CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP015498	Lactobacillus helveticus strain FAM22155 chromosome, complete genome	3 crisprs	cas14j,cas3,csa3,cas2,cas14k,DEDDh,DinG,WYL,Cas14u_CAS-V,RT	1	2	17	1
CP015499	Lactobacillus helveticus strain FAM22155 plasmid pFAM22155, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP015498_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015498_1

746541-746631

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
GTATTCTCCACGTATGTGGAGGTGATCCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP015498_1

>merge|CP015498|1|746541-746631|CRISPRCasFinder
GTATTCTCCACGTATGTGGAGGTGATCCTAAGATAACTCAGGTTACAATGAGAGTAATTAAGTATTCTCCACGTATGTGGAGGTGATCCTA

>CP015498|1|1|746541-746631|CRISPRCasFinder
GTATTCTCCACGTATGTGGAGGTGATCCTA	AGATAACTCAGGTTACAATGAGAGTAATTAA
GTATTCTCCACGTATGTGGAGGTGATCCTA

Protein	Signature genes	Signature genes Name	Protein_function
CP015498.1\|AUI75952.1\|754027_754240_+\|transposase	unknown	unknown	gnl\|CDD\|377551
CP015498.1\|AUI75934.1\|729590_729998_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376823
CP015498.1\|AUI75949.1\|750915_751212_+\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75943.1\|744801_745209_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75953.1\|754312_754660_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367400
CP015498.1\|AUI75951.1\|752546_753776_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
CP015498.1\|AUI75944.1\|747685_747928_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75937.1\|734248_734755_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75945.1\|747949_748339_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75938.1\|734935_736387_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379084
CP015498.1\|AUI75935.1\|730017_730722_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|381297
CP015498.1\|AUI75947.1\|748821_749706_-\|L-serine-dehydratase,-iron-sulfur-dependent-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
CP015498.1\|AUI75950.1\|751352_752402_-\|integrase	unknown	unknown	gnl\|CDD\|225382
CP015498.1\|AUI75942.1\|741133_741343_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI75939.1\|737865_739044_-\|transposase	unknown	unknown	gnl\|CDD\|307151
CP015498.1\|AUI75941.1\|739916_741095_+\|transposase	unknown	unknown	gnl\|CDD\|307151
CP015498.1\|AUI75948.1\|749720_750383_-\|serine-dehydratase	unknown	unknown	gnl\|CDD\|129802
CP015498.1\|AUI75936.1\|731695_732973_+\|transposase	unknown	unknown	gnl\|CDD\|225995
CP015498.1\|AUI75946.1\|748493_748820_-\|DNA-methyltransferase	unknown	unknown	gnl\|CDD\|225062
CP015498.1\|AUI75940.1\|739266_739686_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP015498.1\|AUI75952.1\|754027_754240_+\|transposase	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	2.94019e-20
CP015498.1\|AUI75934.1\|729590_729998_+\|hypothetical-protein	gnl\|CDD\|376823	pfam02566, OsmC, OsmC-like protein. Osmotically inducible protein C (OsmC) is a stress -induced protein found in E. Coli. This family also contains a organic hydroperoxide detoxification protein that has a novel pattern of oxidative stress regulation.	8.47142e-18
CP015498.1\|AUI75953.1\|754312_754660_+\|hypothetical-protein	gnl\|CDD\|367400	pfam03217, SLAP, SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.	8.04155e-06
CP015498.1\|AUI75951.1\|752546_753776_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.09387e-47
CP015498.1\|AUI75948.1\|749720_750383_-\|serine-dehydratase	gnl\|CDD\|129802	TIGR00719, Probable_L-serine_dehydratase_beta_chain, L-serine dehydratase, iron-sulfur-dependent, beta subunit. This enzyme is also called serine deaminase. This model describes the beta chain of an iron-sulfur-dependent L-serine dehydratase, as in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of beta chains from the homologous region of single chain forms such as found in E. coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	7.68833e-43
CP015498.1\|AUI75935.1\|730017_730722_+\|oxidoreductase	gnl\|CDD\|381297	cd19071, AKR_AKR1-5-like, AKR1/2/3/4/5 family of aldo-keto reductase (AKR) and similar proteins. Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. The family includes AKR1A/B/C/D/E/G/I, AKR2A/B/C/D/E, AKR3A/B/C/D/E/G, AKR4A/B/C, AKR5A/B/C/D/E/F/G/H, and similar proteins.	3.42693e-14
CP015498.1\|AUI75938.1\|734935_736387_+\|hypothetical-protein	gnl\|CDD\|379084	pfam13240, zinc_ribbon_2, zinc-ribbon domain. This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.	9.78308e-06
CP015498.1\|AUI75950.1\|751352_752402_-\|integrase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	6.54093e-77
CP015498.1\|AUI75941.1\|739916_741095_+\|transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.377e-112
CP015498.1\|AUI75939.1\|737865_739044_-\|transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.377e-112
CP015498.1\|AUI75946.1\|748493_748820_-\|DNA-methyltransferase	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	1.69042e-34
CP015498.1\|AUI75936.1\|731695_732973_+\|transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.32433e-48
CP015498.1\|AUI75947.1\|748821_749706_-\|L-serine-dehydratase,-iron-sulfur-dependent-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	5.68583e-106

>CP015498.1|AUI75943.1|744801_745209_-|hypothetical-protein
MKGKILFISIISCFLLTGFSTTVKADETDQSQTSKINSQTGSYTQQDNTQINKSDSTQDSGNKQNQTNQNSNNTPVKNNNGWKTVNGNTYYLKNGSATKGLKKLMVTGTFLTKMTSCLKMCVKFLTPSITATLIN
>CP015498.1|AUI75942.1|741133_741343_-|hypothetical-protein
MKYLSRNQAEQWLNQHTLYGKRRKMFTNKFMNRLSKTCRLVPDKNTLFGKKYSLLELLVRYNETVKFFV
>CP015498.1|AUI75941.1|739916_741095_+|transposase
MNDFTKNMAQALFNQDKINDLLRKELQQAVNDLLEAELTAFLGYDPYARTGWNTGNSRNGAYFRKVDTQFGEIEIQVPRDRNGMFHQHTLPDYKQHSDVLESMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHQRKLSDKFFCVYLDATYIPLRRITFDREAVYIAIGIKPNGHKEVIDYRIAPSENVENWTEMLQDMKSRGLEQVELFLSDGVVGMKTALEQTYPKAHFQRCLVHVMRNICAKVRVDDRETIMNEFKQIHQQPNKEAAIKVLHAFYDKWNRAYNHVIRNLKEIEPDLLVFYDYPKQIRASIYSTNMIESFNNVIKRKAKPKAEFPTEQSLDTFIGIQAMSYNERYFNRIHKGFGQVQDTLESYFD
>CP015498.1|AUI75940.1|739266_739686_-|hypothetical-protein
MWIILIINTIITISAIIVSFKNRSEVFSLFNAGIIFIIWSIIFLLGAISIYRNFDTSSLMMFIAGILLILGIIMLMFSFINKKVKKIRLQDIAITMMVASVALVGLMQGLNLNFLNLIVPEVSLIIGLICFVVNTINNR
>CP015498.1|AUI75939.1|737865_739044_-|transposase
MNDFTKNMAQALFNQDKINDLLRKELQQAVNDLLEAELTAFLGYDPYARTGWNTGNSRNGAYFRKVDTQFGEIEIQVPRDRNGMFHQHTLPDYKQHSDVLESMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHQRKLSDKFFCVYLDATYIPLRRITFDREAVYIAIGIKPNGHKEVIDYRIAPSENVENWTEMLQDMKSRGLEQVELFLSDGVVGMKTALEQTYPKAHFQRCLVHVMRNICAKVRVDDRETIMNEFKQIHQQPNKEAAIKVLHAFYDKWNRAYNHVIRNLKEIEPDLLVFYDYPKQIRASIYSTNMIESFNNVIKRKAKPKAEFPTEQSLDTFIGIQAMSYNERYFNRIHKGFGQVQDTLESYFD
>CP015498.1|AUI75938.1|734935_736387_+|hypothetical-protein
MKKICPNCGKEVDPEEKYCPFCHFNLVNNDETMVTVNIGLLGLKNNESTKKDEEKIQSEKKESDAKPEKKKQPEKAVSKSNEDKKQKIEKNEIIPSPLPPKKKPTPLPKSKKKKFHFKWSILIEIVVAVIAILVMVGTNYYSCKAQIGRIETGLKNGEVNNVVTNGKVPLTAKNLTPLKEYYKNNPAAYKKLKKSLMGKNNLPIKLIKQGHYFLFFPRYVVQLPTYELNVVNDYHHSTVTVNGMKFVKKQKVFPGAYNIEAKSSYLGQTAKFKKTVNVWKDQTAEVNLNAKTIKVQGMPNGKLYLNNHNIGKLDKKGNLVLEDVPLTKPFSMYVAKKQKGKLVKTKQVRDVPAVIKGSKNVAVLKLDWQQSKNVGKLLEDNFNYPNSKDFVGGSKNKSYVELRTLVSNWRNSPNLTKYHANITVNNKSLNDIRYSVEFNFAFNKNGKRYKRVQVMKFRSASARSTSKGLKIKTIGGGRIVSSK
>CP015498.1|AUI75937.1|734248_734755_-|hypothetical-protein
MKNYTIDHDIYLMNHKNGDVLKVTVNKEDSVKILQLYRQDGLGNYYLDKNSRLKKQDNLTTKEDIVKASKKIGGHNTHHIDKWHHQVVPIYNAQHQITGFKPKLALEHHTRIQNAKRYLRHLDHHHAIYLSTTSRNTLLKPINHLKDAIYADRNKEMVLAHKIHKLSR
>CP015498.1|AUI75936.1|731695_732973_+|transposase
MSSFNKSIKFDLDIKEKNIVFKDYFYKMVQMKKHKIYEAELIQPACPYCGSLAFLHNGHLITNIRYLTANASLPVIIRLAKQRVKCRDCDHWSMAQSELVNKYCSISNASKLKVLSALTEDRSMTSIARENNVSINTVQRVLGNCSHRFIDSYEYLPAHLAFDEFKGVDRQLHFICLDGDSHQVVQILRTRYKKTLLKYFGRFSPQARANVKTVTMDLNFYYQDIVRACFPNAQIVIDRFHMIQMLTRSFNSLRVQVMKTFDKRSRQYQLLKSPWKLYLKKYDELEKIHPRYNWHYKDCLTQAQVVTEGINTSTTLENSYNLMQSFIQAVETGNTHELKSLINCQDQIGTLMHKTLLTFKHNLTAVLNGAALPYSNGCLEGFNRKIKQIERTAFGYSNFTNLLTRIRLEEDLYKEKEPNSLLMTA
>CP015498.1|AUI75935.1|730017_730722_+|oxidoreductase
MALLDEAVVLNDGSLMPKTGIIVKNDDDVTKATKLGYRLLDCAVDDNLKIKDVNPQLYVEVRISKLAKGKELHDNLKSIRANLIADQPDLCLLNLSDDNERNNQIWQKLEQLKITGWVKTLGIETDEADALEALLKNIKFKPNVLRLKCEDTDLLTIAKNNKLQVEIPVKGDIAALAEIADKYHTFPMELVLCYFNQKGIIPLVEASEMIENPQVNFNIKSADMATISQLFVKD
>CP015498.1|AUI75934.1|729590_729998_+|hypothetical-protein
MGDYLVKTKLENTEWQIANQARDHVFICDADKRSKEDAGPNPVEYLCGSINSCITMSAGMITKVHRLDVKNFHVENYAKTENLGHGKSVVTGMKIKVSFDSSMNREEKEKFIAHALHVSTVYQTLKEAIKIYVEF
>CP015498.1|AUI75944.1|747685_747928_-|hypothetical-protein
MTNHNSIKSMWYIILLIIGFIDPILGIIPIFYLKYKSEKDTDLYVIKNWIKFGEILQLLYIVLLILIMILFTPMYYSVHP
>CP015498.1|AUI75945.1|747949_748339_-|hypothetical-protein
MKKFTKIISLISVGFALVGVALLNTSQSSKASYIGKSSTCTWKSAANITTGWFTIHGRGYSYPNSGKVTSAWITSGSALFNSIINKSHWTYKTPRGVHLMGKATDRAALGTQWIYIPLGSDTQAIGVQF
>CP015498.1|AUI75946.1|748493_748820_-|DNA-methyltransferase
MRDGETIKNDIINQLATVIDPELNVDVVNLGLIYEIDLDKDEICLINMTLTTPACPLTGYLIDSITQAVKKVPEVKNVDVEFVWYPVWTPNRMSDVAKKYFNIDEKQD
>CP015498.1|AUI75947.1|748821_749706_-|L-serine-dehydratase,-iron-sulfur-dependent-subunit-alpha
MYNHIKEIVADSEKQQKPISELIIEQECKLSGLPRQKVWNRMKHNLATMRAAVERGKSGAGIFSKTGLTGGEAVKIKKYRQTHHTLSGDTIIAAVQNAVATNEVNASMGVICATPTAGSSGTLPGVLFLLEKRMDLSEEQMIRSLFTAGGFGLVIANNAEIAGATGGCQAEVGSASAMGAAAAVEAAGGSAEQSAQAMSIAMSNLLGLVCDPIAGLVEVPCVKRNAIGAGNALISADIALAGCTSVIPADECIDAMKKVGHQMPASLRETGIGGLAGTPTGQAIKAKIFGKDAG
>CP015498.1|AUI75948.1|749720_750383_-|serine-dehydratase
MTNRYKSVFDIIGPVMVGPSSSHTAGAVAIGRAGNKLFGGVPRKLTVHYYGSFAQTHRGHGTDYAIAAGILGFDTDDLRVPNAPEIAKKRGIDIRFVEEDGPSPIDHPNTAILDMSSGTKKAQISGCSIGGGSIEIRHLVIHDTEITPTGSLPIIIWLDYEKEILNEQNLTSLLQEKAPFSKKRIFHTKDCNIYEYDVENYLKPALVKELKEKFENIICL
>CP015498.1|AUI75949.1|750915_751212_+|hypothetical-protein
MTDKEILQKIEQKVKDSENWSVYHHLTDNLGSPAIMLREANTNADRLGVNIDVFKGYAYLFLDNGTPAEPGKPFSVQTLSSLNALTELLDIVKPYIKR
>CP015498.1|AUI75950.1|751352_752402_-|integrase
MDSLYSTMNQHIKGKHLSFEERVIIQLRLKDGYSLRAIARELNCSPSTISYEVKRGTVELYHGKVKRYKATQGHDAYQAHRKNCGRKSDFLRKTQFMRYVHKHFFKDGWSLDVCSNHATAVGTFSSRDVVCTKTLYKYVDQGLLDIHNYDLPEKLKRNTKLHRIRKNKKKLGRNIEERPKEINKRNEFGHWECDLVLGHKSKDDEVLLTLSERMSREFLILRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADFSNLEKASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQDIINIETWCNSLPRKILAYHTPDEIFERELDLIYQAA
>CP015498.1|AUI75951.1|752546_753776_+|MFS-transporter
MTHKKSFFPWWIFIVCCFISMIGFGLLVNTIGLFFGPISQEFNVGRANVALMMTFQNAAAAIALLFAGKIMEKVNLRWLLTACFALIAVSMLSLTFANSLVHFYLAWTIIGICQPIAITLSIPVLLSKWFNQKLGTVMGISLAFSALGGTIFNPIIAEVIKQFGWRGGFVREAMLIGLILVPLAISINPEPTTQYPAYGKAMRSSKKVALTGLSLKQALKMPVFYAVAFAMLALQFVSGSIYHISGHITNIGISPITAATVVSGVMIGSAIGKISIGYFLDKFNAKLVLAVYSLFGVIGWGGQAMLRESNLLILAAVILGSGQAVCVVALPYLIRQIFGEKDYSNILSVINMIGAFAMSASVYLIGLFFDQTGSYNLGWMINVSAVALSFIVIMITLGKKESANSDFRK
>CP015498.1|AUI75952.1|754027_754240_+|transposase
MINLYDLGQVYIVCGRTDMRRGIDGLAAIVKDEFDLDPFSGRVFIFCGGKATVTRNQKIKYAGKLTETSR
>CP015498.1|AUI75953.1|754312_754660_+|hypothetical-protein
MFLKTNTYVYNKKCQRIKKQGTLRQGTLVTYSGSVKAASSSDDFFFYPSESSNKDPQALKQYKIKGKVYYALGGGRYVKAVNVSKINGQYVFTKQPTYVIPRADMYVLNKDLKET

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP015498_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015498_2

866027-866147

Orphan

Consensus_repeat	Method
AGAATCAGGCAGTCATTAAAAGGCTGTTTGGTTCTTTTTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP015498_2

>merge|CP015498|2|866027-866147|CRISPRCasFinder
AGAATCAGGCAGTCATTAAAAGGCTGTTTGGTTCTTTTTCTGGCTCTTTGTCAAATCCTGTTGATAGAGAGTAAATGAATAGAATCAAGCAGTCATTAAAAGGCTGTTTGGTTCTTTTTCT

>CP015498|2|2|866027-866147|CRISPRCasFinder
AGAATCAGGCAGTCATTAAAAGGCTGTTTGGTTCTTTTTCT	GGCTCTTTGTCAAATCCTGTTGATAGAGAGTAAATGAAT
AGAATCAAGCAGTCATTAAAAGGCTGTTTGGTTCTTTTTCT

Protein	Signature genes	Signature genes Name	Protein_function
CP015498.1\|AUI76058.1\|875473_876031_+\|ribosome-recycling-factor	unknown	unknown	gnl\|CDD\|178850
CP015498.1\|AUI76056.1\|873584_874610_+\|translation-elongation-factor-Ts	unknown	unknown	gnl\|CDD\|236491
CP015498.1\|AUI76052.1\|869663_870845_-\|cyclopropane-fatty-acyl-phospholipid-synthase	unknown	unknown	gnl\|CDD\|225139
CP015498.1\|AUI76053.1\|870904_871519_-\|acyl-phosphate-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|223282
CP015498.1\|AUI76043.1\|861089_861605_+\|ribosome-maturation-factor-RimM	unknown	unknown	gnl\|CDD\|234650
CP015498.1\|AUI76057.1\|874748_875474_+\|UMP-kinase	unknown	unknown	gnl\|CDD\|234735
CP015498.1\|AUI76055.1\|872777_873551_+\|30S-ribosomal-protein-S2	unknown	unknown	gnl\|CDD\|235396
CP015498.1\|AUI77131.1\|865420_865669_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368690
CP015498.1\|AUI76044.1\|861594_862314_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	unknown	unknown	gnl\|CDD\|234581
CP015498.1\|AUI76054.1\|871584_872616_+\|methyltransferase	unknown	unknown	gnl\|CDD\|226608
CP015498.1\|AUI76046.1\|863162_863822_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381680
CP015498.1\|AUI76059.1\|876033_876768_+\|isoprenyl-transferase	unknown	unknown	gnl\|CDD\|184840
CP015498.1\|AUI76047.1\|863814_864600_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|238141
CP015498.1\|AUI76041.1\|859226_860657_+\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
CP015498.1\|AUI76045.1\|862426_862774_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP015498.1\|AUI76051.1\|867662_869606_+\|peptidase-M13	unknown	unknown	gnl\|CDD\|341056
CP015498.1\|AUI76049.1\|865731_865950_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367606
CP015498.1\|AUI76048.1\|864628_865255_-\|repressor-LexA	unknown	unknown	gnl\|CDD\|234688
CP015498.1\|AUI76060.1\|876769_877585_+\|CDP-diglyceride-synthetase	unknown	unknown	gnl\|CDD\|366491
CP015498.1\|AUI76042.1\|860748_861021_+\|30S-ribosomal-protein-S16	unknown	unknown	gnl\|CDD\|234588

