_BsGlnH, Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.00543e-77
CP015444.1\|AUJ27274.1\|320099_321569_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.98006e-47
CP015444.1\|AUJ27276.1\|322924_324007_+\|peptidase-M42	gnl\|CDD\|349906	cd05656, M42_Frv, M42 Peptidase, endoglucanases. Peptidase M42 family, Frv (Frv Operon Protein; Endo-1 4-Beta-Glucanase; Cellulase Protein; Endoglucanase; Endo-1 4-Beta-Glucanase Homolog; Glucanase; EC. 3.2.1.4) subfamily. Frv is a co-catalytic metallopeptidase, found in archaea and bacteria, including Pyrococcus horikoshii tetrahedral shaped phTET1 (DAPPh1; FrvX; PhDAP aminopeptidase; PhTET aminopeptidase; deblocking aminopeptidase), phTET2 (DAPPh2) and phTET3 (DAPPh3), Haloarcula marismortui TET (HmTET) as well as Bacillus subtilis YsdC. All of these exhibit aminopeptidase and deblocking activities. The HmTET is a broad substrate aminopeptidase capable of degrading large peptides. PhTET2, which shares 24% identity with HmTET, is a cobalt-activated peptidase and possibly a deblocking aminopeptidase, assembled as a 12-subunit tetrahedral dodecamer, while PhTET1 can be alternatively assembled as a tetrahedral dodecamer or as an octahedral tetracosameric structure. The active site in such a self-compartmentalized complex is located on the inside such that substrate sizes are limited, indicating function as possible peptide scavengers. PhTET2 cleaves polypeptides by a nonprocessive mechanism, preferring N-terminal hydrophobic or uncharged polar amino acids. Streptococcus pneumoniae PepA (SpPepA) also forms dodecamer with tetrahedral architecture, and exhibits selective substrate specificity to acidic amino acids with the preference to glutamic acid, with the substrate binding S1 pocket containing an Arg allows electrostatic interactions with the N-terminal acidic residue in the substrate. The YsdC gene is conserved in a number of thermophiles, archaea and pathogenic bacterial species; the closest structural homolog is Thermotoga maritima FrwX (34% identity), which is annotated as either a cellulase or an endoglucanase, and is possibly involved in polysaccharide biosynthesis or degradation.	9.94368e-100
CP015444.1\|AUJ27269.1\|311576_312077_+\|acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.86332e-13
CP015444.1\|AUJ27264.1\|305317_306496_-\|aspartate-aminotransferase	gnl\|CDD\|181219	PRK08068, PRK08068, transaminase; Reviewed.	0
CP015444.1\|AUJ27266.1\|308266_309049_+\|integrase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.40645e-56
CP015444.1\|AUJ27280.1\|328365_328827_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|378956	pfam12802, MarR_2, MarR family. The Mar proteins are involved in the multiple antibiotic resistance, a non-specific resistance system. The expression of the mar operon is controlled by a repressor, MarR. A large number of compounds induce transcription of the mar operon. This is thought to be due to the compound binding to MarR, and the resulting complex stops MarR binding to the DNA. With the MarR repression lost, transcription of the operon proceeds. The structure of MarR is known and shows MarR as a dimer with each subunit containing a winged-helix DNA binding motif.	1.23933e-06
CP015444.1\|AUJ27265.1\|307622_307928_-\|hypothetical-protein	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	3.8263e-38
CP015444.1\|AUJ27272.1\|317937_319266_-\|uracil-permease	gnl\|CDD\|236744	PRK10720, PRK10720, uracil transporter; Provisional.	6.11828e-143
CP015444.1\|AUJ27277.1\|324111_325734_+\|ABC-F-family-ATPase	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
CP015444.1\|AUJ27262.1\|303315_304251_+\|integrase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.04682e-71

>CP015444.1|AUJ27270.1|312816_314142_+|transposase
MRKKVVPRNKAKYEHLASEYLVAGNSKLDQCSHASHDLYNRALYDLRQGFFKRNYVKGYCDLDQRFKKRYSARESMLYHSLFYVQSAQQTLKEVNTIWSAWLKALKAYQANPGKFTGRPRMPKYLAKGQRHVFFVTNQNAKVKDDYLIIPKLGFKLKLTPHLKAIQRVAFKPVYGGYKAIVQYKTNRDIDYLPDNGRYMGIDPGVDNAFACVANIQKAPLLVNGRAIKSVNQYYNKERSRLKALQARYHQLESIVDTQQGKKPVYRETKAMRRITAWRNRKIRQFAHKASKRIVDYALSCGANTIVIGNNKSWKRSSDMGRKNNQNFIGIPHKVMIDMIQYKGNLAGISVIRTNESYTSQTSALDHEKPCWENGNQSRKRQGKTPINRRIHRGLFQSNNGRLVNADINGALQIIRKVFPKFSLDEGIEDAVLHPVKWSPLI
>CP015444.1|AUJ27269.1|311576_312077_+|acetyltransferase
MIIKPLISEDEAKETSRLFQKCWQNTYKDILPDVFLDNIPENAWIKRLNESGRHNLIFIDDDNKIRAAVSYGRPRDTRMLGCGELMALYVEPDFQGFNIGKTLLNAAENELKKMGYGKIYLWCIDGDENARQFFEHFGWVNNATEKFVEIAGKEYKYLLYSHKLLV
>CP015444.1|AUJ27268.1|309789_310236_+|hypothetical-protein
MINNWVSSSKELQLLVDDYLLTVNYRSVIENDLVNYTQGIESYFRNERLTLRDKINKFIEELPESYRELLSEHVGNTDDWIGKLVSTRVFLTHGDRENMAVFNPYKLVQMTKIFGFMVRIFILQKLGITIDKPKILNKFKNVLTAHYY
>CP015444.1|AUJ27267.1|309375_309579_-|cold-shock-protein
MQTGTVKWFNADKGFGFITGSSDNKDVFVHFSAIKTDGFKSLEEGQKVSYDVEQGSRGPQATNVVPQ
>CP015444.1|AUJ27266.1|308266_309049_+|integrase
MSTTILSFQNRVVIETLHNEGRYEGRSLRYIANYLGFSKTTIFNELHRLNSEYQTGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGCSIEESPHKVETRQEFGYFEADTVFSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERQTGTQVYFAHAYSPHERGSNENRN
>CP015444.1|AUJ27265.1|307622_307928_-|hypothetical-protein
MSNWDTKFVKKGLTFDDVLLIPAESHVLPNEVDLSTKLADNIKLNIPIISTGMDTVTEGAMAIAMALQGGLGVVLFKGVAAGPVIASGMTYLIVSLFNLHY
>CP015444.1|AUJ28654.1|306516_307302_-|hydrolase
MKIKVALAQFNIQFADPDKNQQRVAELTSIAAKAGADVIVFPEMWNIGYALNQLDRLADDGGRTTTKLFYRLARQYQISIVGGSVAVKEGGHFYNRTLIVDPLGQVVGKYDKVHLFRLMNEHRYLTAGNQENYFRLAGVPSASFICYDLRFPEWIRTVARHGSAVLYFPAEWPAVRIPQWTTMLKARAIENQAFVVAVNRVGDDPDNHYNGHSLAIDPLGNVIADAGENDGITYAELDLTQLATVRGAIPVFVDRRPDLYK
>CP015444.1|AUJ27264.1|305317_306496_-|aspartate-aminotransferase
MEFQQSKLLGRLPKQFFASLVAKVNHKIESGVDVINLGQGNPDKPTPEYIVKATQKWVADPATHKYSPFQGLPEFKQAAADFYAEKYGAHFDPEKEVAILGGSKIGLVELPWALMNPGDTYLLPDPGYPDYFSGAALGGVKFETVPLLAKNNFLPDLKAIPEAVAQRAKFFYLNYPNNPTGAVATKKFYEELVSWAKKYHVGIISDFAYGALGFDGQAPRSFMQTPGAKDVGIELYTFSKTFNMAGWRIAFAVGNQDIIGALNLIQDHLFVSLFPALQRAAIDALQGSQRDAEIAKIVGRYEERRNAFVDAAEKIGWHAFVPKGTFYAWMPVPAGYTSESFADLLLDKAGVAVAPGNGFGKHGEGYVRIGLLIEPARLKEAVARIAKLHLFD
>CP015444.1|AUJ27263.1|304336_305299_-|2-dehydropantoate-2-reductase
MTLKYTVLGAGAMGLRFGVLLQELAGAKVDFVDNWAPEVKTIQQQGGVYVSRDHEDRHLVPIKIYSPEDYQGDPDVFIVFAKQMTLADLLKRSAHFFHPDHQYVFSGMNGMGHIEKINQYFPKEHVVAGTCLIGTVLNKAGDVDFIGKSGAGSINMAAQTEKADDRVKQIVADFTAANINPHLNNNFLGTLLTKVVFNSVINTICTLFEIQMGQFIDYDGSEKLGKQLINEAYDVAERAGIQLLSTREEEWQTIKYVSSVTNPLHYPSMYQDMSKDRPTEVDYINGYIYQLGKKYNYEASTHDFLRNLVHLAENTRKFRK
>CP015444.1|AUJ27262.1|303315_304251_+|integrase
MSTTILSFQNRVVIETLHNEGRYEGRSLRYIANYLGFSKTTIFNELHRLNSEYQTGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGCSIEESPHKVETRQEFGYFEADTVFSGKCKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERQTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHKLIQINWYLNSRPLKCLNWHTPIESFLLNLRH
>CP015444.1|AUJ27271.1|315825_317016_+|transposase
MLKGIKLRLYPNRTQQNQLEQMFGNDRFVWNQMLAMMNERYQNNKALPFLGKFKLNYLLKPLKKEYPFLKNSDSSSLQVVNEFLTQSWKNFFQDKSGQIGKPRFHSRKYLKKSYTGKSIIKTAGKRYLKIPKLGYVKTSKTGVLQNTKIKRYTVVLEPTGKYYLSLQAEISEPEKYSLTSKQVGIDVGVADLAILSNGLKYPSFNSSYFEKKAKVWQRKYARRRHLAKLLVLQDRNKKVPCPRSLESFANWQKAQKSKAKCQAKAANQRRDYLHKLTTHLVKQYDVIAIEDLKTKNLQKNHHLAKSIANASWRIFRQMLEYKCEWYGKKLIAVDPKNTSRICSKCGYNSGAKPLEIREWTCSKCQTKHDRDINAAINILHKGSTKLNGQGLAMVTS
>CP015444.1|AUJ27272.1|317937_319266_-|uracil-permease
MSKKENFRNPDAILDVYEKPEFGQGVLLSLQHMFAMFGSTVLVPILIGINPSIALLSSGIGTLVHMILTHFKIPAYLGSSFAFVATMQALMKADGYPAVAQSAIASGLVYVIVALIIAKVGSGWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMNNQKYDLTYFGVAIFTLVMTLVFQMCFKGFTSLVSIMLGIICGYVLACFLGIVDFSGVEKAAWFSIPSLDVMGISYHFKWYPAAILAMAPIAFVTMTEHMGHIMVLNSLTKRNFFKNPGLHRTMMGDGISTIIAGFIGGPPTTSYGENIGVLAMTKVHSVWVLAGAAVCAIIFSFVGKLAALIESIPMPVIGGISFLLFGTIASNGLKILVDDNVDFGEKRNMLIASVILVIGIGGAYLQLGNFQLTSVALSTIIGIILNWVLPKKAASEKALEEKNKQKQDGKIYQ
>CP015444.1|AUJ27273.1|319278_319809_-|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase
MAKEIIDTIGMKRALMRMTYEIVERNKGTKNLVLVGIKTRGLYLAQRIAANLKKLEDVEISVGAIDVSQYRDDLPESKKEKMIHNQQLDFDITDKNVVLVDDVLFTGRTIRAALDALMDQGRPAKINLAILVDRGHRELPIRPDFIGKNIPTAMNEEVKVSMTEVDDKDSIELINK
>CP015444.1|AUJ27274.1|320099_321569_+|MFS-transporter
MNKKQLFMVTLALLLANIMSGLDATIINTAIPAIVSDLHGIQYMGWIVACFLLGMSVSVPIWGKLGERMGNKFAFELSLALFILGSLLEGIAPDIYFFLIARILMGVGAGGMGSLPYVIVGYIYPNIKRRTVILGYIAASFSAASIAGPLVGGWIVDTLSWHWVFYINVPLGLIAIILSFVYYKGIRKPNKNTQFDKLGAFTLIAGLTSFLIGIQLLGMVSLPVVLGFIILGILLLVVFIRAERKAKSPVVPLSVFTNKALVGDFLIFALAWGSYIAVNTYLPMWAQAILGTSALVGGMTLIPNSIVDIVGSQTAPYFLRHVNNYRLLIANLTIMAITAVGLILAPISTPYQILALIAAFSGFGVGSIFVILQIKVQVDASEKDMAPATSLSFLIRILALTIMAAIYGVIMNLALGRGIAGHPGITMTMMNKLIDAESAKSLPVQLLPTMRKIFYGGIREIMIVSLVLLVAAYVVNYLYNRHEAKIMAE
>CP015444.1|AUJ27275.1|321592_322798_-|multidrug-transporter
MKEKPIWKKNLFVLSIAVFIAGIAFSEVMPFLPLYIDTLGKFSHQQLNFWSGFIYSGTYLVSALISPWWGKLADKKGRKPMTLRASLGMAIVIGCMGLVTNVYQLFILRMLQGVFAGFVSNSNALIATETPKEKSGQALGTMASSFTAGNLLGPFIGGALASIFSYRVTFFITGGLLLISFFLSLFFVHETDFKPVTEKKLDKASGIIKELRSPQLIFGLLLTTLIIQAANNSINPIVSLYVKQLMANHGNVVFISGVIAALPGIATFLAASRFGAFGDRIGTHKIIVGGFIGATILFFLTAFVQNTVELGILRFLVGFTDACLFPQVQTLLTKNTPAKITGRIFSWNQSAMYVGNIFGPLLGSTISGLTSYSMVFIVTAIIVVFNLILFKFNVINNLRQK
>CP015444.1|AUJ27276.1|322924_324007_+|peptidase-M42
MQKEQEIQMLKEFSDANSTSGFEEEFVKLFTSYAEKTANIEVDGMLNVYASKKENKGDRPVIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKPPHFMTAAERNNVPDVVDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGKDFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGACVTARKVKPDLCLVLESCPADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKNNIPYTRSVRTGGGQDGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAIIRDITQEKLDSFKKF
>CP015444.1|AUJ27277.1|324111_325734_+|ABC-F-family-ATPase
MITVSDLSLKFGGRTLYEDVNLKFTPGNCYGVIGANGAGKSTFLKLLEGKLEPTTGSISIDPNERMSSLNQDHFAFEDFTVMDTVIQGHKELYQVMKEKDALYAKPDFGDEDGVKAAELESKFAELDGWNAEANASKLLQSLDIPESEHQMLMKELPESEKVKVLLAQALFGNPDILLLDEPTNGLDVHTVEWLENFLADYPNIVIVVSHDRHFLNQVCTEMCDVDRGKIQLYVGNYDFWYESSKLANELVANQNAKKEEKIKQLQEFIARFSANASKSRQATSRKKQLDKITLDDIKPSSRKYPFVKFEMHRDLGNDLVKVENVSYSVDGEKILDNVSFIVRPGDKVAFLSRNALATTALLDIIAGKIKPDTGTVTWGQTTAFNYMSRDLNANFNNDDLTILDWLRQYATKEQDDNTFLRGFLGRMLFSGEEIEKKIKVLSGGEKVRCQLSRMMLEPANVLIMDDPTNHLDLESITALNDALVAYPGSILFTSHDHEFIQTIANHIIEVGPKGIVSRQDTTYDEFLDKESIQDQVEKIY
>CP015444.1|AUJ27278.1|326694_327363_+|GMP-synthase
MRVNVLQHAPNEGPGSIQDWCHEHNHEMFVYYPTDFGILPTIDETDLLVILGSPNSPNDKLDWIKNERVLIKQMLKANKPILGICFGSQQSAKTLGYEVLDAPAKEVGWAPVYLQDHTIENIPKKLTALHWHQQMSEIPEDAKLLFSSDLVKNQGYLLGNNVIGLQFHFEPKEDNVCEIAINDGAYALENNDLHQTPQEIIAHGVPKENKDVMFVLLDYITK
>CP015444.1|AUJ27279.1|327405_328224_-|glutamine-ABC-transporter-substrate-binding-protein
MKKRFFLSTLLIGIALFTLSACSQNKKQNVYQTVKSTKTINWGVKADTPLFGSMNIKTGKINGFEIDLAKALTKEMLGKNAKANFVTTTANTKIQLLKNRNVDAVIAAMTITPEREKQVDFSKPYFPAGQSIMVAKNNKIKNVKDLNNKKVLVVKGTTAADAVKKFAPKAEILQFDDYGQAFTALKAGQGDAFVTDNGILVGILRDSSGYKLVGGNFTNQPYGIAVNKGQTEMDKQINLALTKLEKDGTYNRLLKKWFGNIPGFNVKTAEKY
>CP015444.1|AUJ27280.1|328365_328827_+|MarR-family-transcriptional-regulator
MKISESEKLNMAIVHGNRAYQQWDQDHELSDYLSVILYELLLRKKLTQKQLIGLTDLPKQSINKGIKILHDSGYLAMSVDPHDKRVRFCELTAAGNKYAKQKMQSLFRLEEQTAQKLGSEKMQLLTDLLTEWSNTFWDFLNEERSKECKHSKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP015444_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015444_2

1281005-1282287

Unclear

Consensus_repeat	Method
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CRISPRCasFinder
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CRT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	PILER-CR

19 spacers

cas2,cas4,cas3,cas5,cas7,cas8b2,cas6

The CRISPR arrays of CP015444_2

>merge|CP015444|2|1281005-1282287|CRISPRCasFinder,CRT,PILER-CR
AATTATTTTCCTCTTAAGTTAGATAAAATCAGCATATTTAGTAAAGTTGGTGTAAAATTCGGCTTTATTTACATTTCCCTTAGATTAAATAAAGACCTACCAACTACTAAAACTTTTAGATTAAACTTTCAGAAATTCACATTTCTCTTAAATTAAATAAAAACTCACTCAAAAAGAGGTACTATAGATCATTCAAGTTTCTTTACATTTCTCTTAAGTTAAATAAAAACAGCAAGCTCTTTGTAGTTTTCTACTTTTTTTGAAACTTTACATTTCTCTTAAGTTAAATAAAAACTAGTCTTGCACCTGATGAAGTATATAATCGTGAATTCTTTACATTTCTCTTAAGTTAAATAAAAACCTTCTGCATTTTCAATATTAAAGCGCCCACAAATCTCTTTACATTTCTCTTAAGTTAAATAAAAACAAAGTCCAACGACCAAAAGAAAGGATATAGATAGACTTTACATTTCTCTTAAGTTAAATAAAAACAATTTTGACAAAATTTTCTTCTAATTTTTCGCCATACTTTACATTTCTCTTAAGTTAAATAAAAACACACTTTAGAAGTAAGACGACAACGGCTATTAATGCTTTACATTTCTCTTAAGTTAAATAAAAACCGTTTGCAGCAGATTTCCTTAATGATGATTTGATTGGCTTTACATTTCTCTTAAGTTAAATAAAAACGCTTGAGTTTGTGCAGAGCCCTGAAGCTTTAAAGCTCTTTACATTTCTCTTAAGTTAAATAAAAACTTAACGTCCTTAGCCAATTCCTTTTCTGACTTCTTCTTTACATTTCTCTTAAGTTAAATAAAAACCGAGGTACAAAAAATGAAAGAATTTACTATTTATGCCTTTACATTTCTCTTAAGTTAAATAAAAACGCTATTTAAATCGCTTACTTTTTCCATACAAAAATACTTTACATTTCTCTTAAGTTAAATAAAAACCAAGATTTTAGGCACCAATCAAGTGAACGTCTCAGCACTTTACATTTCTCTTAAGTTAAATAAAAACAGTGCTGATGCATTAATTGATAATACTATTCAAGCACTTTACATTTCTCTTAAGTTAAATAAAAACTGATCAGTTGGAAAGTGAAAATGAAAGGTTAAGAACTTTACATTTCTCTTAAGTTAAATAAAAACATCTCCTCAAAAATATTTTGTAGCACCGTTTTAAAACTTTACATTTCTCTTAAGTTAAATAAAAACAATTGTTCCCGCATATACAGGTTCCATCCGTGGTATCTTTACATTTCTCTTAAGTTAAATAAAAAC

>CP015444|2|1|1281005-1282287|CRISPRCasFinder
AATTATTTTCCTCTTAAGTTAGATAAAATC	AGCATATTTAGTAAAGTTGGTGTAAAATTCGGCTTT
ATTTACATTTCCCTTAGATTAAATAAAGAC	CTACCAACTACTAAAACTTTTAGATTAAACTTTCAGAA
ATTCACATTTCTCTTAAATTAAATAAAAAC	TCACTCAAAAAGAGGTACTATAGATCATTCAAGTTT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AGCAAGCTCTTTGTAGTTTTCTACTTTTTTTGAAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TAGTCTTGCACCTGATGAAGTATATAATCGTGAATT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CTTCTGCATTTTCAATATTAAAGCGCCCACAAATCT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AAAGTCCAACGACCAAAAGAAAGGATATAGATAGA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AATTTTGACAAAATTTTCTTCTAATTTTTCGCCATA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	ACACTTTAGAAGTAAGACGACAACGGCTATTAATG
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CGTTTGCAGCAGATTTCCTTAATGATGATTTGATTGG
CTTTACATTTCTCTTAAGTTAAATAAAAAC	GCTTGAGTTTGTGCAGAGCCCTGAAGCTTTAAAGCT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TTAACGTCCTTAGCCAATTCCTTTTCTGACTTCTT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CGAGGTACAAAAAATGAAAGAATTTACTATTTATGC
CTTTACATTTCTCTTAAGTTAAATAAAAAC	GCTATTTAAATCGCTTACTTTTTCCATACAAAAATA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CAAGATTTTAGGCACCAATCAAGTGAACGTCTCAGCA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AGTGCTGATGCATTAATTGATAATACTATTCAAGCA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TGATCAGTTGGAAAGTGAAAATGAAAGGTTAAGAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	ATCTCCTCAAAAATATTTTGTAGCACCGTTTTAAAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AATTGTTCCCGCATATACAGGTTCCATCCGTGGTAT
CTTTACATTTCTCTTAAGTTAAATAAAAAC

>CP015444|2|1|1281005-1282287|CRT
AATTATTTTCCTCTTAAGTTAGATAAAATC	AGCATATTTAGTAAAGTTGGTGTAAAATTCGGCTTT
ATTTACATTTCCCTTAGATTAAATAAAGAC	CTACCAACTACTAAAACTTTTAGATTAAACTTTCAGAA
ATTCACATTTCTCTTAAATTAAATAAAAAC	TCACTCAAAAAGAGGTACTATAGATCATTCAAGTTT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AGCAAGCTCTTTGTAGTTTTCTACTTTTTTTGAAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TAGTCTTGCACCTGATGAAGTATATAATCGTGAATT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CTTCTGCATTTTCAATATTAAAGCGCCCACAAATCT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AAAGTCCAACGACCAAAAGAAAGGATATAGATAGA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AATTTTGACAAAATTTTCTTCTAATTTTTCGCCATA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	ACACTTTAGAAGTAAGACGACAACGGCTATTAATG
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CGTTTGCAGCAGATTTCCTTAATGATGATTTGATTGG
CTTTACATTTCTCTTAAGTTAAATAAAAAC	GCTTGAGTTTGTGCAGAGCCCTGAAGCTTTAAAGCT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TTAACGTCCTTAGCCAATTCCTTTTCTGACTTCTT
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CGAGGTACAAAAAATGAAAGAATTTACTATTTATGC
CTTTACATTTCTCTTAAGTTAAATAAAAAC	GCTATTTAAATCGCTTACTTTTTCCATACAAAAATA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	CAAGATTTTAGGCACCAATCAAGTGAACGTCTCAGCA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AGTGCTGATGCATTAATTGATAATACTATTCAAGCA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	TGATCAGTTGGAAAGTGAAAATGAAAGGTTAAGAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	ATCTCCTCAAAAATATTTTGTAGCACCGTTTTAAAA
CTTTACATTTCTCTTAAGTTAAATAAAAAC	AATTGTTCCCGCATATACAGGTTCCATCCGTGGTAT
CTTTACATTTCTCTTAAGTTAAATAAAAAC

>CP015444|2|2|1281140-1282287|PILER-CR
TTCACATTTCTCTTAAATTAAATAAAAACT	CACTCAAAAAGAGGTACTATAGATCATTCAAGTTTC
TTTACATTTCTCTTAAGTTAAATAAAAACA	GCAAGCTCTTTGTAGTTTTCTACTTTTTTTGAAAC
TTTACATTTCTCTTAAGTTAAATAAAAACT	AGTCTTGCACCTGATGAAGTATATAATCGTGAATTC
TTTACATTTCTCTTAAGTTAAATAAAAACC	TTCTGCATTTTCAATATTAAAGCGCCCACAAATCTC
TTTACATTTCTCTTAAGTTAAATAAAAACA	AAGTCCAACGACCAAAAGAAAGGATATAGATAGAC
TTTACATTTCTCTTAAGTTAAATAAAAACA	ATTTTGACAAAATTTTCTTCTAATTTTTCGCCATAC
TTTACATTTCTCTTAAGTTAAATAAAAACA	CACTTTAGAAGTAAGACGACAACGGCTATTAATGC
TTTACATTTCTCTTAAGTTAAATAAAAACC	GTTTGCAGCAGATTTCCTTAATGATGATTTGATTGGC
TTTACATTTCTCTTAAGTTAAATAAAAACG	CTTGAGTTTGTGCAGAGCCCTGAAGCTTTAAAGCTC
TTTACATTTCTCTTAAGTTAAATAAAAACT	TAACGTCCTTAGCCAATTCCTTTTCTGACTTCTTC
TTTACATTTCTCTTAAGTTAAATAAAAACC	GAGGTACAAAAAATGAAAGAATTTACTATTTATGCC
TTTACATTTCTCTTAAGTTAAATAAAAACG	CTATTTAAATCGCTTACTTTTTCCATACAAAAATAC
TTTACATTTCTCTTAAGTTAAATAAAAACC	AAGATTTTAGGCACCAATCAAGTGAACGTCTCAGCAC
TTTACATTTCTCTTAAGTTAAATAAAAACA	GTGCTGATGCATTAATTGATAATACTATTCAAGCAC
TTTACATTTCTCTTAAGTTAAATAAAAACT	GATCAGTTGGAAAGTGAAAATGAAAGGTTAAGAAC
TTTACATTTCTCTTAAGTTAAATAAAAACA	TCTCCTCAAAAATATTTTGTAGCACCGTTTTAAAAC
TTTACATTTCTCTTAAGTTAAATAAAAACA	ATTGTTCCCGCATATACAGGTTCCATCCGTGGTATC
TTTACATTTCTCTTAAGTTAAATAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP015444.1\|AUJ28034.1\|1286835_1287549_-\|type-I-B-CRISPR-associated-protein-Cas5	cas5	cd09658_cas5_CAS-I-B	gnl\|CDD\|273860
CP015444.1\|AUJ28039.1\|1295178_1295493_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274102
CP015444.1\|AUJ28037.1\|1290231_1290987_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG1583_cas6_CAS-I:CAS-III:CAS-IV	gnl\|CDD\|273848
CP015444.1\|AUJ28031.1\|1278186_1280850_-\|DNA-polymerase-I	unknown	unknown	gnl\|CDD\|235591
CP015444.1\|AUJ28040.1\|1295899_1296877_-\|bacteriocin	unknown	unknown	gnl\|CDD\|375122
CP015444.1\|AUJ28035.1\|1287535_1288438_-\|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR	cas7	cd09687_cas7_CAS-I-B	gnl\|CDD\|274215
CP015444.1\|AUJ28025.1\|1271100_1271622_-\|hypothetical-protein	unknown	unknown	unknown
CP015444.1\|AUJ28026.1\|1271779_1273714_-\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234752
CP015444.1\|AUJ28027.1\|1274944_1276276_-\|chromosome-replication-initiation-protein	unknown	unknown	gnl\|CDD\|226138
CP015444.1\|AUJ28023.1\|1269175_1270225_+\|integrase	unknown	unknown	gnl\|CDD\|225382
CP015444.1\|AUJ28695.1\|1282471_1282753_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP015444.1\|AUJ28029.1\|1276748_1277351_-\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|234620
CP015444.1\|AUJ28694.1\|1274004_1274913_-\|primosomal-protein-DnaI	unknown	unknown	gnl\|CDD\|236353
CP015444.1\|AUJ28030.1\|1277347_1278178_-\|DNA-formamidopyrimidine-glycosylase	unknown	unknown	gnl\|CDD\|234899
CP015444.1\|AUJ28024.1\|1270419_1270950_-\|hypothetical-protein	unknown	unknown	unknown
CP015444.1\|AUJ28038.1\|1294279_1295161_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366488
CP015444.1\|AUJ28036.1\|1288456_1290214_-\|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1	cas8b2	cd09754_cas8b2_CAS-I-B	gnl\|CDD\|187884
CP015444.1\|AUJ28028.1\|1276278_1276746_-\|transcriptional-regulator-NrdR	unknown	unknown	gnl\|CDD\|234774
CP015444.1\|AUJ28033.1\|1284263_1286693_-\|hypothetical-protein	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|273707
CP015444.1\|AUJ28032.1\|1283756_1284248_-\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|366863

Protein	Function_ID	Function_description	E-value
CP015444.1\|AUJ28034.1\|1286835_1287549_-\|type-I-B-CRISPR-associated-protein-Cas5	gnl\|CDD\|273860	TIGR01895, conserved_hypothetical_protein, CRISPR-associated protein Cas5, subtype I-B/TNEAP. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. This family is represented by TM1800 from Thermotoga maritima. It is related to TIGR01868 (CRISPR-associated protein, CT1976 family).	1.28135e-27
CP015444.1\|AUJ28037.1\|1290231_1290987_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|273848	TIGR01877, CRISPR-associated_endoribonuclease_Cas6_1, CRISPR-associated endoribonuclease Cas6. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This broadly distributed, highly divergent Cas family is now characterized as an endoribonuclease that generates guide RNAs for host defense against phage and other invaders. The family contains a C-terminal motif GXGXXXXXGXG, where the each X between two Gly is hydrophobic and the spacer XXXXX contains (usually) one Arg or Lys. The seed alignment for the current version of this model has gappy columns removed. Members of this protein family are found associated with several different CRISPR/cas system subtypes, and consequently we designate this family Cas6.	1.48576e-17
CP015444.1\|AUJ28032.1\|1283756_1284248_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|366863	pfam01930, Cas_Cas4, Domain of unknown function DUF83. This domain has no known function. The domain contains three conserved cysteines at its C-terminus.	1.31481e-59
CP015444.1\|AUJ28040.1\|1295899_1296877_-\|bacteriocin	gnl\|CDD\|375122	pfam17312, Helveticin_J, Bacteriocin helveticin-J. Bacteriocins are biologically active proteins or protein complexes that display a bactericidal mode of action towards closely related species. Bacteriocins produced by lactic acid bacteria are grouped into different classes. Class III of bacteriocins includes large heat liable proteins. Lactobacillus helveticus 481 produces a 37-kDa bacteriocin called helveticin J which is a representative for Clas III bacteriocins.	9.20737e-130
CP015444.1\|AUJ28035.1\|1287535_1288438_-\|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR	gnl\|CDD\|274215	TIGR02585, conserved_protein, CRISPR-associated protein Cas7/Cst2/DevR, subtype I-B/TNEAP. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. This clade is a member of the DevR family (TIGR01875) and includes the DevR protein of Myxococcus xanthus, a protein whose expression appears to be regulated through a number of means, including both location and autorepression; DevR mutants are incapable of fruiting body development.	8.56043e-58
CP015444.1\|AUJ28033.1\|1284263_1286693_-\|hypothetical-protein	gnl\|CDD\|273707	TIGR01587, CRISPR-associated_endonuclease/helicase_Cas3, CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.	1.2115e-58
CP015444.1\|AUJ28026.1\|1271779_1273714_-\|threonine--tRNA-ligase	gnl\|CDD\|234752	PRK00413, thrS, threonyl-tRNA synthetase; Reviewed.	0
CP015444.1\|AUJ28027.1\|1274944_1276276_-\|chromosome-replication-initiation-protein	gnl\|CDD\|226138	COG3611, DnaB, Replication initiation/membrane attachment protein [DNA replication, recombination, and repair].	3.13715e-34
CP015444.1\|AUJ28023.1\|1269175_1270225_+\|integrase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.37896e-74
CP015444.1\|AUJ28695.1\|1282471_1282753_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.736e-27
CP015444.1\|AUJ28029.1\|1276748_1277351_-\|dephospho-CoA-kinase	gnl\|CDD\|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	2.649e-83
CP015444.1\|AUJ28694.1\|1274004_1274913_-\|primosomal-protein-DnaI	gnl\|CDD\|236353	PRK08939, PRK08939, primosomal protein DnaI; Reviewed.	8.40514e-153
CP015444.1\|AUJ28030.1\|1277347_1278178_-\|DNA-formamidopyrimidine-glycosylase	gnl\|CDD\|234899	PRK01103, PRK01103, bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase.	2.51e-156
CP015444.1\|AUJ28031.1\|1278186_1280850_-\|DNA-polymerase-I	gnl\|CDD\|235591	PRK05755, PRK05755, DNA polymerase I; Provisional.	0
CP015444.1\|AUJ28038.1\|1294279_1295161_-\|hypothetical-protein	gnl\|CDD\|366488	pfam01145, Band_7, SPFH domain / Band 7 family. This family has been called SPFH, Band 7 or PHB domain. Recent phylogenetic analysis has shown this domain to be a slipin or Stomatin-like integral membrane domain conserved from protozoa to mammals.	4.07706e-34
CP015444.1\|AUJ28036.1\|1288456_1290214_-\|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1	gnl\|CDD\|187884	cd09754, Cas8a1_I-A, CRISPR/Cas system-associated protein Cas8a1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; signature gene for I-A subtype; also known as CXXC_CXXC family.	1.03036e-18
CP015444.1\|AUJ28028.1\|1276278_1276746_-\|transcriptional-regulator-NrdR	gnl\|CDD\|234774	PRK00464, nrdR, transcriptional repressor NrdR.	6.49925e-87
CP015444.1\|AUJ28039.1\|1295178_1295493_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	9.23975e-10