Protein	Function_ID	Function_description	E-value
CP015498.1\|AUI76058.1\|875473_876031_+\|ribosome-recycling-factor	gnl\|CDD\|178850	PRK00083, frr, ribosome recycling factor; Reviewed.	8.30543e-96
CP015498.1\|AUI76056.1\|873584_874610_+\|translation-elongation-factor-Ts	gnl\|CDD\|236491	PRK09377, tsf, elongation factor Ts; Provisional.	1.63886e-136
CP015498.1\|AUI76052.1\|869663_870845_-\|cyclopropane-fatty-acyl-phospholipid-synthase	gnl\|CDD\|225139	COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].	2.09573e-122
CP015498.1\|AUI76053.1\|870904_871519_-\|acyl-phosphate-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|223282	COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism].	5.07762e-31
CP015498.1\|AUI76043.1\|861089_861605_+\|ribosome-maturation-factor-RimM	gnl\|CDD\|234650	PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional.	1.89151e-62
CP015498.1\|AUI76057.1\|874748_875474_+\|UMP-kinase	gnl\|CDD\|234735	PRK00358, pyrH, uridylate kinase; Provisional.	3.97656e-142
CP015498.1\|AUI76055.1\|872777_873551_+\|30S-ribosomal-protein-S2	gnl\|CDD\|235396	PRK05299, rpsB, 30S ribosomal protein S2; Provisional.	1.44121e-173
CP015498.1\|AUI77131.1\|865420_865669_+\|hypothetical-protein	gnl\|CDD\|368690	pfam05979, DUF896, Bacterial protein of unknown function (DUF896). In B. subtilis, one small SOS response operon under the control of LexA, the yneA operon, is comprised of three genes: yneA, yneB, and ynzC. This family consists of several short, hypothetical bacterial proteins of unknown function. These proteins are mainly found in gram-positive firmicutes. Structures show that the N-terminus is composed of two alpha helices forming a helix-loop-helix motif. The structure of ynzC from B. subtilis forms a trimeric complex. Structural modelling suggests this domain may bind nucleic acids. This family is also known as UPF0291.	7.02205e-19
CP015498.1\|AUI76044.1\|861594_862314_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	gnl\|CDD\|234581	PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; Reviewed.	8.15189e-156
CP015498.1\|AUI76054.1\|871584_872616_+\|methyltransferase	gnl\|CDD\|226608	COG4123, COG4123, Predicted O-methyltransferase [General function prediction only].	4.49185e-60
CP015498.1\|AUI76046.1\|863162_863822_+\|uracil-DNA-glycosylase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	5.12429e-58
CP015498.1\|AUI76059.1\|876033_876768_+\|isoprenyl-transferase	gnl\|CDD\|184840	PRK14830, PRK14830, undecaprenyl pyrophosphate synthase; Provisional.	2.9808e-158
CP015498.1\|AUI76047.1\|863814_864600_+\|acyl-CoA-thioesterase	gnl\|CDD\|238141	cd00229, SGNH_hydrolase, SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	9.4609e-14
CP015498.1\|AUI76041.1\|859226_860657_+\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
CP015498.1\|AUI76045.1\|862426_862774_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	8.62762e-64
CP015498.1\|AUI76051.1\|867662_869606_+\|peptidase-M13	gnl\|CDD\|341056	cd08662, M13, Peptidase family M13 includes neprilysin and endothelin-converting enzyme I. The M13 family of metallopeptidases includes neprilysin (neutral endopeptidase, NEP, enkephalinase, CD10, CALLA, EC 3.4.24.11), endothelin-converting enzyme I (ECE-1, EC 3.4.24.71), erythrocyte surface antigen KELL (ECE-3), phosphate-regulating gene on the X chromosome (PHEX), soluble secreted endopeptidase (SEP), and damage-induced neuronal endopeptidase (DINE)/X-converting enzyme (XCE). Proteins in this family fulfill a broad range of physiological roles due to the greater variation in the active site's S2' subsite allowing substrate specificity. NEP is expressed in a variety of tissues including kidney and brain, and is involved in many physiological and pathological processes, including blood pressure and inflammatory response. It degrades a wide array of substrates such as substance P, enkephalins, cholecystokinin, neurotensin and somatostatin. It is an important enzyme in the regulation of amyloid-beta (Abeta) protein that forms amyloid plaques that are associated with Alzeimers disease (AD). ECE-1 catalyzes the final rate-limiting step in the biosynthesis of endothelins via post-translational conversion of the biologically inactive big endothelins. Like NEP, it also hydrolyzes bradykinin, substance P, neurotensin, and Abeta. Endothelin-1 overproduction has been implicated in various diseases including stroke, asthma, hypertension, and cardiac and renal failure. Kell is a homolog of NEP and constitutes a major antigen on human erythrocytes; it preferentially cleaves big endothelin-3 to produce bioactive endothelin-3, but is also known to cleave substance P and neurokinin A. PHEX forms a complex interaction with fibroblast growth factor 23 (FGF23) and matrix extracellular phosphoglycoprotein, causing bone mineralization. A loss-of-function mutation in PHEX disrupts this interaction leading to hypophosphatemic rickets; X-linked hypophosphatemic (XLH) rickets is the most common form of metabolic rickets. ECEL1 is a brain metalloprotease which plays a critical role in the nervous regulation of the respiratory system, while DINE is abundantly expressed in the hypothalamus and its expression responds to nerve injury. A majority of these M13 proteases are prime therapeutic targets for selective inhibition.	0
CP015498.1\|AUI76049.1\|865731_865950_+\|hypothetical-protein	gnl\|CDD\|367606	pfam03672, UPF0154, Uncharacterized protein family (UPF0154). This family contains a set of short bacterial proteins of unknown function.	1.01974e-23
CP015498.1\|AUI76048.1\|864628_865255_-\|repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.80734e-106
CP015498.1\|AUI76060.1\|876769_877585_+\|CDP-diglyceride-synthetase	gnl\|CDD\|366491	pfam01148, CTP_transf_1, Cytidylyltransferase family. The members of this family are integral membrane protein cytidylyltransferases. The family includes phosphatidate cytidylyltransferase EC:2.7.7.41 as well as Sec59 from yeast. Sec59 is a dolichol kinase EC:2.7.1.108.	4.84971e-62
CP015498.1\|AUI76042.1\|860748_861021_+\|30S-ribosomal-protein-S16	gnl\|CDD\|234588	PRK00040, rpsP, 30S ribosomal protein S16; Reviewed.	3.24901e-45

>CP015498.1|AUI76049.1|865731_865950_+|hypothetical-protein
MNLGLAIFLIIIALLVGAVAGFYGARAYMKKYFKENPPISEDMIVAMMSQMGQKPSNKKVHQVMNMMKHQQK
>CP015498.1|AUI77131.1|865420_865669_+|hypothetical-protein
MSKEEEKKVTDRINELYHKKEKEGLTPEEEQERKELHKKFLANFRATFKQDVENMVIIDKNGKEVTSERAKRAQRKKGLRKD
>CP015498.1|AUI76048.1|864628_865255_-|repressor-LexA
MSKKNSDTKQLEILRYIYDTVDHRGFPPTVREICAAVKLSSTSTVHGHLARLERKGLLIKDATKPRALEITDEGKKELGIKPKRIPVIGVVAAGHPILAVQDIDEYFPLPPDLENDAGELFMLKIHGESMINAGILNGDNVIVKKQNTANNGEIVVAMTDENEATVKRFYKEKDHYRLQPENDTMAPIILPEVTILGKVVGLYRNNID
>CP015498.1|AUI76047.1|863814_864600_+|acyl-CoA-thioesterase
MSNETFLIPIRQNNDLSDIALNELRMDLDEHPLHQRAYTELAYLTGNSRKYSLNNVKTIDSPLRNKKILFLGSSVTFGFGALGESFVDYLWKKDGIAAIKDAENGTTLVDQETSYHGDSCVARFKENLKTPIDMLLLQLSTNDARTNQKLGKVSDDDHFDTQTIIGAMEYIISQAQATWHCPIMIYTNPYFENKLYEQMVKAAHQLAQKWNIEVLDLYNNPDFKDQLALYMADEIHPTRAGYLEKWLPVFEDELTKILAKK
>CP015498.1|AUI76046.1|863162_863822_+|uracil-DNA-glycosylase
MDYPKKLLEEVKERSKGMRLEGINSGSGPKHPLLMIVGEAPGRNEIVNNIPFSGDAGKELDKSLKQIGLSRDQVYITSAVRSRPFSVKKVFSKRENKEVIKRPNRKPTKKEVLAHAPFLDYEISYTDPQIIVALGNTGLERLLGPGHKISAEHGKVIDNTPILELNTAKDGYVWSKKKYTVIPEYHPAAVFYNRKLSDDIVKDWEVIKPYIDKERESNE
>CP015498.1|AUI76045.1|862426_862774_+|50S-ribosomal-protein-L19
MDPLIQELTKEQIRDDIPAFRAGDTVTVHVRVVEGTHERIQLFEGVVIKKKGTGIGATYTVRKIASGVGVERTFPVNDPRVAKVEVKRHGRVRRAKLYYLRERHGKSARIAEARR
>CP015498.1|AUI76044.1|861594_862314_+|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD
MKINVLTLFPDMFTPLQVSMLGRGLEDGKWDLNLVNFRDFTTDVHHHVDDTPYGGGAGMVLQIMPIKKALDSLPSTGKVIITAPQGKTFNEQMAQDWAKEDELTFICGHYEGFDQRVYDLADETVSIGDYVLTGGELPTMSMIDATVRLLPGILGNAASPVEESFSHGLLEYPQYTRPADFEGQKVPEVLTSGNHQKIAEWRHKEALKATYLHRPDMLEDRQLTNEEKKMLEEIKSELD
>CP015498.1|AUI76043.1|861089_861605_+|ribosome-maturation-factor-RimM
MEYFDVARILTTHGLNGEVKVNVITDFPEERFAEGMHLSLRSDTNRTLTVEKSRPFKQFWLIQFKEITDIDQAEKLRGQILVVSEEDRGELPDGVYYYKDIFDCDVIDEETGKRIGKIVDIQSPGANDIWLVREDDGKEYWIPNIADVVKKVDVAAKKVYVELMEGLRDED
>CP015498.1|AUI76042.1|860748_861021_+|30S-ribosomal-protein-S16
MSVKIRMHRAGAKRKPFYRIVVADSRMPRDGRFIEQVGYYNPVSQPKELKLDEDKIFDWLQKGAQPSDTVRSLLSGAGLMTKLHDAKYNK
>CP015498.1|AUI76041.1|859226_860657_+|signal-recognition-particle-protein
MAFENLSERIQKALKNLTGKGKVSEEDINKASREIRLALLEADVNFKVVKDFIKTIKKEALGKEVQESLNPGQQVIKIVNEELTKMMGEEAVPLNKSKHIPTIIMMVGLQGTGKTTTVGKLAYHLQKTQKARPLLIAGDIYRPAAVDQLKQIGEQLKVPVFSEDGEKDVAKIVQDGLAEADKNKNDYVLIDTAGRLEIDEPLMEELERVKKVAQPDNILLVVDAMTGQAATDVAKGFDERLDVTGVILTKLDGDTRGGAALSIRAVTGKPILFTGQGEKLSDLDIFHPDRMASRILGMGDMLSLIEKAQQDYDAKEAEKVAEKMRENTFDFNDFVDQMKQVQKMGPLDQIMKMIPGMANNPQLKNLNVDQKQIDHTIAIVYSMTEAEREDPDLLNPSRRRRIAAGSGRPVVEVNRMIKQFKQMRDMMSKMTKGNMKGLSNLPGMDSPMAKMAMRRLNKNFKKNKKKRMRKIKRFHS
>CP015498.1|AUI76051.1|867662_869606_+|peptidase-M13
MRRYLAVRGGAGDVAEPDLNAKPQDNLYLAVNSEWLSKAEIPADQTSAGVNTELDIKIEKRMMKDFADIASGKEKMPDIRDFDKAIALYKIAKNFDKRDAEKANPIQNDLQKILDLTNFDKFKDNATELFMGPYALPFVFDIDADMKNTDVNVLHFGGPSTFLPDTTTYKTPEAKKLLDILEKQSINLLEMAGIGKEEARVYVQNALAFDQKLSKVVKSTEEWSDYAAIYNPVSLTEFLAKFKSFDMADFLKTILPEKVERVIVMEPRFLDHADELINPANFDEIKGWMLVKYINSVAKYLSQDFRAAAFPFNQAISGTPELPSQIKQAYRLANGAFDEVVGIFYGKKYFGEEAKHDVEDMIHNMLKVYEQRINDNNWLSEDTKKKAIIKLRALVLKIGYPEKIEKIYDLLQIDPERSLYENEAQMATVRTKYMLDKLTQPVDRSVWLMPGNLNNACYDPQRNDLTFPAGILQAPFYDIHQSRGANYGGIGATIGHEVSHAFDNSGAKFDEHGNMNNWWTDEDFAEFNKRVGQMIDIFDGLQYGPAKINGKQVVGENIADLAGLACAVQAGKNDNVDLKDLFENYARSWMQKQRPEAIKTEVQVDVHAPQPTRVNIPVQCQDDFYTAFDVKPDDGMWLDPEDRITIW
>CP015498.1|AUI76052.1|869663_870845_-|cyclopropane-fatty-acyl-phospholipid-synthase
MLEKAFYKMMLSKSFPFPIKVTYWDGKSEVYGNGTPEIEIVFNEKIPMGDITRNASLALGEAYMDKKIEIHGSIQKLIDGVYESADSFMRSSKFRKFLPKTKHTEKQSEEDVQSHYDIGNDFYEQWLDPTLTYSCAYFTDDNKDDLEQAQIAKVHHILNKLHPQKGKTLLDIGCGWGTLMLTAAKEYGLKVTGVTLSEEQYKLVQKKIYAENLQDVAEVKLADYRKLGDQQWDYVTSVGMFEHVGSENLGEYFNDVAKYLKTDGVALIHGITRQQGGATNAWINKYIFPGGYIPGLVEIISRIEEAHLQISDVEMLRRHYQRTLEIWDKNFNNARPEIEKKMGERFCRMWDMYLQACAASFESGNIDVVQYLLTKGLSGKNLPMTRDYMLNNK
>CP015498.1|AUI76053.1|870904_871519_-|acyl-phosphate-glycerol-3-phosphate-acyltransferase
MFYKIIRPIARFIVWVLNGHLHIHHKNRLPKGSYILVAPHRTWWEPILFALGASPMEFMSMAKIELFKNPVLRFILDHVHAFPVDRKKPGPSALKIPVKGLRKGELSLIIFPSGTRHSAELKGGALLISKMSQKPMVPVVYQGPLSFKGLLKRKGLEVNFGDPITIDRKTKLTHENEKIIYQQLEDAWKKLDDELDPNFHYVAK
>CP015498.1|AUI76054.1|871584_872616_+|methyltransferase
MVELKDNERIDYMYSDDLRIIQDKTAFSFSMDTLLLAYWAKNQISDRDKVADLCAGNCAATIYMAYFNRAHYDAIEIQDEIYSQAKRSIELNRMENRIAVHKDNVLNAAKFLRKDSYDVVTVNPPYFKVPEGHEVNPDRKKAIARHELLINLEQIIEVASGLLKMKGKMFMVHRPERLGEICYYCMKHDLSVKLVQPFVSHRGDDANLIIVEAVKHTGTDGTELMDAIEVHYKNDEFKPLIQRIVRETPEDKAKHDAYGKYYFYVLLCNDGSFYGGFTNDLDHRLKMHNSGKGAKYTKSRRPVRMIYHEQFDDKRLALKREYWFKYHSRSWKEKFLREHNIDF
>CP015498.1|AUI76055.1|872777_873551_+|30S-ribosomal-protein-S2
MADVVTMKQLLEAGVHFGHQTRRWNPKMAPYIFTQRNGIYIIDLQKTIKMLDDAYNFMKTVAEDGGVFLFVGTKKQAQDSIAEEATRAGQYYVNQRWLGGTLTNWTTIQSRVKRLKQLKEMSQDGTFDVLPKKEVALLTKEMDKLERFLGGIEDMPRIPDVLFVVDPKKEKIAVHEANILGIPVVAMVDTNTDPDPIDVVIPSNDDAIRAIRLIAGAMADAIVEGKQGQDDESVEADFKKNADGSEEIVSAEENPED
>CP015498.1|AUI76056.1|873584_874610_+|translation-elongation-factor-Ts
MAQITAKLVKELRERTGAGVMDAKKALVEVDGDMDKAIQYLRDKGMAKAAKKADRVAAEGLTGVYVNGNVAAITEVNSETDFVSSNDKFVNLVKDATKTIAEGQPADMEVAKKLKMDDGSTLDQAFVNATATIGEKIVLRRFALEKKNDDQEFGAYQHNGGQIGVITVLEGADAATAKHLAMHIAAMKPKVISPEELDDQFITDQLAVMNHKIDQDNESRALVHKKPLPHLVYGSEKQLTDDVLAKAKEDIKAELKEEGKPEKIWDRIIPGKMQRFIDDNTQVDKHFAVLSQDYIMDDSKTVGEFLKEKGAKLVAFQRFEVGEGIEKKQEDFAAEVREQMK
>CP015498.1|AUI76057.1|874748_875474_+|UMP-kinase
MSQVKYKRIILKISGEALAGDKGNGINPTVIGHLAKEIKSVYDLGVEIGIVCGGGNMWRGETGAKLGMERAQADYMGMLATIMNGLALQDGLEKVGVPTRMQTSIEMRQIAEPYIRRRALRHLEKGRVVIFGGGTGNPYFSTDTTAALRAAEIGADVILMAKNGVDGVYSADPKTDPTATKFTELTQLDLISKNLKVMDRTASSLSMDTEIPLIVFNVNTPGNIKKVVMGENIGTVIRGDK
>CP015498.1|AUI76058.1|875473_876031_+|ribosome-recycling-factor
MNNETIKKAQDNMDKSIKVYQKRLASIRAGVANAALLDNVQVEYYGAPTPLTQISSITIPEPRVLLITPYDQNSLDDIEHALLASNLGLTPANDGKVIRLVIPQLTGERREEIAKEVGKYAEDAKIAVRNVRREAMDALKKEQKDGNITEDEQRNLEKQVQKITDDSTKKIDQLADEKRKEITQG
>CP015498.1|AUI76059.1|876033_876768_+|isoprenyl-transferase
MSKTDNELNHLAIIMDGNGRWAKKRHKPRFVGHREGMDNVERITLAADKLGIKVLTLYAFSTENWARPKEEVAYLMNLPVRFFDKYMPTLMENNVKVNIMGYLDELPEKTYQIVQRAMSETANNTGLILNFAFNYGSRREITTAMQELGGMIEADALKSEDITEKMISQHLMTKNFGKYQDPDLLIRTSGEQRISNFLLWQLAYSELAFSDKNWPDFDEDDLRKFVDDYKHRNRRFGKVDESDS
>CP015498.1|AUI76060.1|876769_877585_+|CDP-diglyceride-synthetase
MKQRVITAVIALILFIPIVLAGGLWMDWLTVLFAAVGISEIFLMKKQILVSFDFLLALLATLTWTVPDSFFKAFPPNITKFGVFFGIIMLFLTWTVLSKNKTTFDDVGVYILASLYIGIGFHYMAAIRAYPQNGLALLGYVFVVVWSTDIGAYMIGRKIGKHKLWPVISPNKTWEGSIGAVICALICSAIYLAILSHFNIVFGVSELTMVILAFFLSIVGQMGDLVESAYKRFYGVKDSGKILPGHGGILDRFDSMLFVLPVVAAILGIVH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP015498_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015498_3