>CP015444.1|AUJ28031.1|1278186_1280850_-|DNA-polymerase-I
MADKKLLLIDGNSVAFRAFYALYRQLESFKSPDGLHTNAIYAFKNMLDVLLKDVDPTHVLVAFDAGKVTFRTKMYGEYKGGRAKTPEELLEQMPYIQEMLHDLGIKTYELKNYEADDIIGTFAAKGEKVGFTTTIVTGDRDLTQLASDKTTVEVTKSGVSQLEAYTPEHMKEVNGVTPSEFIDMKALMGDNSDNYPGVEGIGPKTASNLIQEYGSVENLYDHIDEMKKSKRKERLIRDKDKAFLAKKLATIDRDSPVTIDIDDVKREPVDYEKLRQFYEKMNFRKFLAELNASGAGQDGAEVEKVEYTVLNDDNVKDVKATEKDTVEFYLEMLGANYHLADFVGFSLKINDKIYVSRDVDLLEEDNIKHILEDEKIKKNVFDLKRSMVGAHRLGIHTHGLDYDMLLASYLVNNENNSNDLGEIAHLYGDYSVKTDLEVYGKGKSEHIPDDDDELFNHLASKVNAIESLKKTLLEKLKDHEQDALFDTIEIPTARVLARMEMNGMKVETSTLIQLQNEFAVKLKKLEDKIYGQAGEKFNLNSPKQLGHILFEKLGLPVIKKTKTGYSTSVEVLDQLKTQSPIVSKILDYRQIAKIQSTYVKGLLDVIQPDGRVHTRYLQTLTATGRLSSVDPNLQNIPTRTEEGKQIRKAFVPSEPDGYIFSCDYSQVELRVLAHVSGDQNMQEAFKTGYDIHSHTAMKIFHLESPDEVTPLMRRHAKAVNFGIVYGISDYGLSKNLGISRKRAQEFIDNYFEQYPQIKDYMNKAVQEARDKGYAETIMHRRRYLPDIHAKKYTVRAFAERTAINSPIQGSAADIIKIAMINMQKKLDELHLKTKMVIQVHDELIFDVPKDELETIKKIVPEVMQSAVKLDVPLIADSGWGHNWYDAK
>CP015444.1|AUJ28030.1|1277347_1278178_-|DNA-formamidopyrimidine-glycosylase
MPEMPEVETVRRTLIPLIKGKTIEKVILWYPKIVATDHEKFLSELPGKKIIDIDRYAKYLLIRLSDNLTIVSHLRMEGKYHLTTSDAPKDKHDHVEFIFTDGTALRYNDVRKFGRMQLILTGTERQTTGIGKLGYEPNSSEFTSEYLVNGLKRKKKNIKNTLLDQSVVAGLGNIYVDEVLWRTKIHPLSQANKIPAEKVMELHDQINQIITEAIKLQGTTVHSFLNANGQVGGFQSKLQVYGHVGEPCPVCGTKFEKIKVNGRGTTFCPHCQVIYK
>CP015444.1|AUJ28029.1|1276748_1277351_-|dephospho-CoA-kinase
MSYVLALTGGIATGKSTADDFFRKKNIPIIDCDQIARELMEPGNASWQAIKDHFGMEYLNSDQTINRKKLGQLVFSNKQALSELNQVTHPLIFDKTVAKIKEYRDFALVILDAPVYFEAGLDNKHVANGVLVITLPEQLQIERLKKRNNLTDQEAINRINSQMPLVEKEKMADFVVANTGTIKELENKLKQILIKIREEE
>CP015444.1|AUJ28028.1|1276278_1276746_-|transcriptional-regulator-NrdR
MECPNCHQNASRVIDSRPSDENRAIRRRRECENCGFRFTTFERIETAPLLVIKNDGTREPFNRKKILHGVMAAGQKRPISSDQFEQLVDHVENKVRKQGISEISSKKIGQYVMDELADLDDVAYIRFASIYREFKDMSSFMKTMEDMMAKKGKGN
>CP015444.1|AUJ28027.1|1274944_1276276_-|chromosome-replication-initiation-protein
MFETADPKHLYYVANRIRLFPEDEKVLIKLYQPLVGAVAVALYQTLIQNYDPYGIISDSKGIYSLQEQLDCSLKQLFNSLHKLEAVGLVQTFLSDNVFNNVLVFKLLQVPAADKFFATPLLASLLKEKVGVPTFHDLSHAFAQEAKLKEKPIKNAKDVSANFFDVFRLPGDEAITPSSDVVQAAQENKVHEVEIAKVNDHDSIDWDFIKQEYSRYQIPASEIDLNKEQIRGLIQTYGLSEKEFVDESLPCLHGSYSLNMRDISNTLAENYKRTNTRENVQTQLNEGRKKALATIKDMDDNDKKLLKAANESSPAEFLYKLKTQKGGITSANEKQIINNLHTQYGLPEDLINILTYTCLTYDTVVSSNLAYKIANDWLQHGVATAVQALQYVKKRRNSFGKKRPVRTYQKRVEKGTDWSKKKADRDAGISTEQLKNLFKDLNNK
>CP015444.1|AUJ28694.1|1274004_1274913_-|primosomal-protein-DnaI
MEPIDKVIKKIVKERNLGDAQSLISQALHDPDVQAFLTANANKIDQKMVQNSMSNLYEYYSQKHTANKVMAGYAPQLFLNGKVIDIRYVPTKAKLAQDRKQAAERRLQLIDVPTRLHDVSLSEIDVNDDRKQVLTLIYDFLRKYKQDPHVQGLYLSGDYGVGKTYILAGLANYVVTNMNKNVVFLHVPTFIAGLASHFDDNSLQSEIRRLSECDLLILDDIGAESLSQWSRDDVLGVILQARMDNVLPTFFSSNLDMEALESHFEETRNATDPVKARRLMQRVRFLAKEVVVSGPDRRNSLH
>CP015444.1|AUJ28026.1|1271779_1273714_-|threonine--tRNA-ligase
MSFSITLPDGSKKDFEESLTIADLAQNIATSLGKAAVAGKVNGELKPLDYKLDSDSEVAIITNKDEEGLDVLRATAAFVFEAVAKCEYPELRLGEHVADEDGFYVDTDKDDQIKVGELPKLEKAMQKVIKNGEKIEHVQIAKSELEDLYKNDKFKSELLAKVEGDTVDAYKLGDFVDFGFDALLPNTGKIKQFKLLSVAGAYWLGKSSNPMLQRIFGTAFFKEADLKADLKRRQEIKERDHRTIGRDLDLFFVDPKVGAGLPYWMPKGATIRRVVERYIIDREVADGYQHVYTPVLMNLDAYKTSGHWAHYRDDMFPPMDMGDGEMLELRPMNCPSHIQIFKHHIRSYRDLPLRVAELGMMHRYEKSGALSGLQRVREMTLNDGHTFVVLDQVQTEFAKILKLIMEVYKDFDITDYYFRLSYRDPKNTDKYFANDEMWEKSQKMLKGAMDDLGLDYVEAEGEAAFYGPKLDIQTKTALGNDETMSTIQLDFMLPDRFGLTYVGKDGEEHRPVMIHRGIVGTMERFIAYLTEIYKGAFPTWLAPVQAEIIPVNNEAHGEYAEKVRAELAKRGFRVEVDDRNEKMGYKIRESQTQKVPYTLVLGDEEMKSGKVNLRRYGTDEEISKSLDDFINEIDADVKSYSREN
>CP015444.1|AUJ28025.1|1271100_1271622_-|hypothetical-protein
MKRKLILFLTACSIIFSVALINQRKASAASWDAKSLYTTPKQTRGTWYYKKNGKIKKLRITAHTFDKVKLYKMLSNKQTRKWTKKLAKADQESGFKLAKKVGTSQYEADDFKFHKSAGFTINGWLSSDNADSGHTYVTVKKKYKGSKIKTLRVRNGAVNAFLYYCYRTKKLAK
>CP015444.1|AUJ28024.1|1270419_1270950_-|hypothetical-protein
MKKKLLLFLGAILLILGFAKLSSVNADAATIKATDWGAKKVFTTPKKTRGVWYYKEGKKVKKFKITAHTIDGVKLYKELNGKTSDRWVNKLIKADKKSGYKLADKVGESAWACHTIKYHKIIGFNADGWLAGSGDGFYYVPVKKNVKGKKVNALRVGEGAGNYLSYYAYKSRKLVK
>CP015444.1|AUJ28023.1|1269175_1270225_+|integrase
MDSLHSTMNQHIKGKHLSFEERVIIQLRLKDGYSLRAIARELNCSPSTISYEVKRGTVELYHGKVKRYKATQGHDAYQVHRKNCGRKSDFLRKTQFMRYVHKHFFKDGWSLDVCSNRATAVGAFSSRDVVCTKTLYKYVDQGLLDIHNYDLPEKLKRNTKLHRIRKNKKKLGRSIEERPKEINKRNEFGHWECNLVLGHKSKDDEVLLALSERMSREFLILRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEKASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQDIINIETWCNSLPRKILAYHTPDEIFERELDLIYQAA
>CP015444.1|AUJ28695.1|1282471_1282753_-|CRISPR-associated-endonuclease-Cas2
MYVILVYDIVMDKQGAKVSRHVFKICKKYLTHVQNSVFEGELTKSQLESLKNELDRWIRQNVDSVIIFKNRNKDWLDKEFMGQDLTDLTSDIF
>CP015444.1|AUJ28032.1|1283756_1284248_-|CRISPR-associated-protein-Cas4
MRVTGNMVNYFFVCKRKLWLFQHQIGFEQTSERVQLGSLLDRTSYQGHGTHHVMIDNLINIDMVENWQLIHEVKRSDAIEPAAIWQLKYYIYYLRKKGVNISKGLLDYPRLKKCVKVDYTDEDEKQMEKYISEIEQICEQVTPPKPQFKPICKSCAFYEYCFS
>CP015444.1|AUJ28033.1|1284263_1286693_-|hypothetical-protein
MNEYLAKSLDQSEGNHCETIVEHTNNLLKQYSLLKQAYPDIFQNFWLSQDRFNDMTKQVDIRSKDDWRLLEIACSYHDLGKMNLRFQKKVKAGQSFCKGEIPHALLSITMLPIDELQKHYTKDQIIALIFAIKWHHERNFSEIYEKHYEDEIEALKKEFASFDYSKSSFPIPPQEPAKVDSKYLTGNLSHRLSPNYEPKIYDEFVILKGLLNRIDYAASGHYEIESKSRVCLSQNILQEWHKKNPVADWNELQKYTYDHRNESIVVVGQTGLGKTESALRWLDNSKSFFVLPLKSAINSIYDRISGIVFQNKSHENLALLHSDMMAKALSEKFDDEDNFEEFVNEERSWSKQLSVATLDQIFNFVYHYKNYEPKLATLAYAKVVIDEIQMYSPDLLGYLIYGLGEIQKFGGKFEIMTATLPPFLIDLLESNGLEFKQAPHPFLDPKVNHRHKVKVLHKQINSDDIINLDRHQKTLVVCNTVKSATELYSELKQKGVSDVHLIHSRFIRKDRNEREKEILEFGQKENHSSGIWIGTQVVEASLDIDFDMLITELSELCGLFQRMGRCYRKRNYEGKEPNVYVFDGGDKLTSGIHESKQEYDDKRYHSVVDYHLFEISKRALAQVDGYLTESDKLKLIDENYTTDKLLDENCQLIDKVNDCIDYLNDLTFLDNLKTKEEVVNTFRNINTIDIIPEQVFLENKDKLEAAAKALNNYIRREDFLDQTEYKKQHQILVKEKIKAREVINNYLVGIPLYIINKVSKQDRWIKDKALNEVGYNILPADFNYDSMTGLSYNDNKNKNAEIDDDDNIF
>CP015444.1|AUJ28034.1|1286835_1287549_-|type-I-B-CRISPR-associated-protein-Cas5
MKVIRVKLHQETANYRVPASHGFRESYPLPPISTVIGMVHYLCDFHEYHPMKVSVQGSYVSTTSDFFTRYEFKNGLKFDPGRHQLNAEGYGISRGIGHVQLLYDVNLILHIKPDDENELEDIYNALKYPREFPNLGRREDLVNFEEVKIVDVEKKDEDLTVNHGAYIPVEMSENIGLENEGIGYKGTHYYLNKDYKLVTIKKGQTQRRWNKVEVIYASGFTVYKSYVDEDNNVVFLV
>CP015444.1|AUJ28035.1|1287535_1288438_-|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR
MTQDKMGLTATIVFQASSANYGESLGNVASLKKLTRGDGQQYSYISRQAIRYDIVQQLGEKETNLEAEGSGDKKVIQFAKDASIKGFPEIDFFGYMKTEKGNNSSIRSAKVRLSNAISQEPYEGDTDFLTNMSLAQRIRKATGDNKIRNSIAQSEIQQSYYVYTLTVDLDQIGVDDNDGTNLNANEKNRRVAKLLDTIQYLYRDIRGRREDLKPLFAIGGVYDIKNPIFENAVKVRNSNIDIESIQSILDDPRVKENTSVGFVDGAFNNSQEIKDKLDAVTVAKFMTDLKKKVADYYEGN
>CP015444.1|AUJ28036.1|1288456_1290214_-|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1
MGETSTVTIDFRINSWLENAGIVGLTRILKANPRYRGSYKEKENTLEVDPKVFDNFSDLYFNFFIKNYGQATRYWRIVSEENFLKSLKENGFKDFDNKKLKELTDWFDNVLKYSVNSASYKKVIKFINSDYDIKAEVKDCNKKIRTLNKKNFLTESPEEAKEILQELINQLLKAIEYFSTDQARKYFPAKTLSYTVINKAWNGVSFLNPQAKNLDFYDDYQNYFVAPVQKYLQEDHSKDKYICSTCGRPIKRLEYSYGFLNDMGYDLNRKTSNAWNFKNDLYICPVCQFLYSLVPAGFTYNMASQGIFINENSSIRNLQGKNDATFNSMMRDIRSNTQTSPYRAFSAAFRDAEASGQNAALANIQLITYNNDHYNFQIIPIVASKVLIKAVEKKYTVKQTGEVKSYLANLYNAGISNFRGAGYYSILDNVLNCLFNNTNLFSIIQELELLKVGNTAGCYYNTFQIMTVIRMNGWFLNELHKYRRSENPMKVEEDKLTKARGCGMHVRMGYDNENKAKTLAYKMLEAIRANSTDRFMELLLNAYLYLDKTVPKIFIETQSNTEVFKEYAFAFIAGLIGSSNAEQDK
>CP015444.1|AUJ28037.1|1290231_1290987_-|CRISPR-associated-endoribonuclease-Cas6
MRFGIPIHLLPKNSEEKEIKINIDYDAYILSLIKTGLSTENPALFKELFGKPTQKNYSTSVFFPNATFTKDNIVLDKNGEMKLYFSTANTNLAINFYNSFVYLDHLDAEKLPFGHSYLADVKKLYTIELPKITKDRVIFKTMSTIVIRNDEGRFISCPNDSTEEGLAEFNDALRRNTFNKLRDNESLASTVKGLKFKPIKMRKTVRKSFGLNIECTKGIFELEGNPTLLNFIQESGLGEKTGTFSGMISLA
>CP015444.1|AUJ28038.1|1294279_1295161_-|hypothetical-protein
MMARIIIGIIVVLVIVYVCCGFKIVPRNNEGLVETLGKYSKTVKAGFIFVWPLFQRIRKVPLALQPLEISKYSIITKDNAEISTSLTLNYLVTDSYRYFYNNTDSVESMVQLIRGHLRDIIGRMDLNAALGSTKEINDQLFTATGDLTDIYGIKVVRVNVDELLPSAEIQHAMDKQLTADREKTAAIAKAEGEARTIGMTTKAKNDALVATAKANAEAVKTQADADAYRVQKMQEALSKAGEGYFRNQSLDSFNQLAQGPNNLIVVGKDEMTDLGKVPALRKVWDASDDKKDK
>CP015444.1|AUJ28039.1|1295178_1295493_-|XRE-family-transcriptional-regulator
MAEKTTGLYVRMNPEKKEKAEAILKKLGLNSATAINMFYDQIILHNGIPFRVEIPNAWDNLDQMNKYEYAKLLDERLNTLNGREDLLGDIAKRLDAEKNEKKDN
>CP015444.1|AUJ28040.1|1295899_1296877_-|bacteriocin
MVKSITPHLVYRLNGMHHVVAQVGVVNGDHVFALQLLHSAHDVLVYRKHEGLTKNIDYTDPHLVMMGFGHTQTWVPANDKDEYFVGAKPNSGNWTTQIARVKYPRLLPERYTSNTQLPRLSHLNHVTDVPYDGHDHLHRVEASVSPNGKYFMIASIWDDGSGHFGLFDLNEVNQKLNENGTKNTPITDLHCLSAFHIDNFDNPSVAPDEEMPQMIDSVQGYAIDDDKNIYISNQLSPKINHETGEVTTWSRKIVKFPWGETNSDNWQVAMVDGIDLPDRYSEMESIHVNAANDIYLTVAYHQKYIKGGEYKLRTLENQIFHITDL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	MN693504	Marine virus AFVG_25M410, complete genome	41660-41695	7	0.806
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	MN693504	Marine virus AFVG_25M410, complete genome	41660-41695	7	0.806
CP015444_2	2.5\|1281300\|36\|CP015444\|CRISPRCasFinder,CRT	1281300-1281335	36	MN698245	Pelagibacter phage HTVC111P, complete genome	25762-25797	8	0.778
CP015444_2	2.16\|1282025\|36\|CP015444\|CRISPRCasFinder,CRT	1282025-1282060	36	AJ972879	Yersinia phage phiR1-37 complete genome	205426-205461	8	0.778
CP015444_2	2.16\|1282025\|36\|CP015444\|CRISPRCasFinder,CRT	1282025-1282060	36	NC_016163	Yersinia phage phiR1-37, complete genome	205426-205461	8	0.778
CP015444_2	2.22\|1281301\|36\|CP015444\|PILER-CR	1281301-1281336	36	MN698245	Pelagibacter phage HTVC111P, complete genome	25762-25797	8	0.778
CP015444_2	2.33\|1282026\|36\|CP015444\|PILER-CR	1282026-1282061	36	AJ972879	Yersinia phage phiR1-37 complete genome	205426-205461	8	0.778
CP015444_2	2.33\|1282026\|36\|CP015444\|PILER-CR	1282026-1282061	36	NC_016163	Yersinia phage phiR1-37, complete genome	205426-205461	8	0.778
CP015444_2	2.4\|1281235\|35\|CP015444\|CRISPRCasFinder,CRT	1281235-1281269	35	NZ_CP019991	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-3	15682-15716	9	0.743
CP015444_2	2.7\|1281432\|35\|CP015444\|CRISPRCasFinder,CRT	1281432-1281466	35	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	35302-35336	9	0.743
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	MN693083	Marine virus AFVG_25M55, complete genome	758-793	9	0.75
CP015444_2	2.21\|1281236\|35\|CP015444\|PILER-CR	1281236-1281270	35	NZ_CP019991	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-3	15682-15716	9	0.743
CP015444_2	2.24\|1281433\|35\|CP015444\|PILER-CR	1281433-1281467	35	NZ_CP038863	Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence	35302-35336	9	0.743
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	MN693083	Marine virus AFVG_25M55, complete genome	758-793	9	0.75
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	NZ_CP022092	Staphylococcus saprophyticus strain FDAARGOS_355 plasmid unnamed2, complete sequence	21741-21776	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	NZ_CP035295	Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292 strain ATCC 15305 plasmid unnamed1, complete sequence	6785-6820	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	NZ_CP017467	Staphylococcus nepalensis strain JS11 plasmid pSNJS1101, complete sequence	18175-18210	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	NZ_CP018777	Staphylococcus condimenti strain StO 2014-01 plasmid pStO2014-01, complete sequence	8366-8401	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	NZ_CP017461	Staphylococcus nepalensis strain JS1 plasmid pSNJS101, complete sequence	39887-39922	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	CP019598	Staphylococcus cohnii strain SNUDS-2 plasmid pSC-SNUDS-2-1, complete sequence	5703-5738	10	0.722
CP015444_2	2.13\|1281826\|36\|CP015444\|CRISPRCasFinder,CRT	1281826-1281861	36	MK448796	Streptococcus phage Javan53, complete genome	31569-31604	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	NZ_CP022092	Staphylococcus saprophyticus strain FDAARGOS_355 plasmid unnamed2, complete sequence	21741-21776	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	NZ_CP035295	Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292 strain ATCC 15305 plasmid unnamed1, complete sequence	6785-6820	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	NZ_CP017467	Staphylococcus nepalensis strain JS11 plasmid pSNJS1101, complete sequence	18175-18210	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	NZ_CP018777	Staphylococcus condimenti strain StO 2014-01 plasmid pStO2014-01, complete sequence	8366-8401	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	NZ_CP017461	Staphylococcus nepalensis strain JS1 plasmid pSNJS101, complete sequence	39887-39922	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	CP019598	Staphylococcus cohnii strain SNUDS-2 plasmid pSC-SNUDS-2-1, complete sequence	5703-5738	10	0.722
CP015444_2	2.30\|1281827\|36\|CP015444\|PILER-CR	1281827-1281862	36	MK448796	Streptococcus phage Javan53, complete genome	31569-31604	10	0.722

1. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.806

cgaggtacaaaaaatgaaagaatttactatttatgc-	CRISPR spacer
agtggtacaaaaaatgaaagaaaatacta-tagtgca	Protospacer
 * *******************  ***** * .***

2. spacer 2.30|1281827|36|CP015444|PILER-CR matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.806

cgaggtacaaaaaatgaaagaatttactatttatgc-	CRISPR spacer
agtggtacaaaaaatgaaagaaaatacta-tagtgca	Protospacer
 * *******************  ***** * .***

3. spacer 2.5|1281300|36|CP015444|CRISPRCasFinder,CRT matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 8, identity: 0.778

tagtcttgcacctgatgaagtatataatcgtgaatt	CRISPR spacer
attatttgcacctgatgaagtatataattgtgatgt	Protospacer
    .***********************.****  *

4. spacer 2.16|1282025|36|CP015444|CRISPRCasFinder,CRT matches to AJ972879 (Yersinia phage phiR1-37 complete genome) position: , mismatch: 8, identity: 0.778

agtgctgatgcattaattgataatactattcaagca	CRISPR spacer
cctgctgatgcattaattgataataattttatggct	Protospacer
  *********************** * **  .**

5. spacer 2.16|1282025|36|CP015444|CRISPRCasFinder,CRT matches to NC_016163 (Yersinia phage phiR1-37, complete genome) position: , mismatch: 8, identity: 0.778

agtgctgatgcattaattgataatactattcaagca	CRISPR spacer
cctgctgatgcattaattgataataattttatggct	Protospacer
  *********************** * **  .**

6. spacer 2.22|1281301|36|CP015444|PILER-CR matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 8, identity: 0.778

tagtcttgcacctgatgaagtatataatcgtgaatt	CRISPR spacer
attatttgcacctgatgaagtatataattgtgatgt	Protospacer
    .***********************.****  *

7. spacer 2.33|1282026|36|CP015444|PILER-CR matches to AJ972879 (Yersinia phage phiR1-37 complete genome) position: , mismatch: 8, identity: 0.778

agtgctgatgcattaattgataatactattcaagca	CRISPR spacer
cctgctgatgcattaattgataataattttatggct	Protospacer
  *********************** * **  .**

8. spacer 2.33|1282026|36|CP015444|PILER-CR matches to NC_016163 (Yersinia phage phiR1-37, complete genome) position: , mismatch: 8, identity: 0.778

agtgctgatgcattaattgataatactattcaagca	CRISPR spacer
cctgctgatgcattaattgataataattttatggct	Protospacer
  *********************** * **  .**

9. spacer 2.4|1281235|35|CP015444|CRISPRCasFinder,CRT matches to NZ_CP019991 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-3) position: , mismatch: 9, identity: 0.743

agcaagctctttgtagttttctactt----tttttgaaa	CRISPR spacer
gttaagctctttgtagtgttcttcttttgcttttt----	Protospacer
. .************** **** ***    *****

10. spacer 2.7|1281432|35|CP015444|CRISPRCasFinder,CRT matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

aaagtccaacgaccaaaagaaaggatatagataga	CRISPR spacer
ttcattaaacgattaaaagaaaggatatagataaa	Protospacer
   .*. *****..*******************.*

11. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to MN693083 (Marine virus AFVG_25M55, complete genome) position: , mismatch: 9, identity: 0.75

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
ctaccaaaaaaaaatgaaagtattaactatttattt	Protospacer
* *   * ************ *** ********* .

12. spacer 2.21|1281236|35|CP015444|PILER-CR matches to NZ_CP019991 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-3) position: , mismatch: 9, identity: 0.743

agcaagctctttgtagttttctactt----tttttgaaa	CRISPR spacer
gttaagctctttgtagtgttcttcttttgcttttt----	Protospacer
. .************** **** ***    *****

13. spacer 2.24|1281433|35|CP015444|PILER-CR matches to NZ_CP038863 (Campylobacter jejuni strain SCJK2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

aaagtccaacgaccaaaagaaaggatatagataga	CRISPR spacer
ttcattaaacgattaaaagaaaggatatagataaa	Protospacer
   .*. *****..*******************.*

14. spacer 2.30|1281827|36|CP015444|PILER-CR matches to MN693083 (Marine virus AFVG_25M55, complete genome) position: , mismatch: 9, identity: 0.75

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
ctaccaaaaaaaaatgaaagtattaactatttattt	Protospacer
* *   * ************ *** ********* .

15. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to NZ_CP022092 (Staphylococcus saprophyticus strain FDAARGOS_355 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

16. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to NZ_CP035295 (Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292 strain ATCC 15305 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

17. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to NZ_CP017467 (Staphylococcus nepalensis strain JS11 plasmid pSNJS1101, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

18. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to NZ_CP018777 (Staphylococcus condimenti strain StO 2014-01 plasmid pStO2014-01, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

19. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to NZ_CP017461 (Staphylococcus nepalensis strain JS1 plasmid pSNJS101, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

20. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to CP019598 (Staphylococcus cohnii strain SNUDS-2 plasmid pSC-SNUDS-2-1, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgatacaatttactattttact	Protospacer
..*..************ * ************   .

21. spacer 2.13|1281826|36|CP015444|CRISPRCasFinder,CRT matches to MK448796 (Streptococcus phage Javan53, complete genome) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
gcaaaaacaaaaaatgaaagaaattacaatttcagg	Protospacer
  *.. **************** **** ****  *

22. spacer 2.30|1281827|36|CP015444|PILER-CR matches to NZ_CP022092 (Staphylococcus saprophyticus strain FDAARGOS_355 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

23. spacer 2.30|1281827|36|CP015444|PILER-CR matches to NZ_CP035295 (Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292 strain ATCC 15305 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

24. spacer 2.30|1281827|36|CP015444|PILER-CR matches to NZ_CP017467 (Staphylococcus nepalensis strain JS11 plasmid pSNJS1101, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

25. spacer 2.30|1281827|36|CP015444|PILER-CR matches to NZ_CP018777 (Staphylococcus condimenti strain StO 2014-01 plasmid pStO2014-01, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

26. spacer 2.30|1281827|36|CP015444|PILER-CR matches to NZ_CP017461 (Staphylococcus nepalensis strain JS1 plasmid pSNJS101, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgataaaatttactattttact	Protospacer
..*..************ *.************   .

27. spacer 2.30|1281827|36|CP015444|PILER-CR matches to CP019598 (Staphylococcus cohnii strain SNUDS-2 plasmid pSC-SNUDS-2-1, complete sequence) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
taaaatacaaaaaatgatacaatttactattttact	Protospacer
..*..************ * ************   .

28. spacer 2.30|1281827|36|CP015444|PILER-CR matches to MK448796 (Streptococcus phage Javan53, complete genome) position: , mismatch: 10, identity: 0.722

cgaggtacaaaaaatgaaagaatttactatttatgc	CRISPR spacer
gcaaaaacaaaaaatgaaagaaattacaatttcagg	Protospacer
  *.. **************** **** ****  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10558 : 82773

Streptococcus_phage(15.38%)

transposase,integrase

attL 56806:56833|attR 85497:85524

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27041.1\|10558_11737_-\|transposase	transposase	NA	NA	NA	NA
AUJ27042.1\|15149_15353_-	hypothetical protein	NA	NA	NA	NA
AUJ27043.1\|15330_15975_-	hypothetical protein	NA	NA	NA	NA
AUJ27044.1\|15980_17951_-	hypothetical protein	NA	NA	NA	NA
AUJ27045.1\|19486_19852_+	hypothetical protein	NA	NA	NA	NA
AUJ27046.1\|19990_22012_+	hypothetical protein	NA	NA	NA	NA
AUJ27047.1\|22023_22479_+	50S ribosomal protein L9	NA	NA	NA	NA
AUJ27048.1\|22509_23904_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.7e-120	50.6
AUJ27049.1\|24140_25070_+	phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27050.1\|26629_27559_+	fatty acid-binding protein DegV	NA	NA	NA	NA
AUJ27051.1\|27677_28556_+	fructokinase	NA	NA	NA	NA
AUJ27052.1\|28929_29190_+	hypothetical protein	NA	NA	NA	NA
AUJ27053.1\|29350_31072_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	1.4e-87	36.7
AUJ27054.1\|31063_32293_-	esterase	NA	NA	NA	NA
AUJ27055.1\|32376_33081_-	methyltransferase	G3MA03	Bacillus_virus	1.6e-18	43.6
AUJ27056.1\|33449_33686_+	hypothetical protein	NA	NA	NA	NA
AUJ27057.1\|34272_34473_-	transcriptional regulator	NA	NA	NA	NA
AUJ27058.1\|35275_36034_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AUJ27059.1\|37061_37286_+	hypothetical protein	NA	NA	NA	NA
AUJ27060.1\|37295_37883_+	transcriptional regulator	NA	NA	NA	NA
AUJ27061.1\|40868_42269_+	hypothetical protein	NA	NA	NA	NA
AUJ27062.1\|42365_43139_+	hypothetical protein	NA	NA	NA	NA
AUJ27063.1\|43177_43738_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AUJ27064.1\|43738_44263_-	hypothetical protein	NA	NA	NA	NA
AUJ27065.1\|44264_44675_-	hypothetical protein	NA	NA	NA	NA
AUJ27066.1\|44694_46929_-	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A222ZQ84	Mycobacterium_phage	6.5e-90	33.2
AUJ27067.1\|47183_48218_+	AI-2E family transporter	NA	NA	NA	NA
AUJ27068.1\|48214_48787_+	esterase	NA	NA	NA	NA
AUJ27069.1\|48816_48999_-	hypothetical protein	NA	NA	NA	NA
AUJ27070.1\|49176_49461_-	hypothetical protein	NA	NA	NA	NA
AUJ27071.1\|49834_50596_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.5e-18	28.6
AUJ27072.1\|50603_51488_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27073.1\|51484_52477_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27074.1\|52671_53850_-\|transposase	transposase	NA	NA	NA	NA
AUJ27075.1\|54204_54912_+	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
AUJ27076.1\|55552_56737_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.9e-126	60.1
56806:56833	attL	NA	NA	NA	NA
AUJ27077.1\|58656_59514_+	2,5-diketo-D-gluconic acid reductase	A0A2H4PQR8	Staphylococcus_phage	5.0e-59	43.1
AUJ27078.1\|62792_63806_-	lactate dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	1.3e-50	35.6
AUJ27079.1\|63932_64775_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AUJ27080.1\|65245_66073_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.4e-97	63.5
AUJ27081.1\|67090_69922_+	NgoFVII family restriction endonuclease	A0A0K2CZF8	Paenibacillus_phage	1.6e-29	24.9
AUJ27082.1\|69961_71065_-	penicillin-binding protein	NA	NA	NA	NA
AUJ27083.1\|71261_71675_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.0e-09	38.9
AUJ27084.1\|77490_77649_+	branched-chain amino acid transporter	NA	NA	NA	NA
AUJ27085.1\|77882_78932_+\|integrase	integrase	H7BWC8	unidentified_phage	4.7e-51	35.9
AUJ28645.1\|78996_79269_-	transcriptional regulator	NA	NA	NA	NA
AUJ27086.1\|79472_81470_-	PTS fructose transporter subunit IIC	NA	NA	NA	NA
AUJ27087.1\|81582_82773_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.9e-126	59.0
85497:85524	attR	NA	NA	NA	NA

DBSCAN-SWA_2

86821 : 150539

Bacillus_phage(18.75%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27093.1\|86821_88147_-\|transposase	transposase	G3MB42	Bacillus_virus	2.8e-56	36.0
AUJ27094.1\|88175_88784_-	resolvase	A0A1V0SJI5	Klosneuvirus	1.2e-33	43.2
AUJ27095.1\|89040_89439_-	enterocin immunity protein	NA	NA	NA	NA
AUJ27096.1\|89441_90230_-	hypothetical protein	NA	NA	NA	NA
AUJ27097.1\|90527_90737_-	ATP-binding protein	NA	NA	NA	NA
AUJ27098.1\|90953_91703_-	aspartate racemase	NA	NA	NA	NA
AUJ27099.1\|91711_93283_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AUJ27100.1\|93333_94482_-	two-component sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.0e-18	31.7
AUJ27101.1\|94485_95172_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	9.6e-37	37.6
AUJ28648.1\|95349_97209_-	ABC transporter	W8CYL7	Bacillus_phage	6.2e-46	26.0
AUJ27102.1\|97218_98943_-	ABC transporter	W8CYL7	Bacillus_phage	8.9e-39	27.1
AUJ27103.1\|99057_99840_-	hypothetical protein	NA	NA	NA	NA
AUJ27104.1\|99848_100949_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AUJ27105.1\|100998_101262_-	hypothetical protein	NA	NA	NA	NA
AUJ27106.1\|101254_102139_-	chromosome partitioning protein ParB	S5VTK0	Leptospira_phage	5.1e-14	29.5
AUJ27107.1\|102116_102896_-	sporulation initiation inhibitor Soj	Q8JL10	Natrialba_phage	4.3e-25	31.5
AUJ27108.1\|102911_103751_-	nucleoid occlusion protein	S5VSZ7	Leptospira_phage	2.1e-17	42.5
AUJ27109.1\|103765_104488_-	16S rRNA (guanine(527)-N(7))-methyltransferase	NA	NA	NA	NA
AUJ27110.1\|104649_105186_+	CvpA family protein	NA	NA	NA	NA
AUJ27111.1\|105227_106157_-	thiamine biosynthesis protein ApbE	NA	NA	NA	NA
AUJ27112.1\|106165_106957_-	protein tyrosine phosphatase	NA	NA	NA	NA
AUJ27113.1\|107049_107598_-	NADPH-dependent FMN reductase	A0A2P0ZL82	Lactobacillus_phage	1.1e-27	38.8
AUJ27114.1\|107611_108151_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
AUJ27115.1\|108285_108510_-	hypothetical protein	NA	NA	NA	NA
AUJ27116.1\|108622_109921_-	MFS transporter	NA	NA	NA	NA
AUJ27117.1\|110076_111483_-\|transposase	transposase	NA	NA	NA	NA
AUJ27118.1\|111693_112317_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUJ27119.1\|112443_112686_-	hypothetical protein	NA	NA	NA	NA
AUJ27120.1\|112787_114200_+	dipeptidase	NA	NA	NA	NA
AUJ27121.1\|114244_114919_-	peptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-33	39.4
AUJ27122.1\|115982_116510_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUJ27123.1\|116620_117220_-	phosphoglycerate mutase	NA	NA	NA	NA
AUJ27124.1\|117363_118119_+	alpha/beta hydrolase	NA	NA	NA	NA
AUJ27125.1\|118115_118877_-	hypothetical protein	NA	NA	NA	NA
AUJ27126.1\|118935_119580_+	hypothetical protein	NA	NA	NA	NA
AUJ27127.1\|121357_123892_-	peptidase	A0A0P0IY26	Acinetobacter_phage	1.9e-69	25.9
AUJ27128.1\|124098_124458_+	aggregation promoting factor surface protein	A0A0E3XCL7	Enterococcus_phage	1.6e-19	65.7
AUJ28649.1\|124521_125472_-	cytochrome C5	NA	NA	NA	NA
AUJ27129.1\|128371_128734_+	hypothetical protein	NA	NA	NA	NA
AUJ27130.1\|130711_131092_+	hypothetical protein	NA	NA	NA	NA
AUJ27131.1\|131127_131718_+	hypothetical protein	NA	NA	NA	NA
AUJ27132.1\|131714_132041_+	hypothetical protein	NA	NA	NA	NA
AUJ27133.1\|132074_132269_+	hypothetical protein	NA	NA	NA	NA
AUJ27134.1\|132793_133480_+	hypothetical protein	NA	NA	NA	NA
AUJ27135.1\|133510_134017_+	hypothetical protein	NA	NA	NA	NA
AUJ27136.1\|134035_135091_+	hypothetical protein	NA	NA	NA	NA
AUJ27137.1\|135191_137216_+	hypothetical protein	NA	NA	NA	NA
AUJ27138.1\|139151_140411_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	5.4e-09	20.4
AUJ27139.1\|141886_142252_+	hypothetical protein	NA	NA	NA	NA
AUJ27140.1\|142248_142737_+	hypothetical protein	NA	NA	NA	NA
AUJ27141.1\|143160_143355_-	hypothetical protein	NA	NA	NA	NA
AUJ27142.1\|143787_144606_+	hypothetical protein	NA	NA	NA	NA
AUJ28650.1\|144725_145904_+\|transposase	transposase	NA	NA	NA	NA
AUJ27143.1\|145926_146205_+	hypothetical protein	NA	NA	NA	NA
AUJ27144.1\|146485_146860_+	hypothetical protein	NA	NA	NA	NA
AUJ27145.1\|147679_148138_+	hypothetical protein	A0A0B5CYL8	Listeria_phage	2.8e-32	54.3
AUJ27146.1\|149162_149393_+	hypothetical protein	A0A0B5CYL8	Listeria_phage	1.6e-15	61.4
AUJ27147.1\|149921_150269_+\|transposase	transposase	NA	NA	NA	NA
AUJ28651.1\|150308_150539_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