1681342-1681521

Orphan

Consensus_repeat	Method
ATGTGGGATTTGAACCCACGC	PILER-CR

2 spacers

The CRISPR arrays of CP015498_3

>merge|CP015498|3|1681342-1681521|PILER-CR
ATGTGGGATTCGAACCCACGCATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCCATGTGGGATTTGAACCCACGATCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCAATCAGAGGAGGATGTGGGATTTGAACCCACGC

>CP015498|3|1|1681342-1681521|PILER-CR
ATGTGGGATTCGAACCCACGC	ATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCC
ATGTGGGATTTGAACCCACGA	TCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCAATCAGAGGAGG
ATGTGGGATTTGAACCCACGC

Protein	Signature genes	Signature genes Name	Protein_function
CP015498.1\|AUI76716.1\|1692779_1693958_+\|transposase	unknown	unknown	gnl\|CDD\|307151
CP015498.1\|AUI76717.1\|1694121_1694826_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|198414
CP015498.1\|AUI76710.1\|1681690_1682191_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP015498.1\|AUI76718.1\|1694869_1695562_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377696
CP015498.1\|AUI76707.1\|1674829_1676299_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
CP015498.1\|AUI76712.1\|1685816_1686017_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
CP015498.1\|AUI76714.1\|1689087_1690440_-\|23S-rRNA-(uracil-5-)-methyltransferase-RumA	unknown	unknown	gnl\|CDD\|225174
CP015498.1\|AUI76715.1\|1690804_1692181_+\|Na+/H+-antiporter-NhaC	unknown	unknown	gnl\|CDD\|188097
CP015498.1\|AUI76713.1\|1687192_1688599_+\|transposase	unknown	unknown	gnl\|CDD\|284250
CP015498.1\|AUI77156.1\|1683557_1683962_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI76702.1\|1669035_1669704_-\|GMP-synthase	unknown	unknown	gnl\|CDD\|153212
CP015498.1\|AUI76704.1\|1670664_1672287_-\|ABC-F-family-ATPase	unknown	unknown	gnl\|CDD\|237894
CP015498.1\|AUI76708.1\|1676590_1677121_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235365
CP015498.1\|AUI76709.1\|1677133_1678462_+\|uracil-permease	unknown	unknown	gnl\|CDD\|236744
CP015498.1\|AUI76705.1\|1672391_1673474_-\|peptidase-M42	unknown	unknown	gnl\|CDD\|349906
CP015498.1\|AUI76711.1\|1684192_1685599_+\|transposase	unknown	unknown	gnl\|CDD\|284250
CP015498.1\|AUI76703.1\|1669716_1670508_-\|hypothetical-protein	unknown	unknown	unknown
CP015498.1\|AUI76706.1\|1673600_1674806_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|340949
CP015498.1\|AUI76701.1\|1668174_1668993_+\|glutamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270407
CP015498.1\|AUI76700.1\|1667568_1668030_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378956

Protein	Function_ID	Function_description	E-value
CP015498.1\|AUI76716.1\|1692779_1693958_+\|transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.377e-112
CP015498.1\|AUI76717.1\|1694121_1694826_+\|hypothetical-protein	gnl\|CDD\|198414	cd10432, BI-1-like_bacterial, Bacterial BAX inhibitor (BI)-1/YccA-like proteins. This family is comprised of bacterial relatives of the mammalian members of the BAX inhibitor (BI)-1 like family of small transmembrane proteins, which have been shown to have an antiapoptotic effect either by stimulating the antiapoptotic function of Bcl-2, a well-characterized oncogene, or by inhibiting the proapoptotic effect of Bax, another member of the Bcl-2 family. In plants, BI-1 like proteins play a role in pathogen resistance. A characterized prokaryotic member, Escherichia coli YccA, has been shown to interact with ATP-dependent protease FtsH, which degrades abnormal membrane proteins as part of a quality control mechanism to keep the integrity of biological membranes.	2.56806e-49
CP015498.1\|AUI76710.1\|1681690_1682191_-\|acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.79666e-13
CP015498.1\|AUI76707.1\|1674829_1676299_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.98255e-46
CP015498.1\|AUI76712.1\|1685816_1686017_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	3.71751e-34
CP015498.1\|AUI76714.1\|1689087_1690440_-\|23S-rRNA-(uracil-5-)-methyltransferase-RumA	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	1.42181e-157
CP015498.1\|AUI76715.1\|1690804_1692181_+\|Na+/H+-antiporter-NhaC	gnl\|CDD\|188097	TIGR00931, Uncharacterized_Na+/H+_antiporter_HI_1107, Na+/H+ antiporter NhaC. A single member of the NhaC family, a protein from Bacillus firmus, has been functionally characterized.It is involved in pH homeostasis and sodium extrusion. Members of the NhaC family are found in both Gram-negative bacteria and Gram-positive bacteria. Intriguingly, archaeal homolog ArcD (just outside boundaries of family) has been identified as an arginine/ornithine antiporter. [Transport and binding proteins, Cations and iron carrying compounds].	8.95604e-108
CP015498.1\|AUI76713.1\|1687192_1688599_+\|transposase	gnl\|CDD\|284250	pfam06782, UPF0236, Uncharacterized protein family (UPF0236).	9.13692e-23
CP015498.1\|AUI76718.1\|1694869_1695562_-\|hypothetical-protein	gnl\|CDD\|377696	pfam06736, DUF1211, Protein of unknown function (DUF1211). This family represents a conserved region within a number of hypothetical proteins of unknown function found in eukaryotes, bacteria and archaea. These may possibly be integral membrane proteins.	9.37768e-15
CP015498.1\|AUI76702.1\|1669035_1669704_-\|GMP-synthase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	1.26269e-55
CP015498.1\|AUI76704.1\|1670664_1672287_-\|ABC-F-family-ATPase	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
CP015498.1\|AUI76708.1\|1676590_1677121_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase	gnl\|CDD\|235365	PRK05205, PRK05205, bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR.	7.1535e-100
CP015498.1\|AUI76709.1\|1677133_1678462_+\|uracil-permease	gnl\|CDD\|236744	PRK10720, PRK10720, uracil transporter; Provisional.	1.09337e-144
CP015498.1\|AUI76705.1\|1672391_1673474_-\|peptidase-M42	gnl\|CDD\|349906	cd05656, M42_Frv, M42 Peptidase, endoglucanases. Peptidase M42 family, Frv (Frv Operon Protein; Endo-1 4-Beta-Glucanase; Cellulase Protein; Endoglucanase; Endo-1 4-Beta-Glucanase Homolog; Glucanase; EC. 3.2.1.4) subfamily. Frv is a co-catalytic metallopeptidase, found in archaea and bacteria, including Pyrococcus horikoshii tetrahedral shaped phTET1 (DAPPh1; FrvX; PhDAP aminopeptidase; PhTET aminopeptidase; deblocking aminopeptidase), phTET2 (DAPPh2) and phTET3 (DAPPh3), Haloarcula marismortui TET (HmTET) as well as Bacillus subtilis YsdC. All of these exhibit aminopeptidase and deblocking activities. The HmTET is a broad substrate aminopeptidase capable of degrading large peptides. PhTET2, which shares 24% identity with HmTET, is a cobalt-activated peptidase and possibly a deblocking aminopeptidase, assembled as a 12-subunit tetrahedral dodecamer, while PhTET1 can be alternatively assembled as a tetrahedral dodecamer or as an octahedral tetracosameric structure. The active site in such a self-compartmentalized complex is located on the inside such that substrate sizes are limited, indicating function as possible peptide scavengers. PhTET2 cleaves polypeptides by a nonprocessive mechanism, preferring N-terminal hydrophobic or uncharged polar amino acids. Streptococcus pneumoniae PepA (SpPepA) also forms dodecamer with tetrahedral architecture, and exhibits selective substrate specificity to acidic amino acids with the preference to glutamic acid, with the substrate binding S1 pocket containing an Arg allows electrostatic interactions with the N-terminal acidic residue in the substrate. The YsdC gene is conserved in a number of thermophiles, archaea and pathogenic bacterial species; the closest structural homolog is Thermotoga maritima FrwX (34% identity), which is annotated as either a cellulase or an endoglucanase, and is possibly involved in polysaccharide biosynthesis or degradation.	2.57949e-100
CP015498.1\|AUI76711.1\|1684192_1685599_+\|transposase	gnl\|CDD\|284250	pfam06782, UPF0236, Uncharacterized protein family (UPF0236).	1.66924e-26
CP015498.1\|AUI76701.1\|1668174_1668993_+\|glutamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270407	cd13689, PBP2_BsGlnH, Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.777e-77
CP015498.1\|AUI76706.1\|1673600_1674806_+\|multidrug-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.05065e-155
CP015498.1\|AUI76700.1\|1667568_1668030_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|378956	pfam12802, MarR_2, MarR family. The Mar proteins are involved in the multiple antibiotic resistance, a non-specific resistance system. The expression of the mar operon is controlled by a repressor, MarR. A large number of compounds induce transcription of the mar operon. This is thought to be due to the compound binding to MarR, and the resulting complex stops MarR binding to the DNA. With the MarR repression lost, transcription of the operon proceeds. The structure of MarR is known and shows MarR as a dimer with each subunit containing a winged-helix DNA binding motif.	7.51419e-07

>CP015498.1|AUI76709.1|1677133_1678462_+|uracil-permease
MSKKENFRNPDAILDVYEKPELGQGVLLSLQHMFAMFGSTVLVPILIGINPSIALLSSGIGTLVHMILTHFKIPAYLGSSFAFVATMQALMKADGYPAVAQGAIASGLVYVIVALIIAKVGSGWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMNNQKYDLTYFGVAIFTLVMTLVFQMCFKGFTSLVSIMLGIICGYVLACFLGIVDFSGVEKAAWFSIPSLDVMGISYHFKWYPAAILAMAPIAFVTMTEHMGHIMVLNSLTKRNFFKNPGLHKTMMGDGISTIIAGFIGGPPTTSYGENIGVLAMTKVHSVWVLAGAAVCAIIFSFVGKLAALIESIPMPVIGGISFLLFGTIASNGLKILVDDKVDFGEKRNMLIASVILVIGIGGAYLQLGNFQLTSVALSTIIGMILNWVLPKKAASEKALEEKNKQKQDGKIYQ
>CP015498.1|AUI76708.1|1676590_1677121_+|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase
MAKEIIDAIGMKRALMRMTYEIVERNKGTENLVLVGIKTRGLYLAQRIAANLKKLEDVEISVGAIDVSQYRDDLPESKKEKMIHNQQLDFDITDKNVVLVDDVLFTGRTIRAALDALMDQGRPAKINLAVLVDRGHRELPIRPDFIGKNIPTAMNEEVKVSMTEVDDKDSIELINK
>CP015498.1|AUI76707.1|1674829_1676299_-|MFS-transporter
MNKKQLFMVTLALLLANIMSGLDATIINTAIPAIVSDLHGIQYMGWIVACFLLGMSVSVPIWGKLGERMGNKFAFELSLALFILGSLLEGIAPDIYFFLIARILMGVGAGGMGSLPYVIVGYIYPNIKRRTVILGYILASFSAASIAGPLVGGWIVDTLSWHWVFYINVPLGLIAIILSFVYYKGIRKPNKNTQFDKLGAFTLIAGLTSFLIGIQLLGMVSLPVVLGFIILGILLLVVFIRAERKAKSPVVPLSVFTNKALVGDFLIFALAWGSYIAVNTYLPMWAQAILGASALVGGMTLIPNSIVEIVGSQTAPYFLRHVNNYRLLIANLTIMAITAVGLIFAPISTPYQILALIAAFSGFSVGSIFVILQIKVQVDASEKDMAPATSLSFLIRILAQTIMAAIYGVIMNLALGRGIAGHPGITMTMMNKLSDAESAKSLPVQLLPTMRKIFYGGIREIMIVSLVLLVAAYVVNYLYNRHEAKIMAE
>CP015498.1|AUI76706.1|1673600_1674806_+|multidrug-transporter
MKEKPIWKKNLFVLSIAVFIAGIAFSEVMPFLPLYIDTLGKFSHQQLNFWSGFIYSGTYLVSALISPCWGKLADKKGRKPMTLRASLGMAIVIGCMGLVTNVYQLFILRMLQGVFAGFVSNSNALIATETPKEKSGQALGTMASSFTAGNLLGPFIGGALASIFSYRVTFFITGGLLLISFFLSLFFVHETDFKPVTEKKLDKASGIIKELRSPQLIFGLLLTTLIIQAANNSINPIVSLYVKQLMANHGNVVFISGVIAALPGIATFLAASRFGALGDRIGTHKIIVGGFIGATILFFLTAFVQNTVELGILRFLVGFTDACLFPQVQTLLTKNTPAKITGRIFSWNQSAMYVGNIFGPLLGSTISGLTSYSMVFIVTAIIVVFNLILFKFNVINNLRQK
>CP015498.1|AUI76705.1|1672391_1673474_-|peptidase-M42
MQKEQEIQMLKEFSDANSTSGFEEEFVKLFTSYAEKTANIEVDGMLNVYASKKENKGDRPVIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKPPHFMTAAERNNVPDVVDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGKDFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTARKVKPDLCLVLESCPADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKNNIPYTRSVRTGGGQDGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAIIRDITQEKLDSFKKF
>CP015498.1|AUI76704.1|1670664_1672287_-|ABC-F-family-ATPase
MITVSDLSLKFGGRTLYEDVNLKFTPGNCYGVIGANGAGKSTFLKLLEGKLEPTTGSISIDPNERMSSLNQDHFAFEDFTVMDTVIQGHKELYQVMKEKDALYAKPDFGDEDGVKAAELESKFAELDGWNAEANASKLLQSLDIPESEHQMLMKELPESEKVKVLLAQALFGNPDILLLDEPTNGLDVHTVEWLENFLADYPNIVIVVSHDRHFLNQVCTEMCDVDRGKIQLYVGNYDFWYESSKLANELVANKNDKKEEKIKQLQEFIARFSANASKSRQATSRKKQLDKITLDDIKPSSRKYPFVKFEMHRDLGNDLVKVENVSYSVDGEKILDNVSFIVRPGDKVAFLSRNALAATALLDIIAGKIKPDTGTVTWGQTTAFNYMSRDLNANFNNDDLTILDWLRQYATKEQDDNTFLRGFLGRMLFSGEEIEKKIKVLSGGEKVRCQLSRMMLEPANVLIMDDPTNHLDLESITALNDALVAYPGSILFTSHDHEFIQTIANHIIEVGPKGIVSRQDTTYDEFLDKESIQDQVEKIY
>CP015498.1|AUI76703.1|1669716_1670508_-|hypothetical-protein
MKEQIIFEDFIQDREVRMYDKHFSDTDNKVEYDVYVQVFTMDNLPFSSVTGKLDNIPFNYDHAGTKEVVVNNVIGDYFNPVTKKYEVSDHTFVVGHIKDSNLDQDIAIEQMQQAAMNIINELNKRQMPPHMVMPHLLTDVEKAKQVVTDDDVKISQLSKETGISEEILSDYRENPATLKKASNSTIERLITKYYEKYFNRNEIEKFRFMLIKTVMAYLKENKKDEIDYDPVYELYKLCQQADWHRLARMEEIWRAFYTVDNQH
>CP015498.1|AUI76702.1|1669035_1669704_-|GMP-synthase
MRVNVLQHAPNEGPGSIQDWCHEHNHEMFVYHPTDFGILPTIDETDLLVILGSPNSPNDKLDWIKNERVLIKQMLKANKPILGICFGSQQIAKTLGYEVLDAPAKEVGWAPVYLQDHTIENIPKKLTALHWHQQMSEIPEDTKLLFSSDLVKNQGYLLGNNVIGLQFHFEPKEDNVREIAINDGAYALENNDLHQTPQEIIAHGVPKENKDVMFVLLDYITK
>CP015498.1|AUI76701.1|1668174_1668993_+|glutamine-ABC-transporter-substrate-binding-protein
MKKRFFLPTLLIGIALFTLSACSQNKKQIVYQTVKSTKTINWGVKADTPLFGSMNIKTGKINGFEIDLAKALTKEMLGNNAKANFVTTTANTKIQLLKNRNVDAVIAAMTITPEREKQVDFSKPYFPAGQSIMVAKNSKIKNVKDLNNKKVLVVKGTTAADAVKKFAPKAEILQFDDYGQAFAALKAGQGDAFVTDNGILVGILRDSSGYKLVGGNFTNQPYGIAVNKGQTEMDKQINLALTKLEKDGTYNRLLKKWFGNIPGFNVKIAEKY
>CP015498.1|AUI76700.1|1667568_1668030_-|MarR-family-transcriptional-regulator
MKISESEKLNMAIVHGNRAYQQWDQDHELSDYLSVILYELLLRKKLTQKQLVGLTDLPKQSINKGIKILHDSGYLAMSVDPHDKRVRFCELTAAGNKYAKQKMQSLFRLEEQTAQKLGSEKMQLLTDLLTEWSNTFWDFLNEERSKECKHSKS
>CP015498.1|AUI76710.1|1681690_1682191_-|acetyltransferase
MIIKPLISEDEAKETSRLFQKCWQNTYKDILPDVFLDNIPENAWGKRLNESGRHNLIFIDDDNKIRAAVSYGRPRDTRMLGCGELMALYVEPDFQGFNIGKTLLNAAENELKKMGYGKIYLWCIDGDENARQFFEHFGWVNNATEKFVEIAGKEYKYLLYQKNLHD
>CP015498.1|AUI77156.1|1683557_1683962_-|hypothetical-protein
MVDDYLLTVNYRSVIENDLVNYTQGIESYFRNERLTLRDKINKFIEELPESYRELLSEHVGNTDDWIGKLVSTRVFLTHGDRENMAVSNPYKLVQMTKIFGFMVRIFILQKLGITIDKPKILNKFKNVLTTHYY
>CP015498.1|AUI76711.1|1684192_1685599_+|transposase
MESIIADIVKIIKSENNVIAREKALMCYFFDLIRELMTAALEEVDAGLVEETKKQGYQIEKKNKRSVVTAFGEISYWRRRYVCPGKKAQYPLDKLMGYDKYKRYSVLAVKDVLQVSAVATYRNTALAVNTLSCFKISHSQVGKLIVQAGKQIKAQQQSEERYDGITQKKKAPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSKTRRKRVQAKEFVSLSRLDALQEIKAYLANAYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEHFLDVFHLNKKIKDRLGFMPAMQSKLISAVEFKYDRHLTDVILDTIESNLVDELNTPENHENLRRLRSYLHRRWVDIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKNNELEYWLSSEFAGGQLDIGDQEDLKGAVRASLRKTHGVHLGIHHGAIESLTAGHSYLDDFSRKINQINI
>CP015498.1|AUI76712.1|1685816_1686017_+|cold-shock-protein
MQTGTVKWFNADKGFGFITGSDNKDVFVHFSAIKTDGFKSLEEGQKVSYDVEQGSRGPQATNVVPQ
>CP015498.1|AUI76713.1|1687192_1688599_+|transposase
MESIITDIVKIIKSENNVLAREKALMCYFFDLMGELMKLALEEVDVGLVDETKKQGYQIEKKNKRSVVTVFGEISYWRRRYVCPGKKAKYPLDQLMGYDKYKRYSVLAVKNILQVSAVSTYRNTALAVNTLSSFNISHSQVGKLIVQAGKQIKAQQQSEERYDGITQKKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINVSKTRRKRVQAKEFVSLSRLNALQEIKAYLANTYDLSDTLIISNADGGAGYAKKDFDEIVGRCKQHEHFLDVFHLNKKIKDRLGFMPAMQGKLISAVEFKYDRRLTDVILDTIESNLIDELNTPENHENLRRLRGYLHRHWADIEPFKMRNLPVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKNNELEYWLSSEFAGSEINAITEQELKAAARDSLKKRHESHLGIQRGALTTQTAGSSYLSKFNRMLNHINY
>CP015498.1|AUI76714.1|1689087_1690440_-|23S-rRNA-(uracil-5-)-methyltransferase-RumA
MEKNQIIDLEITDLSYEAMGVAHYNGMTVFVTNALPGEVVSAKILKVKKNFAFAKIEKIKKESPDRVNVKLNQGVQSGLASLAHIKYDKQLDFKRNQVVNLLKKAHLENIEVGETLASPEEVGYRNKAQVPVREVNGQLEIGFFRRHSHDLMPLTHFFTTDPEIDRVLVAVRDILRKYKVPAYDEINNNGEVRYLEVRRSKSTGEMMVILVCLHKDFMQLPNVAAEVSQIPGVSGLILNHNPKKTNVILGPKDYLVFGNDQITDQIGDLKFRISPQSFFQINSLQTPRLYNLAIKQADLKPDDVVIDAYSGIGTIGLSVAKHVKAVRGIEVVRDAIKDAKDNAKLNDITNAKYYLGKAEEIMPRWAKSGLKTDVVFVDPPRKGLTPEFINAAVKTGPKKIVYISCNPATLVRDLQLFQEKSYEFNRIDPVDMFPQTPHVESVTVLERTEK
>CP015498.1|AUI76715.1|1690804_1692181_+|Na+/H+-antiporter-NhaC
MKKEKVSFTESIIILIALLAILGISVIKFGLSPEVPVLFTVLLLTFWARFRGFTWKDVQDGIKEGIGVAIIPIFIFILIGALIGLWIKAGIIPSIMVLGFHLISGSFFVPSVFIACAIVGVAIGSGFTTISTVGIALFGIGASMNANLALVAGAIISGAVFGDKMSPLSDSTNLSSAVAESELFAHIKNMMWSTIPSFIVSLILFWILGNSGHMDPTKIERTSHVLQTNFSISWWAVVPIVFMLLCAWRKVPAIPTLFINIAATVIMIFIQNPHESVQSLNNLIMNGFVAKTSDASVNALLTRGGISSMMATVALIISTLSIGGMLMKFNVVQSAMEPLVKHLRKPGRLITVTILSGICINLLVGEQYLSVILPGRAFKPAFDKIKLSPLALSRVLEDGGSVINYLIPWGVAGSFAATTLGVPVLQFLPFAFFSLLSPVFSIISGFTGIGLKWAKDKK
>CP015498.1|AUI76716.1|1692779_1693958_+|transposase
MNDFTKNMAQALFNQDKINDLLRKELQQAVNDLLEAELTAFLGYDPYARTGWNTGNSRNGAYFRKVDTQFGEIEIQVPRDRNGMFHQHTLPDYKQHSDVLESMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHQRKLSDKFFCVYLDATYIPLRRITFDREAVYIAIGIKPNGHKEVIDYRIAPSENVENWTEMLQDMKSRGLEQVELFLSDGVVGMKTALEQTYPKAHFQRCLVHVMRNICAKVRVDDRETIMNEFKQIHQQPNKEAAIKVLHAFYDKWNRAYNHVIRNLKEIEPDLLVFYDYPKQIRASIYSTNMIESFNNVIKRKAKPKAEFPTEQSLDTFIGIQAMSYNERYFNRIHKGFGQVQDTLESYFD
>CP015498.1|AUI76717.1|1694121_1694826_+|hypothetical-protein
MDNFSNPGRREVHDVSEVNGFLSKMYGYMGLSVLVSALAAFLTMTVFRSAVMQMPPAMMWIILFVPIGLSLGINFKATRNPVAGFVMLMILAVIYGFEFALLAGFYTQAQIGTAFVSSAAVFGAMAVFGTFTKKNLNNMGSYLSAALIGLLVAMVVNIFLRNSVASFVFSIIGVVIFTGLTAYDAQKMKAIYNNYGSQVSTNGLAVLGALQLYLDFVNIFLFLLQIFGMGGDRD
>CP015498.1|AUI76718.1|1694869_1695562_-|hypothetical-protein
MFKLHKVFDSRHYRRLSSVQKEELKEARDKVHQAQQKEPKRLREHLETFNDAVIAIIITIIVLQIQPAFKASQYLEFLGNIVIFIIAFFIIADFWYELHLAFSYFIFKPDKITAICDFCLLATLSLLPVMTKWIMMRDSAFAVTNFGIVYFIAQILKVFVQYFGAKPLMRSSQVMNIMMVKTSVHRIILVFLLTLFLILLSLVVPKVAMFLYILIPFISFLMPNNSRGFR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	13027-13065	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	28210-28248	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	396215-396253	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	458440-458478	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	573897-573935	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	635071-635109	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	637106-637144	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	732978-733016	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	736432-736470	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	765848-765886	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	770931-770969	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	1161513-1161551	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	1166591-1166629	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	1272263-1272301	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	1652757-1652795	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	2030408-2030446	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	CP015498.1	2049942-2049980	1.0

1. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 13027-13065, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

2. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 28210-28248, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

3. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 396215-396253, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

4. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 458440-458478, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

5. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 573897-573935, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

6. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 635071-635109, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

7. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 637106-637144, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

8. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 732978-733016, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

9. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 736432-736470, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

10. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 765848-765886, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

11. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 770931-770969, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

12. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 1161513-1161551, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

13. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 1166591-1166629, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

14. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 1272263-1272301, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

15. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 1652757-1652795, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

16. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 2030408-2030446, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

17. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to position: 2049942-2049980, mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	35281-35319	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	184269-184307	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	20549-20587	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035016	Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence	20990-21028	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	22928-22966	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	35278-35316	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	21154-21192	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	54020-54058	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP019723	Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence	9387-9425	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	35279-35317	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP053913	Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence	16765-16803	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014891	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence	48513-48551	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014891	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence	51143-51181	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012291	Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-3, complete sequence	14211-14249	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP031319	Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence	15046-15084	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP029350	Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence	23350-23388	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014932	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-8, complete sequence	48155-48193	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	6431-6469	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	9060-9098	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	77237-77275	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012657	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence	4489-4527	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012657	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence	7118-7156	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012657	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence	82278-82316	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	31603-31641	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	64577-64615	0	1.0
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	193308-193346	1	0.974
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NC_002102	Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence	6585-6623	1	0.974
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP018612	Lactobacillus delbrueckii subsp. indicus strain JCM 15610 plasmid pLD01, complete sequence	37823-37861	3	0.923
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012291	Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-3, complete sequence	126639-126677	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	4098-4136	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP021933	Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence	36253-36291	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP018212	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence	46905-46943	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	20177-20215	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	68192-68230	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP035574	Lactobacillus plantarum strain SRCM103303 plasmid unnamed3	14267-14305	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032634	Lactobacillus sakei strain ZFM220 plasmid unnamed1, complete sequence	27798-27836	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP012278	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-3, complete sequence	54777-54815	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP014626	Lactobacillus backii strain TMW 1.1988 plasmid L11988-2, complete sequence	30366-30404	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_LT960789	Lactobacillus sakei strain MFPB16A1401 plasmid 2, complete sequence	33954-33992	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032636	Lactobacillus sakei strain ZFM225 plasmid unnamed1, complete sequence	32242-32280	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_LT960782	Lactobacillus sakei strain J64 plasmid 2, complete sequence	41146-41184	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032653	Lactobacillus sakei strain LZ217 plasmid unnamed1, complete sequence	32264-32302	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP022710	Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence	68793-68831	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP025137	Lactobacillus sakei strain WiKim0072 plasmid pLSW72_1, complete sequence	3071-3109	8	0.795
CP015498_2	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	NZ_CP032641	Lactobacillus sakei strain ZFM229 plasmid unnamed1, complete sequence	25735-25773	8	0.795
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22591	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4776-4859	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5853	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26587	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6974	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20993	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5879-5962	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5880-5963	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NC_014386	Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence	1748-1831	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP019583	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence	4584-4667	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4825	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3413	24	0.714
CP015498_4	4.1\|1885747\|84\|CP015498\|CRISPRCasFinder	1885747-1885830	84	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4831-4914	25	0.702

1. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

2. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

3. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

4. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035016 (Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

5. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

6. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

7. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

8. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

9. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP019723 (Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

10. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

11. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP053913 (Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

12. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014891 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

13. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014891 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

14. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012291 (Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

15. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP031319 (Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

16. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP029350 (Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

17. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014932 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-8, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

18. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

19. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

20. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

21. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012657 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

22. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012657 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

23. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012657 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

24. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

25. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP046661 (Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

26. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 1, identity: 0.974

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
agctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
.**************************************

27. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NC_002102 (Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence) position: , mismatch: 1, identity: 0.974

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaag	Protospacer
**************************************

28. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP018612 (Lactobacillus delbrueckii subsp. indicus strain JCM 15610 plasmid pLD01, complete sequence) position: , mismatch: 3, identity: 0.923

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatgaagagtaaatgatt	Protospacer
************************..*********** *

29. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012291 (Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-3, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagttttacaga-----	Protospacer
******.******************** ***     *.*

30. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagatagcttttacag	Protospacer
*************************** **.   *. *

31. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP021933 (Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagatagcttttacag	Protospacer
*************************** **.   *. *

32. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP018212 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagatagcttttacag	Protospacer
*************************** **.   *. *

33. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagatagcttttacag	Protospacer
*************************** **.   *. *

34. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP028242 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagatagcttttacag	Protospacer
*************************** **.   *. *

35. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP035574 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed3) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagttttacaga-----	Protospacer
******.******************** ***     *.*

36. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032634 (Lactobacillus sakei strain ZFM220 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

37. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP012278 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-3, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagttttacaga-----	Protospacer
******.******************** ***     *.*

38. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP014626 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-2, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagttttacaga-----	Protospacer
******.******************** ***     *.*

39. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_LT960789 (Lactobacillus sakei strain MFPB16A1401 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

40. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032636 (Lactobacillus sakei strain ZFM225 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

41. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_LT960782 (Lactobacillus sakei strain J64 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagttttacaga-----	Protospacer
******.******************** ***     *.*

42. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032653 (Lactobacillus sakei strain LZ217 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

43. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP022710 (Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

44. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP025137 (Lactobacillus sakei strain WiKim0072 plasmid pLSW72_1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

45. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to NZ_CP032641 (Lactobacillus sakei strain ZFM229 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

ggctctttgtcaaatcctgttgatagagagt-----aaatgaat	CRISPR spacer
ggctctctgtcaaatcctgttgatagatagtcttacaga-----	Protospacer
******.******************** ***     *.*

46. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

47. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

48. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

49. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

50. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

51. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

52. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

53. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

54. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NC_014386 (Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

55. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP019583 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

56. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

57. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

58. spacer 4.1|1885747|84|CP015498|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 25, identity: 0.702

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacaagcgaaagtctaaaaaatagaccttcgc	Protospacer
*******************************.****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10486 : 72851

Streptococcus_phage(40.0%)

transposase,integrase

attL 29431:29447|attR 57353:57369

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI75336.1\|10486_11665_-\|transposase	transposase	NA	NA	NA	NA
AUI75337.1\|14884_15304_+	DDE endonuclease	NA	NA	NA	NA
AUI75338.1\|15651_16143_-	hypothetical protein	NA	NA	NA	NA
AUI77104.1\|16120_16690_-	hypothetical protein	NA	NA	NA	NA
AUI75339.1\|17782_18961_+\|transposase	transposase	NA	NA	NA	NA
AUI75340.1\|19426_20284_+\|transposase	transposase	NA	NA	NA	NA
AUI75341.1\|22552_22918_+	hypothetical protein	NA	NA	NA	NA
AUI75342.1\|23056_25078_+	hypothetical protein	NA	NA	NA	NA
AUI75343.1\|25089_25545_+	50S ribosomal protein L9	NA	NA	NA	NA
AUI75344.1\|25575_26970_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.7e-120	50.6
AUI75345.1\|27206_28136_+	phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI75346.1\|28252_29530_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	1.4e-12	21.7
29431:29447	attL	NA	NA	NA	NA
AUI75347.1\|29696_30626_+	fatty acid-binding protein DegV	NA	NA	NA	NA
AUI75348.1\|30744_31623_+	fructokinase	NA	NA	NA	NA
AUI75349.1\|31995_32256_+	hypothetical protein	NA	NA	NA	NA
AUI75350.1\|32316_33546_-	esterase	NA	NA	NA	NA
AUI75351.1\|33629_34334_-	methyltransferase	G3MA03	Bacillus_virus	2.1e-18	43.6
AUI75352.1\|34819_36838_+	DNA methyltransferase	Q1MVP0	Enterobacteria_phage	8.0e-31	30.2
AUI75353.1\|36959_38138_+\|transposase	transposase	NA	NA	NA	NA
AUI75354.1\|38299_41077_+	restriction endonuclease subunit R	NA	NA	NA	NA
AUI75355.1\|41345_42314_-	hypothetical protein	NA	NA	NA	NA
AUI75356.1\|42439_42751_+	hypothetical protein	NA	NA	NA	NA
AUI75357.1\|42747_43830_+	cell division protein	NA	NA	NA	NA
AUI75358.1\|43826_44369_+	hypothetical protein	NA	NA	NA	NA
AUI77105.1\|44718_45636_+	replication initiation protein	NA	NA	NA	NA
AUI75359.1\|45695_45890_+	hypothetical protein	NA	NA	NA	NA
AUI75360.1\|45960_47160_+\|integrase	integrase	Q9ZXG6	Leuconostoc_phage	8.4e-12	23.2
AUI75361.1\|47578_48865_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.7e-106	51.3
AUI75362.1\|49122_49476_-	hypothetical protein	NA	NA	NA	NA
AUI75363.1\|49472_49673_-	transcriptional regulator	NA	NA	NA	NA
AUI75364.1\|49840_50479_+	spermidine/putrescine ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	7.6e-20	31.8
AUI75365.1\|50503_51262_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AUI75366.1\|53739_53964_+	hypothetical protein	NA	NA	NA	NA
AUI75367.1\|53973_54561_+	transcriptional regulator	NA	NA	NA	NA
AUI75368.1\|54665_55967_+	hypothetical protein	NA	NA	NA	NA
AUI75369.1\|57634_59035_+	hypothetical protein	NA	NA	NA	NA
57353:57369	attR	NA	NA	NA	NA
AUI75370.1\|59131_59905_+	hypothetical protein	NA	NA	NA	NA
AUI75371.1\|59943_60504_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AUI75372.1\|60504_61029_-	hypothetical protein	NA	NA	NA	NA
AUI75373.1\|61030_61441_-	hypothetical protein	NA	NA	NA	NA
AUI75374.1\|61461_63696_-	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A222ZQ84	Mycobacterium_phage	2.5e-89	33.2
AUI75375.1\|63950_64985_+	AI-2E family transporter	NA	NA	NA	NA
AUI75376.1\|64981_65554_+	esterase	NA	NA	NA	NA
AUI75377.1\|66973_67603_-	fructose-2,6-bisphosphatase	NA	NA	NA	NA
AUI75378.1\|68005_69127_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	2.0e-92	46.8
AUI75379.1\|69104_70271_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	2.6e-98	46.9
AUI75380.1\|70438_70753_+	supressor protein SugE	NA	NA	NA	NA
AUI75381.1\|71509_72343_+\|transposase	transposase	NA	NA	NA	NA
AUI77106.1\|72290_72851_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