191079 : 251223

Bacillus_virus(22.22%)

transposase,integrase,tRNA

attL 223662:223681|attR 251385:251404

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27178.1\|191079_192237_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	1.6e-116	57.6
AUJ27179.1\|192503_193325_+	Sir2 family NAD-dependent protein deacetylase	NA	NA	NA	NA
AUJ27180.1\|193333_194287_+	DNA polymerase III subunit epsilon	A0A0K2SUJ2	Clostridium_phage	1.5e-11	33.1
AUJ27181.1\|194377_195232_+	DNA nuclease	NA	NA	NA	NA
AUJ27182.1\|195273_196701_+	peptidase C69	NA	NA	NA	NA
AUJ27183.1\|196923_197781_+\|transposase	transposase	NA	NA	NA	NA
AUJ27184.1\|197924_199010_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-26	33.2
AUJ27185.1\|199009_199876_+	sugar ABC transporter permease	NA	NA	NA	NA
AUJ27186.1\|199879_200704_+	sugar ABC transporter permease	NA	NA	NA	NA
AUJ27187.1\|200687_201983_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AUJ27188.1\|203474_204392_+	magnesium transporter CorA	NA	NA	NA	NA
AUJ27189.1\|204404_205355_+	serine hydrolase	NA	NA	NA	NA
AUJ27190.1\|205490_206063_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUJ27191.1\|206067_209676_+	hypothetical protein	NA	NA	NA	NA
AUJ27192.1\|209833_210868_+	hypothetical protein	NA	NA	NA	NA
AUJ27193.1\|210913_212296_-	succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AUJ27194.1\|212379_213081_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUJ27195.1\|213132_213240_-	regulator	NA	NA	NA	NA
AUJ27196.1\|213236_214034_-	esterase	NA	NA	NA	NA
AUJ27197.1\|214187_215366_+\|transposase	transposase	NA	NA	NA	NA
AUJ27198.1\|215541_216150_+	hypothetical protein	M1Q152	Streptococcus_phage	3.6e-35	39.1
AUJ27199.1\|216149_216701_+	acetyltransferase	NA	NA	NA	NA
AUJ27200.1\|216924_218232_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.2e-93	44.1
223662:223681	attL	NA	NA	NA	NA
AUJ27201.1\|224702_225050_+	hypothetical protein	NA	NA	NA	NA
AUJ27202.1\|225052_225250_+	hypothetical protein	NA	NA	NA	NA
AUJ27203.1\|225312_226332_+	PTS mannose transporter subunit EIIAB	NA	NA	NA	NA
AUJ27204.1\|226386_227199_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
AUJ27205.1\|227227_228148_+	PTS mannose family transporter subunit IID	NA	NA	NA	NA
AUJ27206.1\|228151_228520_+	hypothetical protein	NA	NA	NA	NA
AUJ27207.1\|228564_229395_-	transcriptional regulator	NA	NA	NA	NA
AUJ27208.1\|230108_231482_-	amino acid permease	NA	NA	NA	NA
AUJ27209.1\|231795_234420_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
AUJ27210.1\|234617_236429_+	glutamine--fructose-6-phosphate aminotransferase	Q76DQ7	Chlorella_virus	1.6e-91	37.4
AUJ27211.1\|236502_236796_+	hypothetical protein	NA	NA	NA	NA
AUJ27212.1\|237879_238263_+	hypothetical protein	NA	NA	NA	NA
AUJ27213.1\|239665_240850_+	acetate kinase	NA	NA	NA	NA
AUJ27214.1\|240953_241685_+	carboxymuconolactone decarboxylase	NA	NA	NA	NA
AUJ27215.1\|241771_241999_+	hypothetical protein	NA	NA	NA	NA
AUJ27216.1\|242160_242574_+	NUDIX hydrolase	NA	NA	NA	NA
AUJ27217.1\|244231_245422_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	4.3e-125	57.9
AUJ27218.1\|245476_245698_+	hypothetical protein	NA	NA	NA	NA
AUJ27219.1\|245690_246062_+	hypothetical protein	NA	NA	NA	NA
AUJ27220.1\|246079_246829_-	TIGR02452 family protein	NA	NA	NA	NA
AUJ27221.1\|247029_247329_+	hypothetical protein	NA	NA	NA	NA
AUJ27222.1\|248073_249399_+\|transposase	transposase	G3MB42	Bacillus_virus	2.1e-56	36.3
AUJ27223.1\|249609_249873_+	hypothetical protein	NA	NA	NA	NA
AUJ27224.1\|250173_251223_+\|integrase	integrase	H7BWC8	unidentified_phage	4.7e-51	35.9
251385:251404	attR	NA	NA	NA	NA

DBSCAN-SWA_4

254246 : 317016

Bacillus_virus(14.29%)

transposase,integrase,tRNA

attL 245490:245508|attR 317085:317103

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
245490:245508	attL	NA	NA	NA	NA
AUJ27228.1\|254246_255488_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	1.3e-119	57.0
AUJ27229.1\|255898_257653_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	1.1e-87	36.7
AUJ27230.1\|257599_257998_-	hypothetical protein	NA	NA	NA	NA
AUJ27231.1\|258096_258297_-	hypothetical protein	NA	NA	NA	NA
AUJ27232.1\|258407_258800_+	hypothetical protein	NA	NA	NA	NA
AUJ27233.1\|260488_261184_+	hypothetical protein	A0A249XZV3	Enterococcus_phage	4.9e-12	50.7
AUJ27234.1\|261321_262380_+	surface exclusion protein	NA	NA	NA	NA
AUJ27235.1\|262449_263028_+	phosphoglycerate mutase	A0A1X9IGJ2	Lactococcus_phage	1.1e-22	37.1
AUJ28652.1\|263586_264246_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AUJ27236.1\|269847_270963_+	hypothetical protein	NA	NA	NA	NA
AUJ27237.1\|271051_271753_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUJ27238.1\|271816_272203_-	glycerol-3-phosphate cytidylyltransferase	A0A0F7LBI5	uncultured_marine_virus	7.1e-13	47.2
AUJ27239.1\|272313_273504_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.9e-121	56.7
AUJ27240.1\|273753_274482_+	acetylglucosaminyldiphospho-UDP acetyl-beta-D-mannosaminyltransferase	NA	NA	NA	NA
AUJ27241.1\|274489_275590_+	galactosyltransferase	NA	NA	NA	NA
AUJ27242.1\|275677_277156_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.3e-115	47.6
AUJ27243.1\|277152_277983_+	NAD(+) synthase	G3MA24	Bacillus_virus	1.3e-67	51.1
AUJ27244.1\|278179_279421_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	5.3e-118	57.4
AUJ27245.1\|282416_283571_+	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
AUJ27246.1\|283575_285006_+	capsular biosynthesis protein	NA	NA	NA	NA
AUJ27247.1\|285008_285707_+	glycosyl transferase	L7RBS6	Acanthamoeba_polyphaga_moumouvirus	2.1e-07	27.6
AUJ27248.1\|285694_286165_+	SprT family protein	NA	NA	NA	NA
AUJ27249.1\|286402_287050_+	N-acetylmuramidase	S5M633	Brevibacillus_phage	1.0e-27	47.7
AUJ27250.1\|287135_289382_+	ATP-dependent DNA helicase PcrA	A7KV33	Bacillus_phage	5.3e-132	41.5
AUJ27251.1\|289422_291429_+	DNA ligase (NAD(+)) LigA	A0A0K2QQN8	Ralstonia_phage	7.1e-104	36.1
AUJ28653.1\|291462_292590_+	sex pheromone biosynthesis protein	NA	NA	NA	NA
AUJ27252.1\|292603_292912_+\|tRNA	asparaginyl/glutamyl-tRNA amidotransferase subunit C	NA	NA	NA	NA
AUJ27253.1\|292911_294351_+\|tRNA	aspartyl/glutamyl-tRNA amidotransferase subunit A	NA	NA	NA	NA
AUJ27254.1\|294355_295786_+\|tRNA	aspartyl/glutamyl-tRNA amidotransferase subunit B	NA	NA	NA	NA
AUJ27255.1\|295810_296731_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.7e-18	25.8
AUJ27256.1\|296797_297451_+	hypothetical protein	NA	NA	NA	NA
AUJ27257.1\|297523_298228_-	hypothetical protein	NA	NA	NA	NA
AUJ27258.1\|298441_299299_+\|transposase	transposase	NA	NA	NA	NA
AUJ27259.1\|299383_299725_+	hypothetical protein	NA	NA	NA	NA
AUJ27260.1\|299761_301138_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
AUJ27261.1\|301503_302856_+	23S rRNA (uracil-5-)-methyltransferase RumA	F5CA72	Streptococcus_phi-m46.1-like_phage	1.9e-116	48.2
AUJ27262.1\|303315_304251_+\|integrase	integrase	H7BVY4	unidentified_phage	1.6e-29	31.3
AUJ27263.1\|304336_305299_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AUJ27264.1\|305317_306496_-	aspartate aminotransferase	NA	NA	NA	NA
AUJ28654.1\|306516_307302_-	hydrolase	NA	NA	NA	NA
AUJ27265.1\|307622_307928_-	hypothetical protein	A0A1V0SHK8	Klosneuvirus	4.0e-11	53.7
AUJ27266.1\|308266_309049_+\|integrase	integrase	H7BVY4	unidentified_phage	1.0e-21	31.3
AUJ27267.1\|309375_309579_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-19	71.9
AUJ27268.1\|309789_310236_+	hypothetical protein	NA	NA	NA	NA
AUJ27269.1\|311576_312077_+	acetyltransferase	NA	NA	NA	NA
AUJ27270.1\|312816_314142_+\|transposase	transposase	G3MB42	Bacillus_virus	4.7e-56	36.0
AUJ27271.1\|315825_317016_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.6e-124	57.7
317085:317103	attR	NA	NA	NA	NA

DBSCAN-SWA_5

333630 : 402520

Streptococcus_phage(15.38%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27284.1\|333630_334488_-\|transposase	transposase	NA	NA	NA	NA
AUJ27285.1\|335086_335827_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-38	41.4
AUJ27286.1\|335838_336657_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27287.1\|336656_337298_+	glutamine ABC transporter permease	NA	NA	NA	NA
AUJ27288.1\|337312_337966_+	glutamine ABC transporter permease	NA	NA	NA	NA
AUJ27289.1\|339965_341267_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27290.1\|341416_342760_-	hypothetical protein	NA	NA	NA	NA
AUJ27291.1\|342778_343048_-	hypothetical protein	NA	NA	NA	NA
AUJ27292.1\|344812_345616_+	DUF4931 domain-containing protein	NA	NA	NA	NA
AUJ27293.1\|346624_347317_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
AUJ27294.1\|347377_349393_+	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	8.5e-65	34.6
AUJ27295.1\|349510_350437_+	purine nucleosidase	NA	NA	NA	NA
AUJ27296.1\|351235_351430_+	hypothetical protein	NA	NA	NA	NA
AUJ27297.1\|352836_353160_+	hypothetical protein	NA	NA	NA	NA
AUJ27298.1\|353224_354043_-	sugar-phosphatase	NA	NA	NA	NA
AUJ27299.1\|355164_355959_+	Fe-S cluster assembly ATPase SufC	A0A1M7XV31	Cedratvirus	7.3e-12	27.6
AUJ27300.1\|355970_357248_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AUJ27301.1\|357222_358461_+	cysteine desulfurase	Q2XUY6	environmental_halophage	1.0e-97	41.8
AUJ27302.1\|358447_358909_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
AUJ27303.1\|358901_360305_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AUJ27304.1\|360304_360628_+	DNA methyltransferase	NA	NA	NA	NA
AUJ27305.1\|360714_361080_-	hypothetical protein	NA	NA	NA	NA
AUJ27306.1\|361085_361841_-	decarboxylase	NA	NA	NA	NA
AUJ27307.1\|362129_364529_+	phosphoketolase	NA	NA	NA	NA
AUJ27308.1\|364595_365444_+	patatin family protein	NA	NA	NA	NA
AUJ27309.1\|368606_368879_+	hypothetical protein	NA	NA	NA	NA
AUJ27310.1\|369694_371056_+	hemolysin	NA	NA	NA	NA
AUJ27311.1\|371163_371733_+	hypoxanthine phosphoribosyltransferase	A0A2K9L634	Tupanvirus	3.7e-10	27.6
AUJ27312.1\|373112_373817_+	lysozyme	NA	NA	NA	NA
AUJ27313.1\|373816_375049_+	helicase	A0A1B1IS59	uncultured_Mediterranean_phage	1.2e-34	28.5
AUJ27314.1\|375045_376374_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AUJ28655.1\|376541_376730_-	hypothetical protein	NA	NA	NA	NA
AUJ27315.1\|376837_377980_+	UDP-N-acetylglucosamine 2-epimerase	A0A0N9R0B2	Chrysochromulina_ericina_virus	1.2e-28	30.3
AUJ27316.1\|378003_378543_-	teichoic acid glycosylation protein	NA	NA	NA	NA
AUJ27317.1\|378535_378982_-	flavodoxin	NA	NA	NA	NA
AUJ27318.1\|379124_379952_+	type I methionyl aminopeptidase	NA	NA	NA	NA
AUJ27319.1\|379960_380884_+	ribonuclease BN-like family protein	NA	NA	NA	NA
AUJ27320.1\|380945_381845_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	6.4e-73	48.1
AUJ27321.1\|383470_384631_+	3-ketoacyl-CoA thiolase	NA	NA	NA	NA
AUJ27322.1\|384630_385842_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
AUJ27323.1\|385841_387005_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
AUJ27324.1\|387043_387328_-	hypothetical protein	NA	NA	NA	NA
AUJ27325.1\|388319_389657_-\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUJ28656.1\|389631_389862_-\|transposase	transposase	NA	NA	NA	NA
AUJ27326.1\|389901_390249_-\|transposase	transposase	NA	NA	NA	NA
AUJ27327.1\|390486_391575_-\|transposase	transposase	A0A1X9I5Z0	Streptococcus_phage	7.6e-52	38.8
AUJ27328.1\|391928_392198_+\|transposase	transposase	NA	NA	NA	NA
AUJ27329.1\|392201_392657_+\|transposase	transposase	NA	NA	NA	NA
AUJ27330.1\|392705_393290_+\|transposase	transposase	NA	NA	NA	NA
AUJ27331.1\|394003_395386_-	23S rRNA (uracil-5-)-methyltransferase RumA	A0A2K5B251	Erysipelothrix_phage	3.9e-69	33.2
AUJ27332.1\|395507_396323_+	recombination regulator RecX	NA	NA	NA	NA
AUJ27333.1\|396333_396816_+	hypothetical protein	NA	NA	NA	NA
AUJ27334.1\|396817_397279_-	hypothetical protein	NA	NA	NA	NA
AUJ27335.1\|397386_398259_+	magnesium/cobalt efflux protein	NA	NA	NA	NA
AUJ27336.1\|398258_399830_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	5.5e-35	26.2
AUJ27337.1\|399897_400179_-	hypothetical protein	NA	NA	NA	NA
AUJ27338.1\|400330_402520_-\|protease	Clp protease ClpE	A0A1C3S747	Escherichia_phage	2.3e-124	40.6

DBSCAN-SWA_6

558119 : 626803

unidentified_phage(20.0%)

transposase,integrase,tRNA,protease

attL 584918:584934|attR 627148:627164

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27465.1\|558119_559298_-\|transposase	transposase	NA	NA	NA	NA
AUJ28659.1\|560235_561084_+	hypothetical protein	NA	NA	NA	NA
AUJ27466.1\|561138_562155_-\|integrase	integrase	H7BWC8	unidentified_phage	2.6e-46	36.1
AUJ27467.1\|562211_562637_+	hypothetical protein	NA	NA	NA	NA
AUJ27468.1\|562780_563197_+	dolichyl-phosphate beta-D-mannosyltransferase	NA	NA	NA	NA
AUJ27469.1\|563193_564120_+	bactoprenol glucosyl transferase	V5USA4	Oenococcus_phage	2.2e-76	49.0
AUJ27470.1\|566221_567412_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.6e-122	57.2
AUJ27471.1\|568132_570772_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.8e-161	43.2
AUJ27472.1\|570772_572047_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AUJ27473.1\|572036_572714_+	hydrolase	NA	NA	NA	NA
AUJ27474.1\|572752_573376_+	DNA repair protein RadC	NA	NA	NA	NA
AUJ27475.1\|573471_574476_+	rod shape-determining protein	NA	NA	NA	NA
AUJ27476.1\|574521_575373_+	rod shape-determining protein MreC	NA	NA	NA	NA
AUJ27477.1\|575372_575912_+	rod shape-determining protein MreD	NA	NA	NA	NA
AUJ27478.1\|576180_576513_+	DUF3397 domain-containing protein	NA	NA	NA	NA
AUJ27479.1\|578044_579433_+\|transposase	transposase	A0A1B1P773	Bacillus_phage	6.9e-58	46.7
AUJ27480.1\|579538_579970_+	cell division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
AUJ28660.1\|579974_580922_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase	NA	NA	NA	NA
AUJ27481.1\|580935_581298_+	cell division protein FtsL	NA	NA	NA	NA
AUJ27482.1\|583452_584421_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AUJ27483.1\|584430_585810_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
584918:584934	attL	NA	NA	NA	NA
AUJ27484.1\|585811_586918_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
AUJ27485.1\|586934_587792_+	cell division protein FtsQ	NA	NA	NA	NA
AUJ27486.1\|587854_589213_+	cell division protein FtsA	NA	NA	NA	NA
AUJ27487.1\|589227_590547_+	cell division protein FtsZ	NA	NA	NA	NA
AUJ27488.1\|590564_591002_+	cell division protein SepF	NA	NA	NA	NA
AUJ27489.1\|591001_591304_+	cell division protein	NA	NA	NA	NA
AUJ27490.1\|591303_592104_+	RNA-binding protein	NA	NA	NA	NA
AUJ27491.1\|592079_592922_+	cell division protein DivIVA	NA	NA	NA	NA
AUJ27492.1\|593098_595882_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	1.5e-88	27.9
AUJ27493.1\|595881_596085_+	cold-shock protein	NA	NA	NA	NA
AUJ27494.1\|596104_596674_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AUJ27495.1\|596676_596985_+	hypothetical protein	NA	NA	NA	NA
AUJ27496.1\|597002_597698_+	5'-methylthioadenosine nucleosidase	NA	NA	NA	NA
AUJ27497.1\|597699_598857_+	cysteine desulfurase	H7BUW1	unidentified_phage	1.8e-27	37.5
AUJ27498.1\|598904_599246_+	hypothetical protein	NA	NA	NA	NA
AUJ27499.1\|599253_600381_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AUJ27500.1\|600473_601133_+	phosphoglycerate mutase	NA	NA	NA	NA
AUJ27501.1\|601132_601777_+	hypothetical protein	NA	NA	NA	NA
AUJ27502.1\|601776_604128_+	exodeoxyribonuclease V subunit alpha	A0A0K2FLP8	Brevibacillus_phage	4.8e-59	26.9
AUJ27503.1\|605171_606851_-	ribonuclease J	NA	NA	NA	NA
AUJ27504.1\|606857_607079_-	hypothetical protein	NA	NA	NA	NA
AUJ27505.1\|607433_607988_-	peptide deformylase	E3SLL2	Synechococcus_phage	3.6e-10	39.7
AUJ27506.1\|608239_610084_+	GTP-binding protein TypA	A0A2K5B2A5	Erysipelothrix_phage	3.6e-22	41.5
AUJ27507.1\|610179_611361_+	cell division protein FtsW	NA	NA	NA	NA
AUJ27508.1\|611357_611702_+	hypothetical protein	NA	NA	NA	NA
AUJ27509.1\|611698_612247_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AUJ27510.1\|612249_612744_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	9.7e-23	36.2
AUJ27511.1\|612727_613762_+	peptide-binding protein	NA	NA	NA	NA
AUJ27512.1\|613851_614553_+	competence protein	NA	NA	NA	NA
AUJ27513.1\|614521_616810_+	DNA internalization-related competence protein ComEC/Rec2	Q332C0	Clostridium_botulinum_C_phage	8.2e-24	31.0
AUJ27514.1\|616806_617793_+	DNA polymerase III subunit delta	NA	NA	NA	NA
AUJ27515.1\|617853_618111_-	30S ribosomal protein S20	NA	NA	NA	NA
AUJ28661.1\|618309_618579_+	30S ribosomal protein S15	NA	NA	NA	NA
AUJ27516.1\|618735_620508_+	RNase J family beta-CASP ribonuclease	NA	NA	NA	NA
AUJ27517.1\|620510_621344_+	hypothetical protein	NA	NA	NA	NA
AUJ27518.1\|621383_622349_-\|integrase	integrase	H7BWC8	unidentified_phage	2.9e-47	35.5
AUJ27519.1\|622732_623923_+	translation elongation factor Tu	A0A076FFS6	Aureococcus_anophage	5.2e-30	27.3
AUJ27520.1\|624067_625399_+	trigger factor	NA	NA	NA	NA
AUJ27521.1\|625528_626803_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.3e-132	55.6
627148:627164	attR	NA	NA	NA	NA

DBSCAN-SWA_7

631724 : 706569

Streptococcus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27525.1\|631724_631865_+\|transposase	transposase	NA	NA	NA	NA
AUJ27526.1\|631989_632232_+	hypothetical protein	NA	NA	NA	NA
AUJ27527.1\|632477_633704_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
AUJ27528.1\|635168_636485_+	diaminopimelate decarboxylase	NA	NA	NA	NA
AUJ27529.1\|636504_637215_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
AUJ27530.1\|637217_638372_+	N-acetyldiaminopimelate deacetylase	NA	NA	NA	NA
AUJ27531.1\|638373_639309_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AUJ27532.1\|639301_640081_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
AUJ27533.1\|640101_641268_+	amino acid aminotransferase	NA	NA	NA	NA
AUJ27534.1\|641279_642338_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AUJ27535.1\|642415_643810_+	hypothetical protein	A0A1B1P773	Bacillus_phage	5.7e-52	43.0
AUJ28662.1\|643929_645012_+	penicillin-binding protein	NA	NA	NA	NA
AUJ27536.1\|645083_645644_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AUJ27537.1\|645687_647298_-	beta-carotene 15,15'-monooxygenase	NA	NA	NA	NA
AUJ27538.1\|647904_648420_+	hypothetical protein	NA	NA	NA	NA
AUJ27539.1\|648482_649412_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27540.1\|649550_650471_+	aldo/keto reductase	NA	NA	NA	NA
AUJ27541.1\|650639_652346_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	6.0e-88	36.7
AUJ27542.1\|653926_654562_-	transcriptional regulator	NA	NA	NA	NA
AUJ27543.1\|656703_657258_-	isochorismatase	G3MA16	Bacillus_virus	4.7e-34	41.8
AUJ28663.1\|658967_660146_+\|transposase	transposase	NA	NA	NA	NA
AUJ27544.1\|660412_661117_+	ADP-ribose pyrophosphatase	G3MA14	Bacillus_virus	2.5e-08	25.9
AUJ27545.1\|663610_664852_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	7.4e-120	56.8
AUJ27546.1\|665011_665950_-	PTS beta-glucoside transporter subunit IIC	NA	NA	NA	NA
AUJ27547.1\|668507_668996_+	nitroreductase	NA	NA	NA	NA
AUJ27548.1\|669147_669750_+	DUF4767 domain-containing protein	NA	NA	NA	NA
AUJ27549.1\|669825_671112_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.3e-108	51.7
AUJ27550.1\|672335_674063_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	8.0e-88	37.1
AUJ27551.1\|674028_674604_-	hypothetical protein	NA	NA	NA	NA
AUJ27552.1\|676556_677513_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.6e-114	60.5
AUJ27553.1\|677527_678046_+	diacylglycerol kinase	G3MBI7	Bacillus_virus	7.6e-26	40.1
AUJ27554.1\|679642_682060_+	ATPase P	E4ZFI9	Streptococcus_phage	1.2e-17	20.4
AUJ27555.1\|682411_683272_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27556.1\|683284_684346_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-29	35.2
AUJ27557.1\|684338_685040_+	methionine ABC transporter permease	NA	NA	NA	NA
AUJ27558.1\|686514_686739_-	hypothetical protein	NA	NA	NA	NA
AUJ27559.1\|686926_688330_+	class II fumarate hydratase	NA	NA	NA	NA
AUJ27560.1\|688341_689718_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	2.9e-56	32.1
AUJ27561.1\|690073_690334_+	hypothetical protein	NA	NA	NA	NA
AUJ27562.1\|691004_691307_+	mucus-binding protein	NA	NA	NA	NA
AUJ27563.1\|691354_691522_+	mucus-binding protein	NA	NA	NA	NA
AUJ27564.1\|692704_693082_+	hypothetical protein	NA	NA	NA	NA
AUJ27565.1\|693088_693589_+	hypothetical protein	NA	NA	NA	NA
AUJ27566.1\|693595_693940_+	hypothetical protein	NA	NA	NA	NA
AUJ27567.1\|694075_695191_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.3e-112	56.2
AUJ27568.1\|695476_696160_+	hypothetical protein	NA	NA	NA	NA
AUJ27569.1\|696175_696391_+	hypothetical protein	NA	NA	NA	NA
AUJ27570.1\|696387_698922_+	hypothetical protein	NA	NA	NA	NA
AUJ27571.1\|699083_700010_+	L-lactate dehydrogenase	NA	NA	NA	NA
AUJ27572.1\|700539_702417_+	hypothetical protein	NA	NA	NA	NA
AUJ27573.1\|702583_702817_+	hypothetical protein	NA	NA	NA	NA
AUJ27574.1\|702836_703106_+	hypothetical protein	NA	NA	NA	NA
AUJ27575.1\|703705_705019_+	aminopeptidase	R4TV59	Phaeocystis_globosa_virus	8.5e-58	32.3
AUJ28664.1\|705390_706569_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_8

773919 : 833439

Staphylococcus_phage(15.38%)

transposase,integrase,tRNA

attL 802976:803000|attR 832484:832508

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27628.1\|773919_775119_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	8.6e-49	34.1
AUJ27629.1\|775156_775849_-	hemolysin III	NA	NA	NA	NA
AUJ28666.1\|775965_776796_+	fatty acid-binding protein DegV	A0A0N9SI50	Staphylococcus_phage	5.3e-21	45.9
AUJ27630.1\|776798_777029_+	hypothetical protein	NA	NA	NA	NA
AUJ27631.1\|777076_778669_+	sodium:proton antiporter	NA	NA	NA	NA
AUJ27632.1\|778692_779544_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
AUJ27633.1\|779533_780286_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	2.6e-27	38.7
AUJ27634.1\|780346_781195_+	DNA protecting protein DprA	S6BFL3	Thermus_phage	4.9e-30	36.8
AUJ27635.1\|781266_783381_+	DNA topoisomerase I	E3T4K4	Cafeteria_roenbergensis_virus	3.8e-100	37.7
AUJ27636.1\|783402_784719_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
AUJ27637.1\|784718_785627_+	tyrosine recombinase XerC	A0A1P8DJJ6	Virus_Rctr41k	2.3e-14	25.1
AUJ27638.1\|785635_786160_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AUJ27639.1\|786170_787574_+	HslU--HslV peptidase ATPase subunit	A0A1B2IB03	Erwinia_phage	7.5e-28	24.9
AUJ27640.1\|787726_788626_+	aldose epimerase	NA	NA	NA	NA
AUJ27641.1\|789693_790509_-\|integrase	integrase	NA	NA	NA	NA
AUJ27642.1\|790789_791173_+	chromosome condensation protein CrcB	A0A2H4PQR0	Staphylococcus_phage	3.1e-08	36.5
AUJ27643.1\|791174_791552_+	camphor resistance protein CrcB	NA	NA	NA	NA
AUJ27644.1\|791632_792490_-\|transposase	transposase	NA	NA	NA	NA
AUJ27645.1\|792735_793116_+	hypothetical protein	NA	NA	NA	NA
AUJ27646.1\|793116_794703_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.9e-13	23.1
AUJ27647.1\|797423_797666_+	hypothetical protein	NA	NA	NA	NA
AUJ27648.1\|797721_797991_+	hypothetical protein	NA	NA	NA	NA
AUJ27649.1\|798238_798469_+	hypothetical protein	NA	NA	NA	NA
AUJ27650.1\|800090_801317_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	5.2e-65	38.1
AUJ28667.1\|802209_802989_+\|transposase	transposase	NA	NA	NA	NA
802976:803000	attL	NA	NA	NA	NA
AUJ27651.1\|803191_805288_+	ornithine decarboxylase	NA	NA	NA	NA
AUJ27652.1\|805304_806564_+	aluminum resistance protein	NA	NA	NA	NA
AUJ28668.1\|807621_809394_+	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	7.7e-78	38.8
AUJ27653.1\|809502_809952_+	transcriptional regulator	NA	NA	NA	NA
AUJ27654.1\|810915_811530_+	acetyltransferase	A0A1V0SJ47	Klosneuvirus	2.1e-06	37.7
AUJ27655.1\|811654_812752_+	penicillin-binding protein	NA	NA	NA	NA
AUJ27656.1\|812818_813640_+	pyridoxal kinase	NA	NA	NA	NA
AUJ27657.1\|813646_814204_+	hypothetical protein	NA	NA	NA	NA
AUJ27658.1\|814285_815491_+	hypothetical protein	NA	NA	NA	NA
AUJ28669.1\|815539_816790_-	MATE family efflux transporter	NA	NA	NA	NA
AUJ27659.1\|817031_818318_+	peptidase T	NA	NA	NA	NA
AUJ28670.1\|818323_818536_+	hypothetical protein	NA	NA	NA	NA
AUJ27660.1\|818580_818775_+	hypothetical protein	NA	NA	NA	NA
AUJ27661.1\|819077_819428_+	hypothetical protein	NA	NA	NA	NA
AUJ27662.1\|819518_820151_+	hypothetical protein	NA	NA	NA	NA
AUJ27663.1\|821573_822155_-	hypothetical protein	NA	NA	NA	NA
AUJ27664.1\|822220_823402_-	permease	NA	NA	NA	NA
AUJ27665.1\|823490_824201_-	GNAT family acetyltransferase	NA	NA	NA	NA
AUJ27666.1\|824262_824616_-	hypothetical protein	NA	NA	NA	NA
AUJ28671.1\|824787_825264_+	GNAT family acetyltransferase	NA	NA	NA	NA
AUJ27667.1\|825260_825542_+	acyltransferase	NA	NA	NA	NA
AUJ27668.1\|825577_825949_+	cytidine deaminase	NA	NA	NA	NA
AUJ27669.1\|825964_826726_+	phosphorylase	NA	NA	NA	NA
AUJ27670.1\|826728_827352_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AUJ27671.1\|827742_828102_+	hypothetical protein	NA	NA	NA	NA
AUJ27672.1\|828211_828703_+	DUF5067 domain-containing protein	NA	NA	NA	NA
AUJ27673.1\|829207_829666_+	hypothetical protein	NA	NA	NA	NA
AUJ28672.1\|829742_830591_+\|integrase	integrase	A0A1B1P773	Bacillus_phage	6.1e-57	46.3
AUJ27674.1\|830868_831147_+	prevent-host-death family protein	NA	NA	NA	NA
AUJ27675.1\|831146_831494_+	addiction module toxin RelE	NA	NA	NA	NA
AUJ27676.1\|831878_832382_+	hypothetical protein	NA	NA	NA	NA
AUJ27677.1\|832581_833439_+\|transposase	transposase	NA	NA	NA	NA
832484:832508	attR	NA	NA	NA	NA

DBSCAN-SWA_9

839287 : 891926

Lactobacillus_virus(18.18%)

transposase,integrase

attL 841278:841293|attR 896829:896844

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27683.1\|839287_840478_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	4.9e-121	56.7
AUJ27684.1\|840874_841309_+	histidine kinase	NA	NA	NA	NA
841278:841293	attL	NA	NA	NA	NA
AUJ27685.1\|841305_841734_+	hypothetical protein	NA	NA	NA	NA
AUJ27686.1\|842057_843563_+	ABC-F type ribosomal protection protein	A0A2K9L3Z8	Tupanvirus	4.9e-25	25.5
AUJ27687.1\|844089_845268_+\|transposase	transposase	NA	NA	NA	NA
AUJ27688.1\|846168_847854_-	hypothetical protein	NA	NA	NA	NA
AUJ27689.1\|849338_851285_-	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	1.8e-59	29.3
AUJ27690.1\|851494_851860_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AUJ27691.1\|852134_853481_+	serine/threonine protein kinase	NA	NA	NA	NA
AUJ27692.1\|853512_854700_+	amidohydrolase	NA	NA	NA	NA
AUJ27693.1\|855089_855389_+	hypothetical protein	NA	NA	NA	NA
AUJ28673.1\|855734_856019_+	homocysteine methyltransferase	NA	NA	NA	NA
AUJ28674.1\|857399_858674_+	DNA replication initiation protein	NA	NA	NA	NA
AUJ27694.1\|860474_861008_+	hypoxanthine phosphoribosyltransferase	NA	NA	NA	NA
AUJ27695.1\|861164_861395_+	replication-associated protein RepA	NA	NA	NA	NA
AUJ27696.1\|861529_862081_+	hypothetical protein	NA	NA	NA	NA
AUJ27697.1\|862235_863426_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	6.6e-126	59.0
AUJ27698.1\|863614_863854_+	hypothetical protein	NA	NA	NA	NA
AUJ27699.1\|864886_865222_+	hypothetical protein	NA	NA	NA	NA
AUJ27700.1\|865604_866984_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
AUJ27701.1\|867053_868094_+	hypothetical protein	A0A1B1P773	Bacillus_phage	1.2e-35	44.4
AUJ27702.1\|868078_868288_+\|transposase	transposase	A0A2I6AZV9	Macacine_betaherpesvirus	6.8e-10	53.2
AUJ27703.1\|868341_869745_-	dipeptidase PepV	NA	NA	NA	NA
AUJ27704.1\|869795_870962_+	serine hydrolase	NA	NA	NA	NA
AUJ27705.1\|871074_873813_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AUJ27706.1\|873848_874061_-	transcriptional regulator	NA	NA	NA	NA
AUJ27707.1\|874123_874447_+	hypothetical protein	NA	NA	NA	NA
AUJ27708.1\|874622_875378_+	hypothetical protein	NA	NA	NA	NA
AUJ27709.1\|875536_875980_+	acetyltransferase	NA	NA	NA	NA
AUJ27710.1\|876069_876483_-	hypothetical protein	NA	NA	NA	NA
AUJ27711.1\|876484_876922_-	LytTR family transcriptional regulator	NA	NA	NA	NA
AUJ27712.1\|877099_877375_+	hypothetical protein	NA	NA	NA	NA
AUJ27713.1\|877440_878094_-	endonuclease III	NA	NA	NA	NA
AUJ27714.1\|878533_878884_+	dihydroneopterin aldolase	NA	NA	NA	NA
AUJ27715.1\|879938_881276_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AUJ27716.1\|881265_882357_+	dihydropteroate synthase	NA	NA	NA	NA
AUJ27717.1\|882368_882905_+	phosphohydrolase	NA	NA	NA	NA
AUJ27718.1\|883062_883347_+	hypothetical protein	NA	NA	NA	NA
AUJ27719.1\|883774_884041_-\|transposase	transposase	NA	NA	NA	NA
AUJ27720.1\|884193_884391_-	hypothetical protein	NA	NA	NA	NA
AUJ27721.1\|884839_885499_+	polar amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27722.1\|885479_886154_+	amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27723.1\|886163_886904_+	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-33	35.2
AUJ27724.1\|886915_887776_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27725.1\|887921_888356_+	hypothetical protein	NA	NA	NA	NA
AUJ27726.1\|888337_888625_+\|transposase	transposase	A0A0C5AJ29	Paenibacillus_phage	2.7e-09	45.1
AUJ28675.1\|888705_889626_+\|integrase	integrase	A0A0C5AC89	Paenibacillus_phage	1.6e-34	39.2
AUJ27727.1\|889739_890240_+	DNA methyltransferase	A0A1S5PRR3	Streptococcus_phage	1.6e-33	45.4
AUJ27728.1\|890551_891190_+	hypothetical protein	NA	NA	NA	NA
AUJ27729.1\|891305_891926_+\|integrase	integrase	E2ELN7	Clostridium_phage	4.3e-20	36.4
896829:896844	attR	NA	NA	NA	NA