77660 : 141520

Streptococcus_phage(14.29%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI75386.1\|77660_78851_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	8.4e-129	59.7
AUI75387.1\|80769_81627_+	2,5-diketo-D-gluconic acid reductase	A0A2H4PQR8	Staphylococcus_phage	3.9e-59	43.1
AUI75388.1\|81965_83891_+	elongation factor G	A0A1S5SF82	Streptococcus_phage	4.7e-65	30.1
AUI75389.1\|84903_85917_-	lactate dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	1.0e-50	35.6
AUI75390.1\|86043_86886_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AUI75391.1\|87340_88168_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.4e-97	63.5
AUI75392.1\|89184_92016_+	NgoFVII family restriction endonuclease	A0A0K2CZF8	Paenibacillus_phage	1.6e-29	24.9
AUI75393.1\|92055_93159_-	penicillin-binding protein	NA	NA	NA	NA
AUI75394.1\|93355_93769_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.0e-09	38.9
AUI77107.1\|99582_99741_+	branched-chain amino acid transporter	NA	NA	NA	NA
AUI75395.1\|100842_101478_-	transcriptional regulator	NA	NA	NA	NA
AUI75396.1\|101629_101848_-	steroid-binding protein	NA	NA	NA	NA
AUI75397.1\|101935_102805_-	phospho-beta-glycosidase	NA	NA	NA	NA
AUI75398.1\|102801_103638_-	glucosyltransferase	NA	NA	NA	NA
AUI75399.1\|103762_104719_-	glucosyltransferase	NA	NA	NA	NA
AUI75400.1\|104737_105574_-	glycosyl transferase	NA	NA	NA	NA
AUI75401.1\|105669_106488_+	transcriptional regulator	NA	NA	NA	NA
AUI75402.1\|106920_107340_+	DDE endonuclease	NA	NA	NA	NA
AUI75403.1\|107411_107726_+\|transposase	transposase	NA	NA	NA	NA
AUI75404.1\|108206_108965_-	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
AUI75405.1\|109110_110289_-\|transposase	transposase	NA	NA	NA	NA
AUI75406.1\|110473_111595_+	s-layer protein	NA	NA	NA	NA
AUI75407.1\|111868_113275_-\|transposase	transposase	NA	NA	NA	NA
AUI75408.1\|114102_115005_+	hypothetical protein	NA	NA	NA	NA
AUI75409.1\|115700_116525_+\|transposase	transposase	NA	NA	NA	NA
AUI75410.1\|116633_116816_+	hypothetical protein	NA	NA	NA	NA
AUI75411.1\|116980_117175_-	hypothetical protein	NA	NA	NA	NA
AUI75412.1\|117352_117610_-	hypothetical protein	NA	NA	NA	NA
AUI75413.1\|118949_119156_-	hypothetical protein	NA	NA	NA	NA
AUI75414.1\|119484_120201_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.0e-41	39.2
AUI77108.1\|120267_122124_+	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	5.1e-32	32.0
AUI75415.1\|122113_123463_+	hypothetical protein	NA	NA	NA	NA
AUI75416.1\|123465_124290_+	hypothetical protein	NA	NA	NA	NA
AUI75417.1\|124305_125103_+	MBL fold hydrolase	A0A2I7SDH3	Paenibacillus_phage	1.2e-30	34.1
AUI75418.1\|125189_126431_+\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-17	29.4
AUI77109.1\|126895_127375_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AUI75419.1\|127883_128768_-	proline iminopeptidase	NA	NA	NA	NA
AUI75420.1\|128776_129430_-	ABC transporter permease	NA	NA	NA	NA
AUI75421.1\|129433_130783_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-12	28.1
AUI75422.1\|130940_131882_+	hypothetical protein	NA	NA	NA	NA
AUI75423.1\|133550_134447_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
AUI75424.1\|134461_135022_-	hypothetical protein	A0A1X9IGG1	Lactococcus_phage	1.2e-13	33.7
AUI75425.1\|135088_136195_-	cation transporter	NA	NA	NA	NA
AUI75426.1\|136383_136788_+	hypothetical protein	NA	NA	NA	NA
AUI75427.1\|136933_137287_+	hypothetical protein	NA	NA	NA	NA
AUI75428.1\|137663_138842_+\|transposase	transposase	NA	NA	NA	NA
AUI75429.1\|140242_141520_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	8.1e-13	21.7

DBSCAN-SWA_3

203230 : 307330

Lactobacillus_virus(13.79%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI75487.1\|203230_204502_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.4e-65	39.1
AUI75488.1\|204534_204945_-\|transposase	transposase	A0A0P0IQC6	Lactobacillus_phage	1.1e-19	36.4
AUI75489.1\|205221_206445_+	N-acetylmuramidase	S5M9Y4	Brevibacillus_phage	2.0e-13	36.3
AUI75490.1\|206463_207555_+	amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.3e-19	26.9
AUI75491.1\|207658_209494_+	potassium transporter	NA	NA	NA	NA
AUI75492.1\|210691_211657_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AUI75493.1\|211666_212458_-	hypothetical protein	NA	NA	NA	NA
AUI75494.1\|212545_213940_-	hypothetical protein	A0A1B1P773	Bacillus_phage	5.7e-52	43.0
AUI75495.1\|214903_215596_+	phosphoglyceromutase	NA	NA	NA	NA
AUI75496.1\|215818_216430_+	pyroglutamyl-peptidase I	NA	NA	NA	NA
AUI75497.1\|216555_217962_+\|transposase	transposase	NA	NA	NA	NA
AUI75498.1\|218091_218652_+	aldose epimerase	NA	NA	NA	NA
AUI75499.1\|218753_219863_+	LytR family transcriptional regulator	NA	NA	NA	NA
AUI75500.1\|219862_220480_+	hypothetical protein	NA	NA	NA	NA
AUI75501.1\|220515_223506_+	glucan modification protein	NA	NA	NA	NA
AUI75502.1\|223591_224986_+	ferrous iron transporter A	NA	NA	NA	NA
AUI75503.1\|225239_226502_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	6.7e-84	41.9
AUI75504.1\|226923_227280_+	hypothetical protein	NA	NA	NA	NA
AUI75505.1\|227584_228898_+	aminopeptidase	R4TV59	Phaeocystis_globosa_virus	2.6e-62	33.0
AUI75506.1\|228897_229551_+	phosphohydrolase	NA	NA	NA	NA
AUI75507.1\|229719_231342_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI75508.1\|231416_233048_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI75509.1\|233204_234347_+	guanosine monophosphate reductase	A0A1V0SHK8	Klosneuvirus	1.2e-63	34.1
AUI75510.1\|234521_235451_+	peptide ABC transporter permease	NA	NA	NA	NA
AUI75511.1\|235459_236491_+	peptide ABC transporter permease	NA	NA	NA	NA
AUI75512.1\|236506_237565_+	peptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-19	32.0
AUI75513.1\|237585_238530_+	peptide ABC transporter substrate-binding protein	G9BWD6	Planktothrix_phage	4.6e-21	33.3
AUI75514.1\|238611_239928_-	aminopeptidase	R4TV59	Phaeocystis_globosa_virus	1.0e-63	36.1
AUI75515.1\|240068_240515_-	heat-shock protein Hsp20	NA	NA	NA	NA
AUI75516.1\|241325_241673_+\|transposase	transposase	NA	NA	NA	NA
AUI77110.1\|241712_241943_+\|transposase	transposase	NA	NA	NA	NA
AUI75517.1\|241917_243255_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUI75518.1\|243558_244221_+	hypothetical protein	NA	NA	NA	NA
AUI75519.1\|244381_244981_-	hypothetical protein	NA	NA	NA	NA
AUI75520.1\|245136_246543_+\|transposase	transposase	NA	NA	NA	NA
AUI75521.1\|246712_247735_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AUI75522.1\|247759_248239_+	competence protein ComE	A7KUY9	Bacillus_phage	5.2e-37	59.0
AUI75523.1\|248219_248837_+	hypothetical protein	NA	NA	NA	NA
AUI75524.1\|249135_251799_+	magnesium-translocating P-type ATPase	M1HXH2	Paramecium_bursaria_Chlorella_virus	9.9e-37	24.4
AUI75525.1\|251891_253868_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	5.2e-99	39.2
AUI75526.1\|253867_254635_+	hydrolase TatD	NA	NA	NA	NA
AUI75527.1\|254621_255188_+	ribonuclease M5	NA	NA	NA	NA
AUI75528.1\|255177_256053_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase	NA	NA	NA	NA
AUI75529.1\|256133_256391_+	hypothetical protein	NA	NA	NA	NA
AUI75530.1\|256491_257322_+	pur operon repressor	NA	NA	NA	NA
AUI75531.1\|257368_258754_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	1.0e-29	34.0
AUI75532.1\|259542_259974_+	hypothetical protein	NA	NA	NA	NA
AUI75533.1\|260068_261025_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	5.9e-93	49.2
AUI75534.1\|262494_263889_+	cell division protein	NA	NA	NA	NA
AUI75535.1\|264129_265104_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	6.6e-47	36.8
AUI75536.1\|266132_266408_-	hypothetical protein	NA	NA	NA	NA
AUI75537.1\|266435_267800_-	hypothetical protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.4e-31	33.1
AUI75538.1\|267913_268315_+	hypothetical protein	NA	NA	NA	NA
AUI75539.1\|268361_268919_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
AUI75540.1\|269036_270656_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.6e-136	47.2
AUI75541.1\|270785_272087_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
AUI75542.1\|272083_272941_-\|transposase	transposase	NA	NA	NA	NA
AUI75543.1\|273177_273399_+	phosphatase	NA	NA	NA	NA
AUI75544.1\|273432_273795_+	haloacid dehalogenase	NA	NA	NA	NA
AUI75545.1\|273850_275275_-	peptidase U34	NA	NA	NA	NA
AUI75546.1\|275355_276180_-	AraC family transcriptional regulator	NA	NA	NA	NA
AUI75547.1\|276279_277554_-	Uric acid permease PucJ	Q9KX94	Enterobacteria_phage	1.4e-28	27.9
AUI75548.1\|277557_278136_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
AUI75549.1\|278409_279588_+\|transposase	transposase	NA	NA	NA	NA
AUI77111.1\|279789_280392_-	hypothetical protein	NA	NA	NA	NA
AUI75550.1\|280743_281934_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	9.0e-123	57.7
AUI75551.1\|282251_282446_-	hypothetical protein	NA	NA	NA	NA
AUI77112.1\|282432_282726_-	hypothetical protein	NA	NA	NA	NA
AUI75552.1\|282768_282921_-	DNA-binding protein	NA	NA	NA	NA
AUI75553.1\|283160_284711_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.2e-23	34.1
AUI75554.1\|286463_286703_+	hypothetical protein	NA	NA	NA	NA
AUI75555.1\|287099_288335_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.2e-101	53.2
AUI75556.1\|288462_289740_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	20.3
AUI75557.1\|291196_292375_-\|transposase	transposase	NA	NA	NA	NA
AUI75558.1\|292672_293056_+	hypothetical protein	A0A146ICT8	Staphylococcus_phage	9.6e-10	37.9
AUI75559.1\|293063_293756_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUI75560.1\|293967_295146_+\|transposase	transposase	NA	NA	NA	NA
AUI75561.1\|295339_296416_+	cell surface protein	NA	NA	NA	NA
AUI75562.1\|296754_297939_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.3e-123	59.1
AUI75563.1\|298125_298956_-	sugar-phosphatase	NA	NA	NA	NA
AUI75564.1\|299140_299386_+	50S ribosomal protein L31	NA	NA	NA	NA
AUI75565.1\|299512_300880_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
AUI75566.1\|300892_302416_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.5e-69	38.4
AUI75567.1\|302498_302855_+	holo-ACP synthase	NA	NA	NA	NA
AUI75568.1\|302857_303988_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	7.2e-29	27.7
AUI75569.1\|304771_305479_-	hypothetical protein	NA	NA	NA	NA
AUI75570.1\|305666_306638_-	L-lactate dehydrogenase	NA	NA	NA	NA
AUI75571.1\|306772_307330_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

DBSCAN-SWA_4

352767 : 466970

113

Streptococcus_phage(10.0%)

integrase,transposase,tRNA

attL 354498:354515|attR 364751:364768

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI75621.1\|352767_353559_+\|tRNA	tRNA pseudouridine(38,39,40) synthase TruA	NA	NA	NA	NA
AUI75622.1\|353659_354103_+	50S ribosomal protein L13	NA	NA	NA	NA
AUI75623.1\|354118_354514_+	30S ribosomal protein S9	NA	NA	NA	NA
354498:354515	attL	NA	NA	NA	NA
AUI75624.1\|354583_355636_-\|integrase	integrase	A0A0M9JJ77	Lactobacillus_phage	1.0e-37	30.4
AUI75625.1\|355710_355899_-	hypothetical protein	NA	NA	NA	NA
AUI77114.1\|355960_356881_-	replication initiation protein	A0A1S6LVK5	Cruciviridae_sp	3.9e-09	28.2
AUI75626.1\|357248_357755_-	hypothetical protein	NA	NA	NA	NA
AUI75627.1\|357761_358844_-	hypothetical protein	NA	NA	NA	NA
AUI75628.1\|358846_359152_-	hypothetical protein	NA	NA	NA	NA
AUI75629.1\|359299_359479_+	hypothetical protein	NA	NA	NA	NA
AUI75630.1\|359490_360426_+	hypothetical protein	NA	NA	NA	NA
AUI75631.1\|360467_363254_+	methylase	Q6NE04	Leptospira_phage	3.0e-161	37.0
AUI75632.1\|363287_364586_+	hypothetical protein	NA	NA	NA	NA
AUI77115.1\|364830_365241_-	hypothetical protein	NA	NA	NA	NA
364751:364768	attR	NA	NA	NA	NA
AUI75633.1\|365330_365915_-	4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein	NA	NA	NA	NA
AUI75634.1\|366689_367448_+	hypothetical protein	NA	NA	NA	NA
AUI75635.1\|367486_368167_+	fructose-2,6-bisphosphatase	NA	NA	NA	NA
AUI75636.1\|368229_369129_+	cobalt transporter	A0A1V0SED0	Indivirus	6.3e-12	34.8
AUI75637.1\|369137_369320_+	hypothetical protein	NA	NA	NA	NA
AUI75638.1\|369333_370014_+	phosphoglycerate mutase	NA	NA	NA	NA
AUI75639.1\|370117_371053_+	2',3'-cyclic-nucleotide 2'-phosphodiesterase	I7CCW4	Staphylococcus_virus	9.5e-11	25.7
AUI75640.1\|371261_372440_+\|transposase	transposase	NA	NA	NA	NA
AUI75641.1\|374274_376953_+	magnesium-translocating P-type ATPase	M1HJQ2	Paramecium_bursaria_Chlorella_virus	4.9e-44	24.4
AUI75642.1\|377604_378447_-	sugar transporter	NA	NA	NA	NA
AUI75643.1\|378590_379940_-	aminopeptidase	R4TV59	Phaeocystis_globosa_virus	4.8e-72	35.5
AUI75644.1\|380149_381007_+\|transposase	transposase	NA	NA	NA	NA
AUI75645.1\|381243_382434_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.5e-125	58.7
AUI75646.1\|382647_382950_-	hypothetical protein	NA	NA	NA	NA
AUI75647.1\|383086_383638_+	dUTP diphosphatase	J9PV85	Bacillus_phage	3.1e-38	48.6
AUI75648.1\|383637_385014_+	DNA repair protein RadA	A0A2I7QPS8	Vibrio_phage	8.8e-05	24.6
AUI75649.1\|385089_386589_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AUI75650.1\|386681_388112_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	6.2e-46	29.4
AUI75651.1\|388104_388545_+	hypothetical protein	NA	NA	NA	NA
AUI75652.1\|388531_389284_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
AUI75653.1\|389426_389972_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AUI75654.1\|390047_390266_+	hypothetical protein	NA	NA	NA	NA
AUI75655.1\|390377_391874_+	gluconate kinase	NA	NA	NA	NA
AUI75656.1\|393955_394123_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AUI75657.1\|394230_394788_+	transcription termination/antitermination protein NusG	F5B3X4	Synechococcus_phage	2.3e-12	31.3
AUI75658.1\|394915_395341_+	50S ribosomal protein L11	NA	NA	NA	NA
AUI75659.1\|395423_396116_+	50S ribosomal protein L1	NA	NA	NA	NA
AUI75660.1\|396257_397520_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	1.3e-10	22.1
AUI75661.1\|398051_398243_-	hypothetical protein	NA	NA	NA	NA
AUI75662.1\|398265_398472_-	hypothetical protein	NA	NA	NA	NA
AUI75663.1\|398602_399469_+	phosphate ABC transporter substrate-binding protein	M1PR58	Cyanophage	4.2e-05	22.6
AUI75664.1\|399472_400468_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AUI75665.1\|400469_401357_+	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AUI75666.1\|401367_402162_+	phosphate ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.0e-13	33.5
AUI75667.1\|402163_402919_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-15	27.5
AUI75668.1\|402935_403613_+	phosphate transport system regulatory protein PhoU	NA	NA	NA	NA
AUI75669.1\|405207_405720_+	50S ribosomal protein L10	NA	NA	NA	NA
AUI75670.1\|405770_406133_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AUI75671.1\|406246_406441_+	hypothetical protein	NA	NA	NA	NA
AUI75672.1\|406557_407736_+\|transposase	transposase	NA	NA	NA	NA
AUI75673.1\|408414_409044_+	16S rRNA methyltransferase	NA	NA	NA	NA
AUI75674.1\|409033_409540_+\|tRNA	tRNA-specific adenosine deaminase	S4VYZ2	Pandoravirus	9.1e-08	39.5
AUI75675.1\|409734_411522_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.0e-49	39.7
AUI75676.1\|411554_411890_+	nucleoid-associated protein	NA	NA	NA	NA
AUI75677.1\|411890_412490_+	recombination protein RecR	NA	NA	NA	NA
AUI75678.1\|412489_412735_+	hypothetical protein	NA	NA	NA	NA
AUI75679.1\|412838_413477_+	dTMP kinase	M1PSC7	Streptococcus_phage	3.6e-54	51.0
AUI75680.1\|413488_413809_+	hypothetical protein	NA	NA	NA	NA
AUI75681.1\|413809_414667_+	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	3.9e-19	29.2
AUI75682.1\|414677_415028_+	Initiation-control protein	NA	NA	NA	NA
AUI75683.1\|415029_415884_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.3e-64	47.7
AUI75684.1\|415886_416621_+	acyl-ACP thioesterase	NA	NA	NA	NA
AUI75685.1\|416663_417182_+	BioY family transporter	NA	NA	NA	NA
AUI75686.1\|417206_417941_+\|tRNA	tRNA N6-adenosine(37)-N6-threonylcarbamoyltransferase complex dimerization subunit TsaB	NA	NA	NA	NA
AUI75687.1\|417924_418497_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AUI77116.1\|418547_419597_+\|tRNA	tRNA N6-adenosine(37)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.1e-50	35.2
AUI75688.1\|419665_420943_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	1.8e-12	21.7
AUI75689.1\|421120_423034_-	ABC transporter	A0A2K9L3Z8	Tupanvirus	6.0e-60	31.4
AUI75690.1\|423207_423855_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
AUI75691.1\|423994_424453_+	DNA-binding protein	NA	NA	NA	NA
AUI75692.1\|424449_425196_+	hypothetical protein	NA	NA	NA	NA
AUI75693.1\|426595_427141_+	sucrose PTS transporter	NA	NA	NA	NA
AUI75694.1\|427370_428777_+\|transposase	transposase	NA	NA	NA	NA
AUI77117.1\|428921_429185_+	hypothetical protein	NA	NA	NA	NA
AUI75695.1\|429266_429452_-	hypothetical protein	NA	NA	NA	NA
AUI75696.1\|429718_430249_+	hypothetical protein	NA	NA	NA	NA
AUI75697.1\|430464_430749_+	co-chaperone GroES	A0A221S304	uncultured_virus	1.2e-12	40.7
AUI75698.1\|430802_432425_+	chaperonin GroL	A0A240F766	uncultured_virus	4.4e-157	54.0
AUI75699.1\|432584_435182_+	DNA mismatch repair protein MutS	F2QAF7	Pyramimonas_orientalis_virus	4.6e-39	25.2
AUI75700.1\|435181_437092_+	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	5.8e-55	29.7
AUI75701.1\|437092_437683_+	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
AUI75702.1\|437731_438748_+	Holliday junction DNA helicase RuvB	B3GAM6	uncultured_virus	7.4e-09	32.5
AUI75703.1\|438806_439232_+	preprotein translocase subunit YajC	NA	NA	NA	NA
AUI75704.1\|439367_440819_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	3.3e-63	32.4
AUI75705.1\|440811_441933_+	DNA polymerase IV	A0A1P8CWP4	Bacillus_phage	3.1e-16	24.5
AUI75706.1\|441992_442949_+	hypothetical protein	NA	NA	NA	NA
AUI75707.1\|442941_444303_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.4e-49	32.2
AUI75708.1\|445110_446289_+\|transposase	transposase	NA	NA	NA	NA
AUI75709.1\|446437_446746_+	hypothetical protein	NA	NA	NA	NA
AUI75710.1\|447015_449655_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.1e-63	33.0
AUI75711.1\|449715_449973_+	hypothetical protein	NA	NA	NA	NA
AUI75712.1\|449972_450401_+	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
AUI75713.1\|450402_450714_+	hypothetical protein	NA	NA	NA	NA
AUI75714.1\|450777_453135_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	9.7e-20	48.7
AUI75715.1\|453235_453547_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	3.8e-17	42.7
AUI75716.1\|453586_453964_-	mechanosensitive ion channel protein MscL	NA	NA	NA	NA
AUI75717.1\|454034_454892_-\|transposase	transposase	NA	NA	NA	NA
AUI75718.1\|454960_456355_-	hypothetical protein	A0A1B1P773	Bacillus_phage	4.4e-52	43.0
AUI75719.1\|456507_456921_-	hypothetical protein	NA	NA	NA	NA
AUI75720.1\|456997_457801_+	glutamate racemase	NA	NA	NA	NA
AUI75721.1\|457800_458421_+	non-canonical purine NTP pyrophosphatase	A0A2P1DNP2	Cassava_brown_streak_virus	8.8e-13	34.0
AUI75722.1\|458699_459926_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.1e-64	37.9
AUI75723.1\|460166_461426_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	2.9e-10	21.1
AUI75724.1\|461593_462445_-	mechanosensitive ion channel	NA	NA	NA	NA
AUI75725.1\|462578_463004_+	chemotaxis protein	NA	NA	NA	NA
AUI75726.1\|463021_463393_+	hypothetical protein	NA	NA	NA	NA
AUI75727.1\|463458_464565_-	dipeptidase	NA	NA	NA	NA
AUI75728.1\|464711_465713_+	catabolite control protein A	C6ZCU4	Enterobacteria_phage	1.1e-20	26.3
AUI75729.1\|465791_466970_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

522397 : 649497

117

Bacillus_phage(19.23%)

transposase,integrase,bacteriocin,tRNA

attL 573897:573940|attR 635071:635114

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI75770.1\|522397_524083_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	6.0e-72	31.4
AUI75771.1\|524193_525105_+	fructose-bisphosphate aldolase	NA	NA	NA	NA
AUI75772.1\|525177_525696_+	DNA mismatch repair protein MutT	NA	NA	NA	NA
AUI75773.1\|525698_525968_+	hypothetical protein	NA	NA	NA	NA
AUI75774.1\|526115_526388_+	hypothetical protein	NA	NA	NA	NA
AUI75775.1\|526377_526989_+	hypothetical protein	NA	NA	NA	NA
AUI75776.1\|529150_529951_-	multidrug transporter	NA	NA	NA	NA
AUI75777.1\|529931_530408_-	hypothetical protein	NA	NA	NA	NA
AUI75778.1\|530551_531730_-\|transposase	transposase	NA	NA	NA	NA
AUI75779.1\|531851_532106_-	hypothetical protein	NA	NA	NA	NA
AUI75780.1\|532105_532300_-	hypothetical protein	NA	NA	NA	NA
AUI75781.1\|532504_533683_+\|transposase	transposase	NA	NA	NA	NA
AUI75782.1\|533752_533974_+	hypothetical protein	NA	NA	NA	NA
AUI75783.1\|534103_534373_+	transcriptional regulator	NA	NA	NA	NA
AUI75784.1\|534539_534794_+	AbrB family toxin-antitoxin system antitoxin	NA	NA	NA	NA
AUI75785.1\|534858_535173_+	transcriptional regulator	NA	NA	NA	NA
AUI75786.1\|536872_537094_+	hypothetical protein	NA	NA	NA	NA
AUI75787.1\|537441_537861_-	DDE endonuclease	NA	NA	NA	NA
AUI75788.1\|538003_538489_-	hypothetical protein	NA	NA	NA	NA
AUI75789.1\|538631_539471_+	fatty acid-binding protein DegV	NA	NA	NA	NA
AUI75790.1\|539784_539967_+	hypothetical protein	NA	NA	NA	NA
AUI75791.1\|539963_540662_+	hypothetical protein	NA	NA	NA	NA
AUI77118.1\|542090_542606_+	hypothetical protein	NA	NA	NA	NA
AUI75792.1\|542602_542785_+	alpha/beta hydrolase	NA	NA	NA	NA
AUI75793.1\|542795_543614_+	triphosphoribosyl-dephospho-CoA synthase	NA	NA	NA	NA
AUI75794.1\|543664_543994_+	hypothetical protein	NA	NA	NA	NA
AUI75795.1\|544057_544810_-	aquaporin	M1H4F4	Acanthocystis_turfacea_Chlorella_virus	1.4e-25	30.7
AUI75796.1\|545866_546013_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
AUI75797.1\|546678_547857_-\|transposase	transposase	NA	NA	NA	NA
AUI75798.1\|548378_550436_+	carboxypeptidase	NA	NA	NA	NA
AUI75799.1\|550456_550807_+	hypothetical protein	NA	NA	NA	NA
AUI75800.1\|550815_552036_+	phosphoesterase	NA	NA	NA	NA
AUI75801.1\|552016_554518_+	DNA repair protein	NA	NA	NA	NA
AUI75802.1\|554510_555488_+	3'-5' exonuclease	NA	NA	NA	NA
AUI75803.1\|555530_555953_-	hypothetical protein	NA	NA	NA	NA
AUI75804.1\|556091_556994_-	peptidylprolyl isomerase	NA	NA	NA	NA
AUI75805.1\|557111_557447_-	hypothetical protein	NA	NA	NA	NA
AUI75806.1\|557456_557894_-	diadenosine tetraphosphate hydrolase	NA	NA	NA	NA
AUI75807.1\|558105_558372_+	addiction module toxin RelE	NA	NA	NA	NA
AUI75808.1\|558388_558724_+	addiction module antidote protein, HigA family	NA	NA	NA	NA
AUI75809.1\|558738_559482_+	multidrug ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-18	29.6
AUI75810.1\|559474_560662_+	ABC transporter permease	NA	NA	NA	NA
AUI75811.1\|560673_561327_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
AUI75812.1\|561397_561718_+	thiol reductase thioredoxin	NA	NA	NA	NA
AUI75813.1\|561737_562385_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA
AUI75814.1\|562436_563744_-	hypothetical protein	NA	NA	NA	NA
AUI75815.1\|565445_565643_+	hypothetical protein	NA	NA	NA	NA
AUI75816.1\|565750_566359_+	resolvase	A0A1V0SJI5	Klosneuvirus	5.2e-34	42.0
AUI75817.1\|566388_567714_+\|transposase	transposase	G3MB42	Bacillus_virus	7.3e-57	36.3
AUI77119.1\|568078_568465_+	permease	NA	NA	NA	NA
AUI75818.1\|568802_573773_+	peptidase S8	A0A1B0T6A2	Bacillus_phage	3.1e-15	32.8
573897:573940	attL	NA	NA	NA	NA
AUI75819.1\|573939_575217_-\|transposase	transposase	Q6V7R1	Burkholderia_virus	1.3e-10	23.4
AUI75820.1\|575530_576766_-	hypothetical protein	A0A1B1P773	Bacillus_phage	9.8e-56	47.3
AUI75821.1\|576821_577466_-	hypothetical protein	NA	NA	NA	NA
AUI75822.1\|577500_578133_-	aggregation promoting protein	A0A0E3XCL7	Enterococcus_phage	4.1e-18	62.2
AUI75823.1\|578705_579158_+	hypothetical protein	NA	NA	NA	NA
AUI75824.1\|579312_580626_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AUI75825.1\|580680_581658_-	cell surface protein	NA	NA	NA	NA
AUI75826.1\|581746_583261_-	aminopeptidase	NA	NA	NA	NA
AUI75827.1\|583398_584376_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AUI75828.1\|584754_585933_+\|transposase	transposase	NA	NA	NA	NA
AUI75829.1\|586162_586477_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUI75830.1\|586494_587376_+	hypothetical protein	NA	NA	NA	NA
AUI75831.1\|587653_588832_-\|transposase	transposase	NA	NA	NA	NA
AUI75832.1\|590444_591806_+	hypothetical protein	NA	NA	NA	NA
AUI75833.1\|591941_595418_+	restriction endonuclease	A0A1B1IUC6	uncultured_Mediterranean_phage	4.6e-26	23.3
AUI75834.1\|595417_598912_+	hypothetical protein	A0A2K5B2B9	Erysipelothrix_phage	1.6e-31	23.7
AUI75835.1\|599285_599816_+	hypothetical protein	NA	NA	NA	NA
AUI75836.1\|599922_601743_+	fumarate reductase	M1HTN0	Paramecium_bursaria_Chlorella_virus	4.9e-11	23.0
AUI75837.1\|601755_602172_+	hypothetical protein	NA	NA	NA	NA
AUI75838.1\|602128_602914_+	hypothetical protein	NA	NA	NA	NA
AUI75839.1\|602906_603587_+	hypothetical protein	A0A2P0ZL82	Lactobacillus_phage	9.7e-05	33.0
AUI75840.1\|603604_605080_+	fumarate reductase	A0A2P0ZL82	Lactobacillus_phage	1.2e-20	24.2
AUI75841.1\|607052_607520_+	hypothetical protein	NA	NA	NA	NA
AUI75842.1\|607568_608618_-\|integrase	integrase	H7BWC8	unidentified_phage	6.0e-46	35.1
AUI75843.1\|609091_611755_+	DNA polymerase I	F8WQ35	Bacillus_phage	2.9e-60	31.0
AUI75844.1\|611763_612594_+	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	7.1e-18	25.9
AUI75845.1\|612590_613193_+	dephospho-CoA kinase	NA	NA	NA	NA
AUI75846.1\|613195_613663_+	transcriptional regulator NrdR	NA	NA	NA	NA
AUI75847.1\|613665_614997_+	chromosome replication initiation protein	NA	NA	NA	NA
AUI75848.1\|615028_615937_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	9.2e-27	28.1
AUI75849.1\|616227_618162_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.6e-97	33.4
AUI75850.1\|618319_618841_+	hypothetical protein	NA	NA	NA	NA
AUI75851.1\|618992_619523_+	hypothetical protein	NA	NA	NA	NA
AUI75852.1\|619713_620322_+	resolvase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
AUI75853.1\|620351_621677_+\|transposase	transposase	G3MB42	Bacillus_virus	8.1e-56	36.0
AUI75854.1\|622860_623154_+	hypothetical protein	NA	NA	NA	NA
AUI75855.1\|623160_624411_+	hypothetical protein	NA	NA	NA	NA
AUI77120.1\|624508_624790_+	hypothetical protein	NA	NA	NA	NA
AUI77121.1\|624957_626196_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AUI75856.1\|626440_626920_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.0e-13	38.7
AUI75857.1\|626941_627142_+	50S ribosomal protein L35	NA	NA	NA	NA
AUI75858.1\|627185_627542_+	50S ribosomal protein L20	NA	NA	NA	NA
AUI75859.1\|627687_628212_+	HAD family hydrolase	NA	NA	NA	NA
AUI75860.1\|628204_629314_+	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
AUI75861.1\|629324_629981_+	nicotinate (nicotinamide) nucleotide adenylyltransferase	NA	NA	NA	NA
AUI75862.1\|629961_630555_+	HD domain-containing protein	NA	NA	NA	NA
AUI75863.1\|630576_630924_+	ribosome silencing factor	NA	NA	NA	NA
AUI75864.1\|630929_632081_+	hypothetical protein	NA	NA	NA	NA
AUI75865.1\|632082_632637_+	DNA-binding protein	NA	NA	NA	NA
AUI75866.1\|632799_633516_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.8e-25	30.1
AUI75867.1\|633502_635062_+	two-component sensor histidine kinase	NA	NA	NA	NA
AUI75868.1\|635164_636529_+	SlpX	NA	NA	NA	NA
635071:635114	attR	NA	NA	NA	NA
AUI75869.1\|637148_638459_-\|transposase	transposase	Q6V7R1	Burkholderia_virus	8.6e-10	23.5
AUI75870.1\|638541_639720_+\|transposase	transposase	NA	NA	NA	NA
AUI75871.1\|639981_640470_-\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
AUI75872.1\|640517_641486_-	insertase	NA	NA	NA	NA
AUI75873.1\|641532_641805_-	acylphosphatase	NA	NA	NA	NA
AUI75874.1\|641902_642670_+	rRNA methyltransferase	NA	NA	NA	NA
AUI75875.1\|642781_643132_+	MarR family transcriptional regulator	NA	NA	NA	NA
AUI75876.1\|643416_644466_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	5.3e-34	37.3
AUI75877.1\|644469_646884_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AUI75878.1\|646960_647437_+	transcription elongation factor GreA	NA	NA	NA	NA
AUI75879.1\|647499_648414_+	L-lactate dehydrogenase	NA	NA	NA	NA
AUI77122.1\|648535_648943_+	addiction module toxin RelE	NA	NA	NA	NA
AUI75880.1\|648935_649208_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUI75881.1\|649266_649497_-\|transposase	transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.0e-11	55.9

DBSCAN-SWA_6

657422 : 773917

Bacillus_virus(14.29%)

transposase,integrase,protease,tRNA

attL 647848:647863|attR 770951:771030

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
647848:647863	attL	NA	NA	NA	NA
AUI75888.1\|657422_658103_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
647848:647863	attL	NA	NA	NA	NA
AUI75889.1\|658103_658331_+	hypothetical protein	NA	NA	NA	NA
AUI75890.1\|658389_658791_+	sulfurtransferase	NA	NA	NA	NA
AUI75891.1\|658869_659790_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AUI75892.1\|659854_660274_+	DDE endonuclease	NA	NA	NA	NA
AUI75893.1\|660345_660660_+\|transposase	transposase	NA	NA	NA	NA
AUI75894.1\|661550_662888_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AUI75895.1\|663999_664905_+	ABC transporter	NA	NA	NA	NA
AUI77123.1\|665005_666019_+	hypothetical protein	NA	NA	NA	NA
AUI75896.1\|666085_666955_-\|integrase	integrase	A0A1B1P773	Bacillus_phage	6.5e-46	41.8
AUI75897.1\|667595_668588_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.3e-52	38.4
AUI75898.1\|668692_669649_-	beta-galactosidase	NA	NA	NA	NA
AUI75899.1\|669632_671519_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	3.1e-93	33.5
AUI75900.1\|672718_673726_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUI77124.1\|673835_674099_+	lactose permease	NA	NA	NA	NA
AUI75901.1\|674312_674642_+	hypothetical protein	NA	NA	NA	NA
AUI75902.1\|674687_675176_+	hypothetical protein	NA	NA	NA	NA
AUI75903.1\|675154_675775_+	hypothetical protein	NA	NA	NA	NA
AUI75904.1\|676039_677956_+	phosphotransferase enzyme IIA component	NA	NA	NA	NA
AUI75905.1\|679185_680421_-	hypothetical protein	A0A1B1P773	Bacillus_phage	2.2e-55	46.9
AUI75906.1\|681888_683034_+	MFS transporter	NA	NA	NA	NA
AUI75907.1\|684188_685850_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
683064:683079	attR	NA	NA	NA	NA
AUI75908.1\|685860_686349_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.8e-22	45.1
683064:683079	attR	NA	NA	NA	NA
AUI75909.1\|686341_687478_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AUI75910.1\|687675_688392_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SPE1	Cyanophage	9.7e-40	39.1
AUI75911.1\|688391_688643_+	phosphoribosylformylglycinamidine synthase, purS protein	NA	NA	NA	NA
AUI75912.1\|688642_689314_+	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
AUI75913.1\|689310_691542_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	7.8e-144	38.9
AUI75914.1\|691517_692951_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-61	35.1
AUI75915.1\|692982_694032_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	9.2e-63	43.9
AUI77125.1\|694622_696164_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.8e-75	46.6
AUI75916.1\|696176_697433_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AUI75917.1\|697520_698699_-\|transposase	transposase	NA	NA	NA	NA
AUI75918.1\|699011_700289_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	1.8e-12	21.7
AUI75919.1\|701813_702653_+	RpiR family transcriptional regulator	NA	NA	NA	NA
AUI75920.1\|702683_703640_-	sugar ABC transporter permease	NA	NA	NA	NA
AUI75921.1\|703629_704793_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUI75922.1\|704773_706318_-	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-14	26.9
AUI75923.1\|706386_707472_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.2e-77	49.3
AUI77126.1\|707589_707811_-	hypothetical protein	NA	NA	NA	NA
AUI75924.1\|708306_709896_+	ABC transporter	G9BWD6	Planktothrix_phage	1.5e-11	29.7
AUI75925.1\|712219_713449_+	MFS transporter	NA	NA	NA	NA
AUI75926.1\|713521_715396_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AUI75927.1\|719640_720819_+\|transposase	transposase	NA	NA	NA	NA
AUI75928.1\|721271_722438_+	galactokinase	NA	NA	NA	NA
AUI75929.1\|722459_723923_+	galactose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AUI75930.1\|724043_725039_+	galactose mutarotase	NA	NA	NA	NA
AUI75931.1\|725159_725600_+	hypothetical protein	NA	NA	NA	NA
AUI75932.1\|725834_726536_+\|transposase	transposase	NA	NA	NA	NA
AUI75933.1\|728399_729572_+	MFS transporter permease	NA	NA	NA	NA
AUI75934.1\|729590_729998_+	hypothetical protein	NA	NA	NA	NA
AUI75935.1\|730017_730722_+	oxidoreductase	NA	NA	NA	NA
AUI75936.1\|731695_732973_+\|transposase	transposase	Q6V7R1	Burkholderia_virus	2.9e-10	23.4
AUI75937.1\|734248_734755_-	hypothetical protein	NA	NA	NA	NA
AUI75938.1\|734935_736387_+	hypothetical protein	NA	NA	NA	NA
AUI75939.1\|737865_739044_-\|transposase	transposase	NA	NA	NA	NA
AUI75940.1\|739266_739686_-	hypothetical protein	NA	NA	NA	NA
AUI75941.1\|739916_741095_+\|transposase	transposase	NA	NA	NA	NA
AUI75942.1\|741133_741343_-	hypothetical protein	NA	NA	NA	NA
AUI75943.1\|744801_745209_-	hypothetical protein	NA	NA	NA	NA
AUI75944.1\|747685_747928_-	hypothetical protein	NA	NA	NA	NA
AUI75945.1\|747949_748339_-	hypothetical protein	NA	NA	NA	NA
AUI75946.1\|748493_748820_-	DNA methyltransferase	NA	NA	NA	NA
AUI75947.1\|748821_749706_-	L-serine dehydratase, iron-sulfur-dependent subunit alpha	NA	NA	NA	NA
AUI75948.1\|749720_750383_-	serine dehydratase	NA	NA	NA	NA
AUI75949.1\|750915_751212_+	hypothetical protein	NA	NA	NA	NA
AUI75950.1\|751352_752402_-\|integrase	integrase	H7BWC8	unidentified_phage	4.6e-46	34.3
AUI75951.1\|752546_753776_+	MFS transporter	NA	NA	NA	NA
AUI75952.1\|754027_754240_+\|transposase	transposase	NA	NA	NA	NA
AUI75953.1\|754312_754660_+	hypothetical protein	NA	NA	NA	NA
AUI75954.1\|754699_755209_+	hypothetical protein	NA	NA	NA	NA
AUI75955.1\|755551_757303_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI75956.1\|757401_757569_+	quaternary ammonium transporter	NA	NA	NA	NA
AUI75957.1\|757956_758190_-	hypothetical protein	NA	NA	NA	NA
AUI75958.1\|758342_759002_+	polar amino acid ABC transporter permease	NA	NA	NA	NA
AUI75959.1\|758982_759657_+	amino acid ABC transporter permease	NA	NA	NA	NA
AUI75960.1\|759666_760407_+	glutamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.1e-25	30.8
AUI75961.1\|760419_761280_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI75962.1\|761326_761623_-	DNA methyltransferase	NA	NA	NA	NA
AUI75963.1\|761639_761954_-\|transposase	transposase	NA	NA	NA	NA
AUI75964.1\|762025_762445_-	DDE endonuclease	NA	NA	NA	NA
AUI75965.1\|762463_765802_+	hypothetical protein	NA	NA	NA	NA
AUI75966.1\|767347_767956_+	resolvase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
AUI75967.1\|767985_769311_+\|transposase	transposase	G3MB42	Bacillus_virus	8.1e-56	36.0
AUI75968.1\|769682_770915_+	MFS transporter	NA	NA	NA	NA
AUI75969.1\|771190_772417_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.1e-64	38.1
AUI75970.1\|772657_773917_-\|transposase	transposase	A0A2D1GQC1	Lysinibacillus_phage	2.4e-09	21.1

DBSCAN-SWA_7

858334 : 921517

Streptococcus_phage(11.11%)

transposase,integrase,protease,tRNA

attL 878276:878290|attR 923376:923390

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI77130.1\|858334_858766_+\|transposase	transposase	W5R8L2	Staphylococcus_phage	4.2e-14	34.9
AUI76040.1\|858880_859222_+	transcriptional regulator	NA	NA	NA	NA
AUI76041.1\|859226_860657_+	signal recognition particle protein	NA	NA	NA	NA
AUI76042.1\|860748_861021_+	30S ribosomal protein S16	NA	NA	NA	NA
AUI76043.1\|861089_861605_+	ribosome maturation factor RimM	NA	NA	NA	NA
AUI76044.1\|861594_862314_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AUI76045.1\|862426_862774_+	50S ribosomal protein L19	NA	NA	NA	NA
AUI76046.1\|863162_863822_+	uracil-DNA glycosylase	A0A218MKQ4	uncultured_virus	2.8e-09	30.9
AUI76047.1\|863814_864600_+	acyl-CoA thioesterase	NA	NA	NA	NA
AUI76048.1\|864628_865255_-	repressor LexA	A0A1B2APZ1	Phage_Wrath	8.9e-13	53.6
AUI77131.1\|865420_865669_+	hypothetical protein	NA	NA	NA	NA
AUI76049.1\|865731_865950_+	hypothetical protein	NA	NA	NA	NA
AUI76050.1\|866110_867388_-\|transposase	transposase	Q6V7R1	Burkholderia_virus	4.5e-11	23.7
AUI76051.1\|867662_869606_+	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	3.6e-60	28.2
AUI76052.1\|869663_870845_-	cyclopropane-fatty-acyl-phospholipid synthase	A0A2K9L4K8	Tupanvirus	4.7e-47	36.1
AUI76053.1\|870904_871519_-	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
AUI76054.1\|871584_872616_+	methyltransferase	NA	NA	NA	NA
AUI76055.1\|872777_873551_+	30S ribosomal protein S2	NA	NA	NA	NA
AUI76056.1\|873584_874610_+	translation elongation factor Ts	NA	NA	NA	NA
AUI76057.1\|874748_875474_+	UMP kinase	NA	NA	NA	NA
AUI76058.1\|875473_876031_+	ribosome recycling factor	NA	NA	NA	NA
AUI76059.1\|876033_876768_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.0e-23	39.7
AUI76060.1\|876769_877585_+	CDP-diglyceride synthetase	NA	NA	NA	NA
AUI76061.1\|877595_878852_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
878276:878290	attL	NA	NA	NA	NA
AUI76062.1\|878894_880592_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AUI76063.1\|880597_884914_+	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	1.2e-18	34.1
AUI76064.1\|885023_885500_+	ribosome maturation factor RimP	NA	NA	NA	NA
AUI77132.1\|885519_886701_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AUI77133.1\|886730_887006_+	DNA-binding protein	NA	NA	NA	NA
AUI76065.1\|887008_887320_+	50S ribosomal protein L7	NA	NA	NA	NA
AUI76066.1\|887324_889937_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.7e-21	24.5
AUI76067.1\|889956_890322_+	ribosome-binding factor A	NA	NA	NA	NA
AUI76068.1\|890373_891267_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AUI76069.1\|891272_892235_+	riboflavin biosynthesis protein RibF	A0A1V0SD03	Indivirus	6.1e-05	30.1
AUI76070.1\|892404_893454_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AUI76071.1\|893469_894069_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
AUI76072.1\|894086_895913_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.8e-143	49.5
AUI76073.1\|895994_897149_+	molecular chaperone DnaJ	A0A167RAM8	Powai_lake_megavirus	1.4e-19	29.0
AUI76074.1\|898592_900431_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	4.0e-21	24.1
AUI76075.1\|900433_901123_+	class A sortase	NA	NA	NA	NA
AUI76076.1\|901243_903517_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	3.7e-77	35.9
AUI76077.1\|903621_904149_+	adenine phosphoribosyltransferase	NA	NA	NA	NA
AUI76078.1\|904292_905222_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	2.2e-100	59.5
AUI77134.1\|905237_905996_-	homoserine O-succinyltransferase	NA	NA	NA	NA
AUI76079.1\|907788_908286_+	lactocepin S-layer protein	NA	NA	NA	NA
AUI76080.1\|908353_910627_-	proton-efflux P-type ATPase	A7IUR5	Paramecium_bursaria_Chlorella_virus	1.6e-43	25.3
AUI76081.1\|910755_911610_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUI76082.1\|912684_913875_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.3e-124	58.2
AUI76083.1\|916334_916871_+	holo-ACP synthase CitX	NA	NA	NA	NA
AUI76084.1\|917120_918299_+\|transposase	transposase	NA	NA	NA	NA
AUI76085.1\|918370_919537_+	GNAT family acetyltransferase	NA	NA	NA	NA
AUI76086.1\|919716_920322_+	transcriptional regulator	NA	NA	NA	NA
AUI76087.1\|920488_921517_+\|integrase	integrase	H7BWC8	unidentified_phage	4.1e-47	34.6
923376:923390	attR	NA	NA	NA	NA

DBSCAN-SWA_8

963091 : 1019211

Bacillus_phage(11.76%)

transposase,integrase,tRNA

attL 963158:963173|attR 1021624:1021639

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76123.1\|963091_964390_+\|tRNA	asparagine--tRNA ligase	M1PB22	Moumouvirus	2.3e-47	27.8
963158:963173	attL	NA	NA	NA	NA
AUI76124.1\|964475_965120_+	DNA replication protein DnaD	A0A0N7AE27	Bacillus_phage	4.2e-10	36.0
AUI76125.1\|965121_965742_+	endonuclease III	NA	NA	NA	NA
AUI76126.1\|965957_968237_-	penicillin-binding protein	NA	NA	NA	NA
AUI76127.1\|968233_968866_-	Holliday junction resolvase RecU	A0A1B1P798	Bacillus_phage	6.0e-17	30.6
AUI76128.1\|968929_969499_+	hypothetical protein	NA	NA	NA	NA
AUI76129.1\|969589_970006_+	cell division protein	NA	NA	NA	NA
AUI77137.1\|970469_971594_+	RNA methyltransferase	NA	NA	NA	NA
AUI76130.1\|972842_973175_+	hypothetical protein	NA	NA	NA	NA
AUI76131.1\|973171_974848_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
AUI76132.1\|974854_975319_+	signal peptidase II	NA	NA	NA	NA
AUI76133.1\|975311_976223_+	pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.0e-09	29.1
AUI76134.1\|976225_977281_+	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
AUI76135.1\|977284_980476_+	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
AUI76136.1\|980543_982238_-	hypothetical protein	Q84500	Paramecium_bursaria_Chlorella_virus	3.2e-09	40.0
AUI76137.1\|982445_983852_+\|transposase	transposase	NA	NA	NA	NA
AUI76138.1\|983993_984410_+	MarR family transcriptional regulator	NA	NA	NA	NA
AUI76139.1\|984485_985367_+	fatty acid-binding protein DegV	A0A0N9SI50	Staphylococcus_phage	4.4e-10	35.9
AUI76140.1\|985569_986652_-	tyrosine recombinase XerS	NA	NA	NA	NA
AUI76141.1\|987166_987622_+	hypothetical protein	NA	NA	NA	NA
AUI76142.1\|987628_988120_+	adenylate kinase	A0A097BYE2	Leuconostoc_phage	5.0e-19	36.1
AUI76143.1\|988165_988774_-	DUF5052 domain-containing protein	A0A2K9VCV0	Lactobacillus_phage	1.8e-39	44.2
AUI76144.1\|989102_990281_+\|transposase	transposase	NA	NA	NA	NA
AUI76145.1\|992453_992807_+	transcriptional regulator	NA	NA	NA	NA
AUI76146.1\|992837_993422_-	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	8.2e-29	44.6
AUI76147.1\|993506_994442_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
AUI76148.1\|994496_995459_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AUI76149.1\|995609_998066_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.0e-96	31.3
AUI76150.1\|998082_1000029_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.7e-116	41.0
AUI76151.1\|1000125_1000752_+	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
AUI76152.1\|1001057_1002275_-	hypothetical protein	A0A0K0N6W5	Gordonia_phage	4.0e-33	28.5
AUI76153.1\|1002402_1002870_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
AUI76154.1\|1002958_1003477_-	GCN5 family acetyltransferase	NA	NA	NA	NA
AUI76155.1\|1003690_1004551_+	Sir2 silent information regulator family NAD-dependent deacetylase	NA	NA	NA	NA
AUI76156.1\|1005287_1005878_+	Sir2 silent information regulator family NAD-dependent deacetylase	NA	NA	NA	NA
AUI76157.1\|1006547_1006787_-	hypothetical protein	NA	NA	NA	NA
AUI76158.1\|1006942_1007701_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AUI76159.1\|1007852_1008203_-	hypothetical protein	NA	NA	NA	NA
AUI76160.1\|1008199_1009033_-	hydrolase	NA	NA	NA	NA
AUI76161.1\|1009190_1009658_-	GCN5 family acetyltransferase	NA	NA	NA	NA
AUI76162.1\|1009721_1011062_+	glutathione reductase	NA	NA	NA	NA
AUI76163.1\|1011359_1011638_+	sodium:proton antiporter	NA	NA	NA	NA
AUI76164.1\|1011894_1012515_-\|integrase	integrase	E2ELN7	Clostridium_phage	7.4e-20	36.4
AUI76165.1\|1012630_1013269_-	hypothetical protein	NA	NA	NA	NA
AUI76166.1\|1013580_1014081_-	DNA methyltransferase	A0A1S5PRR3	Streptococcus_phage	1.6e-33	45.4
AUI77138.1\|1014192_1015113_-\|integrase	integrase	A0A0C5AC89	Paenibacillus_phage	1.6e-34	39.2
AUI76167.1\|1015193_1015481_-\|transposase	transposase	A0A0C5AJ29	Paenibacillus_phage	2.7e-09	45.1
AUI76168.1\|1015462_1015822_-	hypothetical protein	NA	NA	NA	NA
AUI76169.1\|1016043_1016904_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI77139.1\|1016915_1017656_-	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-33	35.2
AUI76170.1\|1017665_1018340_-	amino acid ABC transporter permease	NA	NA	NA	NA
AUI76171.1\|1018405_1018825_+	DDE endonuclease	NA	NA	NA	NA
AUI76172.1\|1018896_1019211_+\|transposase	transposase	NA	NA	NA	NA
1021624:1021639	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1026355 : 1092198

Erysipelothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76181.1\|1026355_1026670_+\|transposase	transposase	NA	NA	NA	NA
AUI76182.1\|1026843_1027497_+	endonuclease III	NA	NA	NA	NA
AUI76183.1\|1027668_1029381_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	3.0e-87	36.7
AUI76184.1\|1029366_1029642_-	hypothetical protein	NA	NA	NA	NA
AUI76185.1\|1029819_1030257_+	LytTR family transcriptional regulator	NA	NA	NA	NA
AUI76186.1\|1030258_1030672_+	hypothetical protein	NA	NA	NA	NA
AUI76187.1\|1030707_1031205_-	acetyltransferase	NA	NA	NA	NA
AUI76188.1\|1031208_1032792_-	ATPase	NA	NA	NA	NA
AUI76189.1\|1032758_1032971_+	transcriptional regulator	NA	NA	NA	NA
AUI76190.1\|1033006_1035745_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AUI76191.1\|1036373_1036688_+\|transposase	transposase	NA	NA	NA	NA
AUI76192.1\|1037938_1039342_+	dipeptidase PepV	NA	NA	NA	NA
AUI76193.1\|1040697_1042077_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
AUI76194.1\|1042459_1042795_-	hypothetical protein	NA	NA	NA	NA
AUI76195.1\|1043823_1044063_-	hypothetical protein	NA	NA	NA	NA
AUI76196.1\|1044251_1045442_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.0e-126	59.0
AUI76197.1\|1045594_1046146_-	hypothetical protein	NA	NA	NA	NA
AUI76198.1\|1046280_1046511_-	replication-associated protein RepA	NA	NA	NA	NA
AUI76199.1\|1046674_1047208_-	hypoxanthine phosphoribosyltransferase	NA	NA	NA	NA
AUI76200.1\|1048802_1049000_-	hypothetical protein	A0A2K5B2C5	Erysipelothrix_phage	2.7e-16	74.5
AUI77140.1\|1049066_1050314_-	DNA replication initiation protein	NA	NA	NA	NA
AUI77141.1\|1051778_1052681_-	homocysteine S-methyltransferase	NA	NA	NA	NA
AUI76201.1\|1053021_1054209_-	amidohydrolase	NA	NA	NA	NA
AUI76202.1\|1054906_1056253_-	serine/threonine protein kinase	NA	NA	NA	NA
AUI76203.1\|1056534_1056900_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AUI76204.1\|1057078_1059025_+	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	3.0e-59	28.8
AUI76205.1\|1062383_1062803_-	DDE endonuclease	NA	NA	NA	NA
AUI76206.1\|1062821_1063055_+	hypothetical protein	NA	NA	NA	NA
AUI76207.1\|1069764_1070481_+	peptidylprolyl isomerase	NA	NA	NA	NA
AUI76208.1\|1072863_1074042_-\|transposase	transposase	NA	NA	NA	NA
AUI77142.1\|1074207_1077930_-	ATPase	NA	NA	NA	NA
AUI76209.1\|1077942_1078542_-	ATP-binding protein	NA	NA	NA	NA
AUI76210.1\|1078541_1079147_-	hypothetical protein	NA	NA	NA	NA
AUI76211.1\|1079264_1081232_-	hypothetical protein	NA	NA	NA	NA
AUI76212.1\|1082855_1083485_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AUI76213.1\|1083503_1084055_-	DNA-binding protein	NA	NA	NA	NA
AUI76214.1\|1084054_1084285_-	copper-binding protein	NA	NA	NA	NA
AUI76215.1\|1084307_1086209_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.1e-89	34.5
AUI76216.1\|1086326_1086677_-	hypothetical protein	NA	NA	NA	NA
AUI76217.1\|1086673_1086880_-	hypothetical protein	NA	NA	NA	NA
AUI76218.1\|1087110_1088475_-	NAD(FAD)-dependent dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.4e-09	22.6
AUI76219.1\|1088606_1088993_-	FMN-binding protein	NA	NA	NA	NA
AUI76220.1\|1089065_1089998_-	transcriptional regulator	NA	NA	NA	NA
AUI76221.1\|1090101_1091280_-\|transposase	transposase	NA	NA	NA	NA
AUI76222.1\|1091461_1091920_+	hypothetical protein	NA	NA	NA	NA
AUI76223.1\|1091934_1092198_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1097370 : 1152474

Streptococcus_phage(20.0%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76230.1\|1097370_1098549_-\|transposase	transposase	NA	NA	NA	NA
AUI76231.1\|1099332_1099785_-\|transposase	transposase	NA	NA	NA	NA
AUI76232.1\|1099996_1100713_-	antibiotic transporter permease	NA	NA	NA	NA
AUI76233.1\|1100712_1101447_-	multidrug ABC transporter permease	NA	NA	NA	NA
AUI76234.1\|1101450_1102212_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	34.7
AUI76235.1\|1102223_1102697_-	hypothetical protein	NA	NA	NA	NA
AUI76236.1\|1102711_1102960_-	hypothetical protein	NA	NA	NA	NA
AUI76237.1\|1102952_1104557_-	ABC transporter permease	A0A2H4UU96	Bodo_saltans_virus	5.1e-12	29.4
AUI76238.1\|1104531_1104819_-	hypothetical protein	NA	NA	NA	NA
AUI76239.1\|1105170_1105503_-	hypothetical protein	NA	NA	NA	NA
AUI76240.1\|1105581_1105896_-\|transposase	transposase	NA	NA	NA	NA
AUI76241.1\|1105967_1106387_-	DDE endonuclease	NA	NA	NA	NA
AUI76242.1\|1108134_1109250_-\|transposase	transposase	NA	NA	NA	NA
AUI76243.1\|1109554_1111069_-	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	3.5e-23	23.7
AUI76244.1\|1111386_1111611_+	hypothetical protein	NA	NA	NA	NA
AUI76245.1\|1111657_1113517_-	DNA mismatch repair protein MutS	F2Y1C6	Organic_Lake_phycodnavirus	1.5e-07	32.1
AUI76246.1\|1113728_1114157_-	hypothetical protein	NA	NA	NA	NA
AUI76247.1\|1114153_1114588_-	histidine kinase	NA	NA	NA	NA
AUI76248.1\|1114772_1115360_-	non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
AUI76249.1\|1115650_1115863_-	hypothetical protein	NA	NA	NA	NA
AUI76250.1\|1115946_1118451_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.2e-137	32.0
AUI76251.1\|1118466_1118979_-	streptothricin acetyltransferase	E4ZFP7	Streptococcus_phage	8.3e-17	30.2
AUI76252.1\|1119215_1119683_-	regulator	NA	NA	NA	NA
AUI76253.1\|1119880_1120180_-	hypothetical protein	NA	NA	NA	NA
AUI76254.1\|1121581_1121929_-	addiction module toxin RelE	NA	NA	NA	NA
AUI76255.1\|1121928_1122207_-	prevent-host-death family protein	NA	NA	NA	NA
AUI76256.1\|1126032_1126524_-	DUF5067 domain-containing protein	NA	NA	NA	NA
AUI76257.1\|1126633_1126993_-	hypothetical protein	NA	NA	NA	NA
AUI76258.1\|1127383_1128007_-	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AUI76259.1\|1128009_1128771_-	phosphorylase	NA	NA	NA	NA
AUI76260.1\|1128786_1129206_-	cytidine deaminase	NA	NA	NA	NA
AUI76261.1\|1129469_1129946_-	GNAT family acetyltransferase	NA	NA	NA	NA
AUI76262.1\|1130035_1130473_+	hypothetical protein	NA	NA	NA	NA
AUI76263.1\|1130652_1131831_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.3e-121	57.5
AUI76264.1\|1131941_1132652_+	GNAT family acetyltransferase	NA	NA	NA	NA
AUI76265.1\|1132740_1133922_+	permease	NA	NA	NA	NA
AUI76266.1\|1133987_1134569_+	hypothetical protein	NA	NA	NA	NA
AUI76267.1\|1134658_1135276_-	hypothetical protein	NA	NA	NA	NA
AUI76268.1\|1135538_1136084_-	hypothetical protein	NA	NA	NA	NA
AUI76269.1\|1136672_1137050_-	hypothetical protein	NA	NA	NA	NA
AUI76270.1\|1137062_1137803_-	hypothetical protein	NA	NA	NA	NA
AUI76271.1\|1137809_1139393_-	ABC transporter permease	A0A076FI99	Aureococcus_anophage	1.1e-19	26.5
AUI76272.1\|1139382_1140987_-\|bacteriocin	bacteriocin ABC transporter	A0A076FI99	Aureococcus_anophage	1.7e-15	21.6
AUI76273.1\|1141160_1141511_-	hypothetical protein	NA	NA	NA	NA
AUI76274.1\|1141813_1142053_-	hypothetical protein	NA	NA	NA	NA
AUI77143.1\|1142052_1142265_-	hypothetical protein	NA	NA	NA	NA
AUI76275.1\|1142270_1143557_-	peptidase T	NA	NA	NA	NA
AUI76276.1\|1143716_1145051_+	MATE family efflux transporter	NA	NA	NA	NA
AUI76277.1\|1145099_1146305_-	hypothetical protein	NA	NA	NA	NA
AUI76278.1\|1146477_1147656_-\|transposase	transposase	NA	NA	NA	NA
AUI76279.1\|1147941_1148658_-	ABC transporter	W6JKT0	Anomala_cuprea_entomopoxvirus	3.5e-13	28.6
AUI76280.1\|1149160_1150339_-\|transposase	transposase	NA	NA	NA	NA
AUI76281.1\|1150820_1151111_-	hypothetical protein	NA	NA	NA	NA
AUI76282.1\|1151295_1152474_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1393584 : 1448358

Lactobacillus_virus(18.18%)

transposase,integrase,tRNA

attL 1439558:1439580|attR 1445828:1445850

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76481.1\|1393584_1394763_-\|transposase	transposase	NA	NA	NA	NA
AUI76482.1\|1394963_1395296_-	DUF3397 domain-containing protein	NA	NA	NA	NA
AUI76483.1\|1395565_1396105_-	rod shape-determining protein MreD	NA	NA	NA	NA
AUI76484.1\|1396104_1396956_-	rod shape-determining protein MreC	NA	NA	NA	NA
AUI76485.1\|1397001_1398006_-	rod shape-determining protein	NA	NA	NA	NA
AUI76486.1\|1398101_1398725_-	DNA repair protein RadC	NA	NA	NA	NA
AUI76487.1\|1398763_1399441_-	hydrolase	NA	NA	NA	NA
AUI76488.1\|1399430_1400705_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AUI76489.1\|1400705_1403345_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.8e-161	43.4
AUI76490.1\|1405766_1407083_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.5e-65	38.9
AUI76491.1\|1407353_1408280_-	bactoprenol glucosyl transferase	V5USA4	Oenococcus_phage	1.7e-76	49.3
AUI76492.1\|1408276_1408693_-	dolichyl-phosphate beta-D-mannosyltransferase	NA	NA	NA	NA
AUI76493.1\|1411843_1412380_+	hypothetical protein	NA	NA	NA	NA
AUI76494.1\|1412868_1414086_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
AUI76495.1\|1414085_1415246_-	aminotransferase V	A0A1X6WFP1	Pacmanvirus	1.7e-38	31.7
AUI76496.1\|1415337_1417047_-	septation ring formation regulator EzrA	NA	NA	NA	NA
AUI76497.1\|1417169_1418348_-\|transposase	transposase	NA	NA	NA	NA
AUI76498.1\|1418709_1419321_+	30S ribosomal protein S4	NA	NA	NA	NA
AUI76499.1\|1419410_1419878_+	hypothetical protein	NA	NA	NA	NA
AUI76500.1\|1419877_1421191_+	recombinase RarA	A0A127AWE7	Bacillus_phage	6.2e-101	49.3
AUI76501.1\|1421329_1422736_+\|transposase	transposase	NA	NA	NA	NA
AUI76502.1\|1423097_1423379_+	hypothetical protein	NA	NA	NA	NA
AUI76503.1\|1423446_1423911_+	universal stress protein UspA	NA	NA	NA	NA
AUI76504.1\|1423976_1425170_-	rod shape-determining protein RodA	NA	NA	NA	NA
AUI76505.1\|1425191_1425419_-	hypothetical protein	NA	NA	NA	NA
AUI76506.1\|1425734_1426724_-	rod shape-determining protein	NA	NA	NA	NA
AUI76507.1\|1426807_1427038_-	hypothetical protein	NA	NA	NA	NA
AUI76508.1\|1427101_1427542_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
AUI76509.1\|1427553_1428993_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
AUI76510.1\|1429015_1429978_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
AUI76511.1\|1429988_1431500_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AUI76512.1\|1431514_1432063_-	ATP synthase F1 subunit delta	NA	NA	NA	NA
AUI76513.1\|1432062_1432572_-	ATP synthase F0 subunit B	NA	NA	NA	NA
AUI77150.1\|1432623_1432848_-	hypothetical protein	NA	NA	NA	NA
AUI76514.1\|1432876_1433590_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
AUI76515.1\|1433713_1434343_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AUI76516.1\|1434426_1435428_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.2e-48	38.1
AUI76517.1\|1435433_1436276_-	protein-(glutamine-N5) methyltransferase, release factor-specific	NA	NA	NA	NA
AUI76518.1\|1436268_1437357_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.4e-05	44.6
AUI76519.1\|1437373_1437973_-	thymidine kinase	C1KFH3	Lactobacillus_virus	2.4e-47	50.8
AUI76520.1\|1438123_1439476_+	UDP-N-acetylmuramyl peptide synthase	NA	NA	NA	NA
1439558:1439580	attL	NA	NA	NA	NA
AUI76521.1\|1439653_1440811_-\|integrase	integrase	P97010	Streptococcus_pyogenes_phage	4.9e-57	38.2
AUI76522.1\|1440949_1441537_-	hypothetical protein	NA	NA	NA	NA
AUI76523.1\|1441685_1441886_+	hypothetical protein	NA	NA	NA	NA
AUI76524.1\|1441888_1442113_+	hypothetical protein	NA	NA	NA	NA
AUI76525.1\|1442115_1442391_+	DNA-packaging protein	NA	NA	NA	NA
AUI77151.1\|1442715_1444032_+	hypothetical protein	U3PCP1	Lactobacillus_phage	9.1e-92	44.2
AUI76526.1\|1445132_1445498_-	hypothetical protein	NA	NA	NA	NA
AUI76527.1\|1446065_1447079_+	esterase	A0A1D8EXR7	Mycobacterium_phage	1.2e-06	26.1
1445828:1445850	attR	NA	NA	NA	NA
AUI76528.1\|1447179_1448358_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1454601 : 1591782

114

Streptococcus_phage(31.03%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76532.1\|1454601_1455792_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.0e-114	54.9
AUI76533.1\|1455884_1457342_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.6e-33	33.8
AUI76534.1\|1457341_1458064_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.6e-37	36.9
AUI76535.1\|1458063_1458456_-	hypothetical protein	NA	NA	NA	NA
AUI76536.1\|1458490_1459456_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
AUI76537.1\|1462098_1463283_-	acetate kinase	NA	NA	NA	NA
AUI76538.1\|1463331_1464333_-	DNA methyltransferase	NA	NA	NA	NA
AUI76539.1\|1464502_1465003_-	competence protein ComGF	NA	NA	NA	NA
AUI76540.1\|1465010_1465280_-	hypothetical protein	NA	NA	NA	NA
AUI76541.1\|1465276_1465708_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
AUI76542.1\|1465676_1466027_-	competence protein ComGC	NA	NA	NA	NA
AUI77152.1\|1466037_1467039_-	type II secretion system protein F	NA	NA	NA	NA
AUI76543.1\|1467007_1467982_-	competence protein	NA	NA	NA	NA
AUI76544.1\|1468130_1468859_-	transcriptional regulator	NA	NA	NA	NA
AUI76545.1\|1468949_1469465_-	hypothetical protein	NA	NA	NA	NA
AUI76546.1\|1469559_1469745_-	30S ribosomal protein S14	NA	NA	NA	NA
AUI76547.1\|1469843_1471028_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.8e-123	59.1
AUI76548.1\|1472807_1473764_-	alpha/beta hydrolase	NA	NA	NA	NA
AUI76549.1\|1475438_1477460_-	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
AUI76550.1\|1478642_1479797_+	glycerate kinase	NA	NA	NA	NA
AUI76551.1\|1479801_1480269_-	protein tyrosine phosphatase	NA	NA	NA	NA
AUI76552.1\|1480825_1482004_+\|transposase	transposase	NA	NA	NA	NA
AUI76553.1\|1482382_1483198_-	HAD family hydrolase	NA	NA	NA	NA
AUI76554.1\|1483207_1484023_-	HAD family hydrolase	NA	NA	NA	NA
AUI76555.1\|1484117_1485470_-	phosphoglucosamine mutase	NA	NA	NA	NA
AUI76556.1\|1485500_1486460_-	hypothetical protein	NA	NA	NA	NA
AUI76557.1\|1486456_1487299_-	TIGR00159 family protein	NA	NA	NA	NA
AUI76558.1\|1487356_1488430_-	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI76559.1\|1488426_1489242_-	spermidine/putrescine ABC transporter permease	NA	NA	NA	NA
AUI76560.1\|1489238_1490051_-	spermidine/putrescine ABC transporter permease	NA	NA	NA	NA
AUI76561.1\|1490040_1491144_-	spermidine/putrescine import ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	2.5e-34	41.1
AUI76562.1\|1491203_1492100_-	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
AUI76563.1\|1492197_1492731_+	exonuclease	M1PFD8	Streptococcus_phage	6.8e-22	36.6
AUI76564.1\|1492737_1493238_-\|tRNA	tRNA (N6-adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase TsaE	NA	NA	NA	NA
AUI76565.1\|1493237_1494227_-	phosphate acetyltransferase	NA	NA	NA	NA
AUI76566.1\|1494238_1494937_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	2.7e-42	43.0
AUI76567.1\|1495005_1495887_+	HAD family hydrolase	NA	NA	NA	NA
AUI76568.1\|1495893_1496415_+	hypothetical protein	NA	NA	NA	NA
AUI76569.1\|1496745_1497504_-	triose-phosphate isomerase	NA	NA	NA	NA
AUI76570.1\|1497529_1498741_-	phosphoglycerate kinase	NA	NA	NA	NA
AUI76571.1\|1498853_1499870_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AUI76572.1\|1499925_1500957_-	hypothetical protein	NA	NA	NA	NA
AUI76573.1\|1505769_1506585_+	sugar-phosphatase	NA	NA	NA	NA
AUI76574.1\|1506639_1508265_-	hypothetical protein	NA	NA	NA	NA
AUI76575.1\|1508451_1509036_+	ATP-dependent Clp endopeptidase, proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.7e-53	54.9
AUI76576.1\|1509087_1510023_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.4e-46	35.2
AUI76577.1\|1510015_1511059_-	hypothetical protein	A1IMD5	Streptococcus_phage	2.4e-87	50.2
AUI76578.1\|1511069_1511945_-	RNase adaptor protein RapZ	A0A0R8VB27	Thermobifida_phage	1.2e-07	29.3
AUI76579.1\|1512033_1512576_-	hypothetical protein	NA	NA	NA	NA
AUI76580.1\|1512640_1515481_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.7e-305	56.1
AUI76581.1\|1515470_1517519_-	excinuclease ABC subunit B	NA	NA	NA	NA
AUI76582.1\|1517621_1519346_-	phosphoglucomutase	A0A1X9I671	Streptococcus_phage	2.6e-147	46.0
AUI77153.1\|1519446_1519899_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
AUI76583.1\|1520078_1521263_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	8.9e-123	58.8
AUI76584.1\|1521650_1522829_+\|transposase	transposase	NA	NA	NA	NA
AUI76585.1\|1523067_1524327_+\|transposase	transposase	Q6V7R1	Burkholderia_virus	8.9e-12	22.8
AUI76586.1\|1524567_1525740_+\|transposase	transposase	A0A1X9I5Z0	Streptococcus_phage	4.6e-55	37.9
AUI76587.1\|1525824_1527003_+\|transposase	transposase	NA	NA	NA	NA
AUI76588.1\|1527488_1528508_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AUI76589.1\|1528549_1529389_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AUI76590.1\|1529381_1530350_-	HPr kinase/phosphorylase	NA	NA	NA	NA
AUI76591.1\|1530366_1530645_-	hypothetical protein	NA	NA	NA	NA
AUI76592.1\|1530652_1531651_-	peptide chain release factor 2	NA	NA	NA	NA
AUI76593.1\|1531836_1534236_-	preprotein translocase subunit SecA	NA	NA	NA	NA
AUI76594.1\|1534375_1534921_-	ribosomal subunit interface protein	NA	NA	NA	NA
AUI76595.1\|1535001_1535697_-	competence protein	NA	NA	NA	NA
AUI76596.1\|1535693_1536980_-	competence protein ComF	A0A1X9I5S6	Streptococcus_phage	2.9e-82	43.8
AUI76597.1\|1537024_1537687_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.4e-39	43.8
AUI76598.1\|1537713_1538871_-	undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
AUI76599.1\|1538978_1540610_-	ribonuclease Y	NA	NA	NA	NA
AUI76600.1\|1540729_1541827_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	7.2e-119	61.8
AUI76601.1\|1542010_1542571_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AUI76602.1\|1542593_1543712_-	transcriptional regulator	NA	NA	NA	NA
AUI76603.1\|1543779_1544508_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AUI76604.1\|1544508_1545765_-	peptidase M16	A0A2P1EIE5	Megavirus	1.0e-12	28.1
AUI76605.1\|1545761_1546976_-\|protease	protease	NA	NA	NA	NA
AUI76606.1\|1546962_1549380_-	cell division protein FtsK	Q853W3	Mycobacterium_phage	1.7e-83	48.0
AUI76607.1\|1549400_1549790_-	hypothetical protein	NA	NA	NA	NA
AUI76608.1\|1549789_1550350_-	RNA methyltransferase	NA	NA	NA	NA
AUI76609.1\|1550400_1551600_-	AI-2E family transporter	NA	NA	NA	NA
AUI76610.1\|1552068_1554825_-	haloacid dehalogenase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.1e-75	29.6
AUI76611.1\|1554977_1556006_+	3-carboxymuconate cyclase	NA	NA	NA	NA
AUI76612.1\|1556112_1556805_+	hypothetical protein	NA	NA	NA	NA
AUI76613.1\|1558725_1559622_-	RNA pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.3e-06	30.5
AUI76614.1\|1559605_1560418_-	NAD kinase	NA	NA	NA	NA
AUI76615.1\|1560414_1561047_-	GTP pyrophosphokinase	NA	NA	NA	NA
AUI76616.1\|1561170_1561785_+	adenylate cyclase	NA	NA	NA	NA
AUI76617.1\|1561863_1562481_+	dihydroorotate dehydrogenase	NA	NA	NA	NA
AUI76618.1\|1562489_1563338_-	competence protein	NA	NA	NA	NA
AUI76619.1\|1563415_1564156_-	adaptor protein MecA	NA	NA	NA	NA
AUI76620.1\|1564247_1564646_-	transcriptional regulator Spx	NA	NA	NA	NA
AUI76621.1\|1564877_1566611_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AUI76622.1\|1566610_1566877_-	phosphocarrier protein HPr	NA	NA	NA	NA
AUI76623.1\|1566989_1567184_-	hypothetical protein	NA	NA	NA	NA
AUI76624.1\|1567461_1568868_-\|transposase	transposase	NA	NA	NA	NA
AUI76625.1\|1569806_1571996_+\|protease	Clp protease ClpE	A0A1C3S747	Escherichia_phage	8.8e-124	40.5
AUI76626.1\|1572147_1572429_+	hypothetical protein	NA	NA	NA	NA
AUI76627.1\|1572496_1574068_-	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	5.5e-35	26.2
AUI76628.1\|1574067_1574940_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AUI76629.1\|1575047_1575509_+	hypothetical protein	NA	NA	NA	NA
AUI76630.1\|1575510_1575993_-	hypothetical protein	NA	NA	NA	NA
AUI76631.1\|1576003_1576819_-	recombination regulator RecX	NA	NA	NA	NA
AUI76632.1\|1576940_1578323_+	23S rRNA (uracil-5-)-methyltransferase RumA	A0A2K5B251	Erysipelothrix_phage	3.9e-69	33.2
AUI76633.1\|1579034_1579619_-\|transposase	transposase	NA	NA	NA	NA
AUI76634.1\|1579667_1580123_-\|transposase	transposase	NA	NA	NA	NA
AUI76635.1\|1580126_1580396_-\|transposase	transposase	NA	NA	NA	NA
AUI76636.1\|1580749_1581838_+\|transposase	transposase	A0A1X9I5Z0	Streptococcus_phage	4.9e-51	38.5
AUI76637.1\|1582075_1582423_+\|transposase	transposase	NA	NA	NA	NA
AUI77154.1\|1582462_1582693_+\|transposase	transposase	NA	NA	NA	NA
AUI76638.1\|1582667_1584005_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUI76639.1\|1584597_1587462_-	peptide synthetase	A0A2K9L3I8	Tupanvirus	1.9e-33	27.0
AUI76640.1\|1587878_1589057_