DBSCAN-SWA_10

973595 : 1044958

Streptococcus_phage(17.65%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27801.1\|973595_975659_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AUJ27802.1\|975651_976569_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AUJ27803.1\|976822_977575_-	DNA repair protein RecO	NA	NA	NA	NA
AUJ27804.1\|977575_978481_-	GTPase Era	NA	NA	NA	NA
AUJ27805.1\|978480_979005_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
AUJ27806.1\|979007_979967_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	1.7e-47	46.1
AUJ27807.1\|979992_980436_-	hypothetical protein	A0A292GL36	Xanthomonas_phage	1.5e-11	32.9
AUJ27808.1\|980546_980723_-	30S ribosomal protein S21	NA	NA	NA	NA
AUJ27809.1\|980978_981815_+	transcriptional regulator	NA	NA	NA	NA
AUJ27810.1\|982168_982618_+	peptidase M23	NA	NA	NA	NA
AUJ27811.1\|982818_983697_+	hypothetical protein	NA	NA	NA	NA
AUJ27812.1\|984878_985736_-\|transposase	transposase	NA	NA	NA	NA
AUJ27813.1\|986376_986988_-	transcriptional regulator	NA	NA	NA	NA
AUJ27814.1\|987167_988334_-	GNAT family acetyltransferase	NA	NA	NA	NA
AUJ27815.1\|988454_988991_-	holo-ACP synthase CitX	NA	NA	NA	NA
AUJ27816.1\|992293_993148_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUJ27817.1\|993276_995550_+	proton-efflux P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.7e-43	26.8
AUJ27818.1\|995618_996116_-	lactocepin S-layer protein	NA	NA	NA	NA
AUJ27819.1\|996258_997116_-\|transposase	transposase	NA	NA	NA	NA
AUJ28677.1\|998871_999630_+	homoserine O-succinyltransferase	NA	NA	NA	NA
AUJ27820.1\|999645_1000575_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	4.4e-101	59.9
AUJ27821.1\|1000718_1001246_-	adenine phosphoribosyltransferase	NA	NA	NA	NA
AUJ27822.1\|1001350_1003624_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-77	35.9
AUJ27823.1\|1003744_1004434_-	class A sortase	NA	NA	NA	NA
AUJ27824.1\|1004436_1006275_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	4.0e-21	24.1
AUJ27825.1\|1006443_1006659_+	hypothetical protein	NA	NA	NA	NA
AUJ27826.1\|1007513_1008668_-	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	9.6e-21	30.2
AUJ27827.1\|1008749_1010576_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	5.4e-143	49.3
AUJ27828.1\|1010593_1011193_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AUJ27829.1\|1011208_1012258_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AUJ27830.1\|1012427_1013390_-	riboflavin biosynthesis protein RibF	A0A1V0SD03	Indivirus	6.1e-05	30.1
AUJ27831.1\|1013395_1014289_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AUJ27832.1\|1014340_1014706_-	ribosome-binding factor A	NA	NA	NA	NA
AUJ27833.1\|1014725_1017338_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.7e-21	24.5
AUJ27834.1\|1017342_1017654_-	50S ribosomal protein L7	NA	NA	NA	NA
AUJ28678.1\|1017656_1017932_-	DNA-binding protein	NA	NA	NA	NA
AUJ28679.1\|1017962_1019144_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AUJ27835.1\|1019163_1019640_-	ribosome maturation factor RimP	NA	NA	NA	NA
AUJ27836.1\|1019749_1024060_-	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	1.2e-18	34.1
AUJ27837.1\|1024065_1025763_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AUJ27838.1\|1025805_1027062_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AUJ27839.1\|1027072_1027888_-	CDP-diglyceride synthetase	NA	NA	NA	NA
AUJ27840.1\|1027889_1028624_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.5e-22	39.0
AUJ27841.1\|1028626_1029184_-	ribosome recycling factor	NA	NA	NA	NA
AUJ27842.1\|1029183_1029909_-	UMP kinase	NA	NA	NA	NA
AUJ27843.1\|1030047_1031073_-	translation elongation factor Ts	NA	NA	NA	NA
AUJ27844.1\|1031106_1031880_-	30S ribosomal protein S2	NA	NA	NA	NA
AUJ27845.1\|1032041_1033073_-	methyltransferase	NA	NA	NA	NA
AUJ27846.1\|1033138_1033753_+	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
AUJ27847.1\|1033807_1034989_+	cyclopropane-fatty-acyl-phospholipid synthase	A0A2K9L4K8	Tupanvirus	4.7e-47	36.1
AUJ27848.1\|1035046_1036990_-	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	7.2e-61	28.4
AUJ27849.1\|1039929_1041120_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.3e-121	57.7
AUJ27850.1\|1042231_1043491_+\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	1.0e-07	22.0
AUJ27851.1\|1043731_1044958_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.1e-64	37.9

DBSCAN-SWA_11

1083139 : 1200192

Streptococcus_phage(14.29%)

transposase,integrase,tRNA

attL 1093861:1093900|attR 1108397:1108436

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27884.1\|1083139_1084066_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	6.1e-10	30.2
AUJ27885.1\|1084097_1086497_-	primosomal protein N'	NA	NA	NA	NA
AUJ27886.1\|1086547_1086772_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AUJ27887.1\|1086774_1087389_-	guanylate kinase	A0A212Q4J6	Cowpox_virus	6.2e-19	29.8
AUJ27888.1\|1087960_1089643_-	DNA repair protein RecN	NA	NA	NA	NA
AUJ27889.1\|1089653_1090466_-	cell division protein FtsJ	NA	NA	NA	NA
AUJ27890.1\|1090466_1091336_-	geranyl transferase	NA	NA	NA	NA
AUJ27891.1\|1091338_1091581_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
AUJ27892.1\|1092915_1093764_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.9e-42	43.1
1093861:1093900	attL	NA	NA	NA	NA
AUJ27893.1\|1093929_1094937_-\|integrase	integrase	H7BWC8	unidentified_phage	8.0e-48	36.1
AUJ27894.1\|1095074_1095923_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.9e-42	43.1
AUJ27895.1\|1095981_1096374_-	transcription antitermination factor NusB	NA	NA	NA	NA
AUJ27896.1\|1096381_1096807_-	alkaline-shock protein	NA	NA	NA	NA
AUJ27897.1\|1096824_1097394_-	elongation factor P	NA	NA	NA	NA
AUJ27898.1\|1097477_1098587_-	X-Pro dipeptidase	NA	NA	NA	NA
AUJ27899.1\|1098696_1098987_-	50S ribosomal protein L27	NA	NA	NA	NA
AUJ27900.1\|1099005_1099317_-	50S ribosomal protein L21	NA	NA	NA	NA
AUJ27901.1\|1100988_1102014_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
AUJ27902.1\|1102057_1102735_-	hypothetical protein	NA	NA	NA	NA
AUJ27903.1\|1102800_1102980_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AUJ27904.1\|1103050_1104847_-	hypothetical protein	NA	NA	NA	NA
AUJ27905.1\|1104969_1106190_-	lysin	X2CXX8	Lactobacillus_phage	1.7e-60	50.9
AUJ27906.1\|1106648_1107545_+	lipase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.8e-11	26.6
AUJ27907.1\|1107553_1107910_+	arsenate reductase	M1PLC0	Streptococcus_phage	5.0e-13	38.6
AUJ27908.1\|1107996_1108221_-	hypothetical protein	NA	NA	NA	NA
AUJ27909.1\|1108624_1111006_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
1108397:1108436	attR	NA	NA	NA	NA
AUJ27910.1\|1111057_1111483_-	peptide-methionine (R)-S-oxide reductase	NA	NA	NA	NA
AUJ27911.1\|1111475_1111757_-	hypothetical protein	NA	NA	NA	NA
AUJ27912.1\|1111871_1112735_-	sugar transporter	NA	NA	NA	NA
AUJ27913.1\|1113057_1114020_-	mucus-binding protein	NA	NA	NA	NA
AUJ27914.1\|1114443_1115622_-\|transposase	transposase	NA	NA	NA	NA
AUJ27915.1\|1116759_1119948_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
AUJ27916.1\|1121024_1122302_-	dihydroorotase	NA	NA	NA	NA
AUJ27917.1\|1122301_1123258_-	aspartate carbamoyltransferase	M1HGA5	Paramecium_bursaria_Chlorella_virus	1.6e-26	34.1
AUJ27918.1\|1123402_1123945_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase	NA	NA	NA	NA
AUJ27919.1\|1124111_1125035_-	dihydroorotate dehydrogenase B catalytic subunit	NA	NA	NA	NA
AUJ27920.1\|1125289_1125994_+	orotidine 5'-phosphate decarboxylase	NA	NA	NA	NA
AUJ27921.1\|1125995_1126619_+	orotate phosphoribosyltransferase	A0A0B5IW17	Pandoravirus	9.1e-26	32.9
AUJ28684.1\|1126843_1127122_-	damage-inducible protein J	NA	NA	NA	NA
AUJ27922.1\|1129049_1131671_+	ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.1e-83	30.0
AUJ27923.1\|1131865_1133125_+\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	2.3e-07	21.7
AUJ27924.1\|1133365_1134592_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.5e-64	37.9
AUJ27925.1\|1134867_1136100_-	MFS transporter	NA	NA	NA	NA
AUJ27926.1\|1136471_1137797_-\|transposase	transposase	G3MB42	Bacillus_virus	1.2e-56	36.3
AUJ27927.1\|1137826_1138435_-	resolvase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
AUJ27928.1\|1139980_1142164_-	hypothetical protein	NA	NA	NA	NA
AUJ28685.1\|1142214_1143393_-\|transposase	transposase	NA	NA	NA	NA
AUJ27929.1\|1143512_1144502_-	hypothetical protein	NA	NA	NA	NA
AUJ27930.1\|1144718_1145576_-\|transposase	transposase	NA	NA	NA	NA
AUJ27931.1\|1147051_1147471_+	DDE endonuclease	NA	NA	NA	NA
AUJ27932.1\|1147542_1147857_+\|transposase	transposase	NA	NA	NA	NA
AUJ27933.1\|1147873_1148170_+	DNA methyltransferase	NA	NA	NA	NA
AUJ27934.1\|1148216_1149077_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27935.1\|1149089_1149830_-	glutamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.1e-25	30.8
AUJ27936.1\|1149839_1150514_-	amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27937.1\|1150494_1151154_-	polar amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27938.1\|1151306_1151540_+	hypothetical protein	NA	NA	NA	NA
AUJ28686.1\|1151927_1152095_-	quaternary ammonium transporter	NA	NA	NA	NA
AUJ27939.1\|1152193_1153945_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ27940.1\|1154287_1154797_-	hypothetical protein	NA	NA	NA	NA
AUJ27941.1\|1154836_1155184_-	hypothetical protein	NA	NA	NA	NA
AUJ27942.1\|1155256_1155469_-\|transposase	transposase	NA	NA	NA	NA
AUJ27943.1\|1155720_1156950_-	MFS transporter	NA	NA	NA	NA
AUJ27944.1\|1157206_1158613_-\|transposase	transposase	NA	NA	NA	NA
AUJ27945.1\|1159944_1161396_-	hypothetical protein	NA	NA	NA	NA
AUJ27946.1\|1161716_1162895_+\|transposase	transposase	NA	NA	NA	NA
AUJ27947.1\|1162988_1163459_+	hypothetical protein	NA	NA	NA	NA
AUJ27948.1\|1163561_1164188_-	hypothetical protein	NA	NA	NA	NA
AUJ27949.1\|1164837_1165185_+\|transposase	transposase	NA	NA	NA	NA
AUJ28687.1\|1165224_1165455_+\|transposase	transposase	NA	NA	NA	NA
AUJ27950.1\|1165429_1166767_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUJ27951.1\|1166866_1167652_-	hypothetical protein	NA	NA	NA	NA
AUJ27952.1\|1169316_1170027_-	oxidoreductase	NA	NA	NA	NA
AUJ27953.1\|1170046_1170454_-	hypothetical protein	NA	NA	NA	NA
AUJ27954.1\|1170472_1171645_-	MFS transporter permease	NA	NA	NA	NA
AUJ27955.1\|1174184_1174784_-	hypothetical protein	NA	NA	NA	NA
AUJ27956.1\|1174840_1175323_-	hypothetical protein	NA	NA	NA	NA
AUJ27957.1\|1175443_1176439_-	galactose mutarotase	NA	NA	NA	NA
AUJ27958.1\|1176558_1178022_-	galactose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AUJ27959.1\|1178043_1179210_-	galactokinase	NA	NA	NA	NA
AUJ27960.1\|1185655_1186885_-	MFS transporter	NA	NA	NA	NA
AUJ27961.1\|1191607_1192693_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.2e-77	49.3
AUJ27962.1\|1192761_1194306_+	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-14	26.9
AUJ27963.1\|1194286_1195450_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUJ27964.1\|1195439_1196396_+	sugar ABC transporter permease	NA	NA	NA	NA
AUJ27965.1\|1197465_1198725_+\|transposase	transposase	Q6V7R1	Burkholderia_virus	1.4e-09	22.4
AUJ27966.1\|1198965_1200192_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4

DBSCAN-SWA_12

1238984 : 1305283

Bacillus_phage(36.36%)

transposase,tRNA,protease,bacteriocin,integrase

attL 1252323:1252339|attR 1279717:1279733

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ27993.1\|1238984_1239665_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AUJ27994.1\|1239685_1240246_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AUJ27995.1\|1240308_1240458_-	50S ribosomal protein L33	NA	NA	NA	NA
AUJ27996.1\|1240534_1242643_-	cell division protein FtsI	NA	NA	NA	NA
AUJ27997.1\|1242733_1245325_+	ABC transporter permease	NA	NA	NA	NA
AUJ27998.1\|1245432_1246356_+	N-acetylglucosamine kinase	NA	NA	NA	NA
AUJ27999.1\|1246421_1247816_-	hypothetical protein	A0A1B1P773	Bacillus_phage	5.7e-52	43.0
AUJ28000.1\|1247889_1248162_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUJ28001.1\|1248154_1248496_-	addiction module toxin RelE	NA	NA	NA	NA
AUJ28002.1\|1248694_1249609_-	L-lactate dehydrogenase	NA	NA	NA	NA
AUJ28003.1\|1249672_1250149_-	transcription elongation factor GreA	NA	NA	NA	NA
AUJ28004.1\|1250225_1252640_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
1252323:1252339	attL	NA	NA	NA	NA
AUJ28005.1\|1252643_1253693_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.2e-33	37.3
AUJ28006.1\|1253977_1254328_-	MarR family transcriptional regulator	NA	NA	NA	NA
AUJ28007.1\|1254438_1255206_-	rRNA methyltransferase	NA	NA	NA	NA
AUJ28691.1\|1255303_1255576_+	acylphosphatase	NA	NA	NA	NA
AUJ28008.1\|1255622_1256585_+	insertase	NA	NA	NA	NA
AUJ28009.1\|1256632_1257121_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
AUJ28010.1\|1257157_1258717_-	two-component sensor histidine kinase	NA	NA	NA	NA
AUJ28011.1\|1258703_1259420_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.8e-25	30.1
AUJ28012.1\|1259582_1260137_-	DNA-binding protein	NA	NA	NA	NA
AUJ28013.1\|1260138_1261290_-	hypothetical protein	NA	NA	NA	NA
AUJ28014.1\|1261295_1261643_-	ribosome silencing factor	NA	NA	NA	NA
AUJ28015.1\|1261664_1262258_-	HD domain-containing protein	NA	NA	NA	NA
AUJ28016.1\|1262238_1262895_-	nicotinate (nicotinamide) nucleotide adenylyltransferase	NA	NA	NA	NA
AUJ28017.1\|1262905_1264015_-	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
AUJ28018.1\|1264007_1264532_-	HAD family hydrolase	NA	NA	NA	NA
AUJ28019.1\|1264677_1265034_-	50S ribosomal protein L20	NA	NA	NA	NA
AUJ28020.1\|1265077_1265278_-	50S ribosomal protein L35	NA	NA	NA	NA
AUJ28021.1\|1265299_1265779_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.0e-13	38.7
AUJ28693.1\|1266023_1267262_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AUJ28692.1\|1267429_1267711_-	hypothetical protein	NA	NA	NA	NA
AUJ28022.1\|1267808_1269059_-	hypothetical protein	NA	NA	NA	NA
AUJ28023.1\|1269175_1270225_+\|integrase	integrase	H7BWC8	unidentified_phage	2.7e-46	34.3
AUJ28024.1\|1270419_1270950_-	hypothetical protein	NA	NA	NA	NA
AUJ28025.1\|1271100_1271622_-	hypothetical protein	NA	NA	NA	NA
AUJ28026.1\|1271779_1273714_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.6e-97	33.4
AUJ28694.1\|1274004_1274913_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	9.2e-27	28.1
AUJ28027.1\|1274944_1276276_-	chromosome replication initiation protein	NA	NA	NA	NA
AUJ28028.1\|1276278_1276746_-	transcriptional regulator NrdR	NA	NA	NA	NA
AUJ28029.1\|1276748_1277351_-	dephospho-CoA kinase	NA	NA	NA	NA
AUJ28030.1\|1277347_1278178_-	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	7.1e-18	25.9
AUJ28031.1\|1278186_1280850_-	DNA polymerase I	F8WQ35	Bacillus_phage	8.9e-62	30.6
1279717:1279733	attR	NA	NA	NA	NA
AUJ28695.1\|1282471_1282753_-	CRISPR-associated endonuclease Cas2	NA	NA	NA	NA
AUJ28032.1\|1283756_1284248_-	CRISPR-associated protein Cas4	NA	NA	NA	NA
AUJ28033.1\|1284263_1286693_-	hypothetical protein	A0A2R2ZGW0	Clostridioides_phage	4.8e-30	23.5
AUJ28034.1\|1286835_1287549_-	type I-B CRISPR-associated protein Cas5	NA	NA	NA	NA
AUJ28035.1\|1287535_1288438_-	type I-B CRISPR-associated protein Cas7/Cst2/DevR	NA	NA	NA	NA
AUJ28036.1\|1288456_1290214_-	type I-B CRISPR-associated protein Cas8b1/Cst1	NA	NA	NA	NA
AUJ28037.1\|1290231_1290987_-	CRISPR-associated endoribonuclease Cas6	NA	NA	NA	NA
AUJ28038.1\|1294279_1295161_-	hypothetical protein	NA	NA	NA	NA
AUJ28039.1\|1295178_1295493_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUJ28040.1\|1295899_1296877_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AUJ28041.1\|1297014_1298529_+	aminopeptidase	NA	NA	NA	NA
AUJ28042.1\|1298617_1299595_+	cell surface protein	NA	NA	NA	NA
AUJ28043.1\|1299648_1300962_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AUJ28044.1\|1301105_1301624_-	hypothetical protein	NA	NA	NA	NA
AUJ28045.1\|1303353_1303701_+\|transposase	transposase	NA	NA	NA	NA
AUJ28696.1\|1303740_1303971_+\|transposase	transposase	NA	NA	NA	NA
AUJ28046.1\|1303945_1305283_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4

DBSCAN-SWA_13

1564463 : 1607350

Agrobacterium_phage(12.5%)

bacteriocin,transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ28264.1\|1564463_1566944_-\|protease	ATP-dependent Clp protease ATP-binding protein ClpC	A0A223W0B1	Agrobacterium_phage	1.6e-118	33.4
AUJ28265.1\|1567048_1567504_-	histidine kinase	NA	NA	NA	NA
AUJ28266.1\|1567868_1568351_-	hypothetical protein	NA	NA	NA	NA
AUJ28267.1\|1568662_1570213_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.5e-82	35.6
AUJ28268.1\|1570228_1571254_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
AUJ28269.1\|1571331_1572222_-	Hsp33 family molecular chaperone	NA	NA	NA	NA
AUJ28270.1\|1572274_1574440_-	cell division protein FtsH	A0A0P0BXI2	Ostreococcus_lucimarinus_virus	1.1e-107	41.0
AUJ28271.1\|1574534_1575791_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
AUJ28272.1\|1575831_1576194_-	RNA-binding protein	NA	NA	NA	NA
AUJ28273.1\|1576193_1576571_-	septation inhibitor protein	NA	NA	NA	NA
AUJ28274.1\|1576636_1576879_-	hypothetical protein	NA	NA	NA	NA
AUJ28275.1\|1576890_1580388_-	transcription-repair coupling factor	NA	NA	NA	NA
AUJ28276.1\|1580389_1580947_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AUJ28277.1\|1581081_1582053_+	L-lactate dehydrogenase	NA	NA	NA	NA
AUJ28278.1\|1582230_1582938_+	hypothetical protein	NA	NA	NA	NA
AUJ28706.1\|1582989_1583475_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUJ28279.1\|1583719_1584850_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.6e-28	27.7
AUJ28280.1\|1584852_1585209_-	holo-ACP synthase	NA	NA	NA	NA
AUJ28281.1\|1585291_1586803_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-70	39.1
AUJ28282.1\|1586816_1588184_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
AUJ28283.1\|1588310_1588556_-	50S ribosomal protein L31	NA	NA	NA	NA
AUJ28284.1\|1588740_1589571_+	sugar-phosphatase	NA	NA	NA	NA
AUJ28285.1\|1589757_1590948_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.5e-122	56.9
AUJ28286.1\|1591286_1592363_-	cell surface protein	NA	NA	NA	NA
AUJ28287.1\|1592458_1593424_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AUJ28288.1\|1593803_1594667_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUJ28289.1\|1598012_1599248_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.2e-101	53.2
AUJ28290.1\|1599618_1600476_+\|transposase	transposase	NA	NA	NA	NA
AUJ28291.1\|1600571_1601798_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
AUJ28292.1\|1604109_1605135_-	hypothetical protein	NA	NA	NA	NA
AUJ28293.1\|1605749_1606391_-	hypothetical protein	NA	NA	NA	NA
AUJ28294.1\|1606492_1607350_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1725629 : 1845284

115

Bacillus_phage(15.38%)

transposase,integrase,protease

attL 1784691:1784719|attR 1820939:1820967

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ28390.1\|1725629_1726865_+\|protease	serine protease	NA	NA	NA	NA
AUJ28391.1\|1726901_1727639_-	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-32	40.7
AUJ28392.1\|1727631_1729116_-	ABC transporter permease	NA	NA	NA	NA
AUJ28393.1\|1729239_1730064_-	hypothetical protein	NA	NA	NA	NA
AUJ28394.1\|1730076_1730760_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUJ28395.1\|1730910_1731897_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	1.2e-32	34.1
AUJ28396.1\|1731998_1732430_-	hypothetical protein	NA	NA	NA	NA
AUJ28397.1\|1732432_1733071_-	NAD-dependent dehydratase	NA	NA	NA	NA
AUJ28398.1\|1733089_1733746_-	oxidoreductase	NA	NA	NA	NA
AUJ28399.1\|1733757_1734573_-	glycosyl transferase	NA	NA	NA	NA
AUJ28400.1\|1734734_1735679_+	hypothetical protein	NA	NA	NA	NA
AUJ28401.1\|1735725_1736484_-	ribonuclease	C1KFJ1	Lactobacillus_virus	1.1e-28	33.1
AUJ28402.1\|1736571_1737498_+	alpha/beta hydrolase	NA	NA	NA	NA
AUJ28403.1\|1737517_1738975_+	cardiolipin synthase	NA	NA	NA	NA
AUJ28404.1\|1738969_1739449_-	hypothetical protein	NA	NA	NA	NA
AUJ28405.1\|1739540_1740245_+	NAD-dependent protein deacylase	NA	NA	NA	NA
AUJ28406.1\|1740296_1740815_+	cysteine methyltransferase	A0A1S5V092	Saudi_moumouvirus	2.3e-14	42.2
AUJ28407.1\|1740801_1741590_+	hypothetical protein	A0A068EP98	Bacillus_phage	1.0e-37	40.8
AUJ28408.1\|1741626_1741989_-	hypothetical protein	NA	NA	NA	NA
AUJ28409.1\|1742058_1742691_+	3-methyladenine DNA glycosylase	NA	NA	NA	NA
AUJ28410.1\|1743018_1744632_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ28411.1\|1744631_1745387_+	ABC transporter	G9BWD6	Planktothrix_phage	1.4e-28	37.2
AUJ28412.1\|1745439_1746357_-	restriction endonuclease	NA	NA	NA	NA
AUJ28413.1\|1746357_1747005_-	hydrolase	NA	NA	NA	NA
AUJ28414.1\|1747226_1748084_+\|transposase	transposase	NA	NA	NA	NA
AUJ28415.1\|1748142_1748376_+	hypothetical protein	NA	NA	NA	NA
AUJ28416.1\|1748350_1748677_+	hypothetical protein	NA	NA	NA	NA
AUJ28417.1\|1748673_1749156_-	hypothetical protein	NA	NA	NA	NA
AUJ28418.1\|1749152_1749485_-	hypothetical protein	NA	NA	NA	NA
AUJ28419.1\|1750861_1751722_-	hypothetical protein	NA	NA	NA	NA
AUJ28420.1\|1752047_1752317_-	hypothetical protein	NA	NA	NA	NA
AUJ28421.1\|1752300_1752705_-	hypothetical protein	NA	NA	NA	NA
AUJ28422.1\|1752907_1754014_+	cation transporter	NA	NA	NA	NA
AUJ28423.1\|1754080_1754641_+	hypothetical protein	A0A1X9IGG1	Lactococcus_phage	1.2e-13	33.7
AUJ28424.1\|1754655_1755552_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
AUJ28425.1\|1756725_1757139_+	hypothetical protein	A0A0C5AEA5	Paenibacillus_phage	5.6e-16	49.4
AUJ28426.1\|1757220_1758162_-	hypothetical protein	NA	NA	NA	NA
AUJ28427.1\|1758320_1759670_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-12	28.1
AUJ28428.1\|1759673_1760327_+	ABC transporter permease	NA	NA	NA	NA
AUJ28429.1\|1760335_1761220_+	proline iminopeptidase	NA	NA	NA	NA
AUJ28709.1\|1762759_1763239_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AUJ28430.1\|1763704_1764946_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-17	29.4
AUJ28431.1\|1765032_1765830_-	MBL fold hydrolase	A0A2I7SDH3	Paenibacillus_phage	2.0e-30	34.6
AUJ28432.1\|1765845_1766670_-	hypothetical protein	NA	NA	NA	NA
AUJ28433.1\|1766672_1768022_-	hypothetical protein	NA	NA	NA	NA
AUJ28710.1\|1768011_1769868_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	3.9e-32	33.5
AUJ28434.1\|1769934_1770651_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	6.7e-41	38.8
AUJ28435.1\|1770978_1771200_+	hypothetical protein	NA	NA	NA	NA
AUJ28436.1\|1771732_1772635_-	hypothetical protein	NA	NA	NA	NA
AUJ28437.1\|1773463_1774870_+\|transposase	transposase	NA	NA	NA	NA
AUJ28438.1\|1775143_1776265_-	s-layer protein	NA	NA	NA	NA
AUJ28439.1\|1776393_1777152_+	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
AUJ28440.1\|1777201_1777591_-	hypothetical protein	NA	NA	NA	NA
AUJ28441.1\|1778923_1779760_+	glycosyl transferase	NA	NA	NA	NA
AUJ28442.1\|1779778_1780735_+	glucosyltransferase	NA	NA	NA	NA
AUJ28443.1\|1781698_1782568_+	phospho-beta-glycosidase	NA	NA	NA	NA
AUJ28444.1\|1782656_1782875_+	steroid-binding protein	NA	NA	NA	NA
AUJ28445.1\|1783026_1783635_+	transcriptional regulator	NA	NA	NA	NA
AUJ28446.1\|1783872_1784220_+\|transposase	transposase	NA	NA	NA	NA
AUJ28711.1\|1784259_1784490_+\|transposase	transposase	NA	NA	NA	NA
AUJ28447.1\|1784464_1785802_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
1784691:1784719	attL	NA	NA	NA	NA
AUJ28448.1\|1786920_1787958_-\|integrase	integrase	H7BWC8	unidentified_phage	1.8e-50	36.2
AUJ28449.1\|1788314_1789232_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AUJ28450.1\|1789263_1789911_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-15	29.3
AUJ28451.1\|1789910_1790705_+	ABC transporter	NA	NA	NA	NA
AUJ28452.1\|1791139_1792522_+	sodium:dicarboxylate symporter	NA	NA	NA	NA
AUJ28453.1\|1792972_1793155_-	hypothetical protein	NA	NA	NA	NA
AUJ28712.1\|1793285_1794464_+\|transposase	transposase	NA	NA	NA	NA
AUJ28454.1\|1796008_1796281_+	enterocin immunity protein	NA	NA	NA	NA
AUJ28455.1\|1797178_1798975_-	oligoendopeptidase F	NA	NA	NA	NA
AUJ28456.1\|1799136_1800378_+	LytR family transcriptional regulator	NA	NA	NA	NA
AUJ28457.1\|1800446_1800671_+	hypothetical protein	NA	NA	NA	NA
AUJ28458.1\|1800764_1801955_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.4e-122	57.2
AUJ28459.1\|1802552_1803107_-	ribosomal-protein-serine acetyltransferase	NA	NA	NA	NA
AUJ28460.1\|1803240_1803618_+	hypothetical protein	NA	NA	NA	NA
AUJ28461.1\|1803626_1805168_+	multidrug ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	3.7e-44	28.0
AUJ28462.1\|1805178_1805949_+	hypothetical protein	NA	NA	NA	NA
AUJ28463.1\|1805951_1806437_+	hypothetical protein	NA	NA	NA	NA
AUJ28464.1\|1806640_1807357_-	hypothetical protein	NA	NA	NA	NA
AUJ28465.1\|1808986_1809523_+	hypothetical protein	NA	NA	NA	NA
AUJ28713.1\|1809767_1810946_+\|transposase	transposase	NA	NA	NA	NA
AUJ28466.1\|1811012_1811357_+	hypothetical protein	NA	NA	NA	NA
AUJ28467.1\|1811667_1812852_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	8.9e-123	58.3
AUJ28468.1\|1813097_1813739_+	hypothetical protein	NA	NA	NA	NA
AUJ28469.1\|1813753_1815259_-	hypothetical protein	NA	NA	NA	NA
AUJ28470.1\|1815351_1815651_-	DUF2187 domain-containing protein	NA	NA	NA	NA
AUJ28471.1\|1815745_1816291_+	guanylate kinase	A0A218KC48	Bacillus_phage	9.4e-11	31.7
AUJ28472.1\|1816480_1817032_+	glycosidase	A0A1V0DZX6	Clostridioides_phage	6.6e-20	46.0
AUJ28473.1\|1817124_1817397_+	ATPase	NA	NA	NA	NA
AUJ28714.1\|1817438_1817822_+	ATPase	NA	NA	NA	NA
AUJ28474.1\|1817994_1818720_+	hydrolase	A0A1V0DZX6	Clostridioides_phage	5.6e-19	47.2
AUJ28475.1\|1818873_1819806_+	hydrolase	M9MUG9	Rhodococcus_phage	9.1e-14	38.5
AUJ28476.1\|1820285_1820744_+	hypothetical protein	NA	NA	NA	NA
AUJ28477.1\|1821293_1822559_-	GTPase HflX	NA	NA	NA	NA
1820939:1820967	attR	NA	NA	NA	NA
AUJ28478.1\|1823034_1824096_+	transcriptional regulator	A0A1X9I5X1	Streptococcus_phage	1.1e-15	31.1
AUJ28479.1\|1824107_1824995_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUJ28480.1\|1825005_1825794_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUJ28481.1\|1825793_1826564_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUJ28482.1\|1826682_1827333_+	multidrug MFS transporter	NA	NA	NA	NA
AUJ28483.1\|1827347_1827797_+	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
AUJ28484.1\|1827809_1828304_+	glycosyltransferase	NA	NA	NA	NA
AUJ28485.1\|1828303_1829272_+	hypothetical protein	NA	NA	NA	NA
AUJ28486.1\|1829342_1830458_+	hypothetical protein	NA	NA	NA	NA
AUJ28487.1\|1830450_1831437_+	hypothetical protein	NA	NA	NA	NA
AUJ28488.1\|1831461_1831926_+	hypothetical protein	NA	NA	NA	NA
AUJ28489.1\|1832012_1832633_+	hypothetical protein	NA	NA	NA	NA
AUJ28490.1\|1832644_1833766_+	hypothetical protein	NA	NA	NA	NA
AUJ28715.1\|1833831_1834854_+	hypothetical protein	NA	NA	NA	NA
AUJ28491.1\|1834897_1835755_-\|transposase	transposase	NA	NA	NA	NA
AUJ28492.1\|1835896_1837006_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	2.7e-158	71.9
AUJ28493.1\|1837011_1838439_+	flippase	NA	NA	NA	NA
AUJ28494.1\|1838440_1839454_+	acetyltransferase	NA	NA	NA	NA
AUJ28495.1\|1839646_1840042_+	hypothetical protein	NA	NA	NA	NA
AUJ28716.1\|1840156_1841335_+\|transposase	transposase	NA	NA	NA	NA
AUJ28496.1\|1843583_1845284_-\|transposase	transposase	A0ZS58	Staphylococcus_virus	4.6e-88	37.3

DBSCAN-SWA_15

1853380 : 1916831

Streptococcus_phage(27.27%)

transposase,integrase

attL 1857803:1857819|attR 1911075:1911091

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUJ28502.1\|1853380_1853569_+\|transposase	transposase	NA	NA	NA	NA
AUJ28503.1\|1853555_1853789_+	hypothetical protein	NA	NA	NA	NA
AUJ28504.1\|1853877_1854096_-	ubiquitin	NA	NA	NA	NA
AUJ28505.1\|1854106_1854664_-	hypothetical protein	NA	NA	NA	NA
AUJ28506.1\|1854843_1855893_-\|integrase	integrase	H7BWC8	unidentified_phage	4.7e-51	35.9
AUJ28719.1\|1856340_1857519_-\|transposase	transposase	NA	NA	NA	NA
1857803:1857819	attL	NA	NA	NA	NA
AUJ28507.1\|1858224_1859796_-	ABC transporter ATP-binding protein/permease	A0A076FI99	Aureococcus_anophage	4.5e-13	23.6
AUJ28508.1\|1859802_1861389_-	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	5.4e-14	21.8
AUJ28509.1\|1861399_1862242_-	hypothetical protein	NA	NA	NA	NA
AUJ28510.1\|1862274_1863309_-	adenylyltransferase	A0A1V0SCZ9	Indivirus	2.1e-06	37.8
AUJ28511.1\|1863391_1864570_+\|transposase	transposase	NA	NA	NA	NA
AUJ28512.1\|1864683_1865700_-	hypothetical protein	NA	NA	NA	NA
AUJ28513.1\|1865701_1866334_-	hypothetical protein	NA	NA	NA	NA
AUJ28514.1\|1867021_1868359_-\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUJ28720.1\|1868333_1868564_-\|transposase	transposase	NA	NA	NA	NA
AUJ28515.1\|1868603_1868951_-\|transposase	transposase	NA	NA	NA	NA
AUJ28516.1\|1871215_1871494_-	RelB	NA	NA	NA	NA
AUJ28517.1\|1871597_1872206_+\|integrase	integrase	D2XR58	Bacillus_phage	1.2e-17	31.2
AUJ28518.1\|1872156_1872489_+	hypothetical protein	NA	NA	NA	NA
AUJ28519.1\|1872539_1872995_-	hypothetical protein	NA	NA	NA	NA
AUJ28520.1\|1874310_1875717_+\|transposase	transposase	NA	NA	NA	NA
AUJ28521.1\|1876222_1876696_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
AUJ28522.1\|1876849_1879135_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
AUJ28523.1\|1879352_1880018_+	5,10-methylenetetrahydrofolate reductase	NA	NA	NA	NA
AUJ28524.1\|1880445_1881042_-\|transposase	transposase	NA	NA	NA	NA
AUJ28525.1\|1881257_1882334_+	guanine permease	NA	NA	NA	NA
AUJ28526.1\|1882336_1882894_+	adenine phosphoribosyltransferase	NA	NA	NA	NA
AUJ28527.1\|1883086_1884346_+\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	5.4e-09	20.4
AUJ28528.1\|1884586_1885813_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
AUJ28529.1\|1886696_1887239_-	biotin biosynthesis protein BioY	NA	NA	NA	NA
AUJ28530.1\|1887312_1888302_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AUJ28531.1\|1888349_1889108_-	enoyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AUJ28532.1\|1889166_1889937_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
AUJ28533.1\|1889929_1890772_-	acetyl-CoA carboxylase subunit beta	NA	NA	NA	NA
AUJ28534.1\|1890752_1892132_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AUJ28535.1\|1892145_1892562_-	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AUJ28536.1\|1892566_1893037_-	acetyl-CoA carboxylase, biotin carboxyl carrier protein	NA	NA	NA	NA
AUJ28537.1\|1893040_1894270_-	beta-ketoacyl-[acyl-carrier-protein] synthase II	NA	NA	NA	NA
AUJ28538.1\|1894291_1895023_-	beta-ketoacyl-ACP reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-13	30.0
AUJ28539.1\|1895022_1895940_-	ACP S-malonyltransferase	NA	NA	NA	NA
AUJ28540.1\|1895949_1896192_-	acyl carrier protein	NA	NA	NA	NA
AUJ28541.1\|1896250_1897234_-	3-oxoacyl-ACP synthase	NA	NA	NA	NA
AUJ28542.1\|1897230_1897698_-	MarR family transcriptional regulator	NA	NA	NA	NA
AUJ28543.1\|1897727_1898174_-	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
AUJ28544.1\|1899876_1900125_-	hypothetical protein	NA	NA	NA	NA
AUJ28545.1\|1902104_1902491_+\|transposase	transposase	NA	NA	NA	NA
AUJ28546.1\|1902730_1903618_+	sugar transporter	NA	NA	NA	NA
AUJ28547.1\|1905899_1908167_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-60	30.1
AUJ28548.1\|1908631_1909150_-	acetyltransferase	NA	NA	NA	NA
AUJ28549.1\|1909493_1910720_-\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	2.0e-37	29.0
AUJ28550.1\|1910777_1911101_-	hypothetical protein	NA	NA	NA	NA
1911075:1911091	attR	NA	NA	NA	NA
AUJ28551.1\|1911357_1912107_-	hypothetical protein	NA	NA	NA	NA
AUJ28552.1\|1912535_1913582_-	fucose-binding lectin II	NA	NA	NA	NA
AUJ28553.1\|1915436_1916831_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP015444

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection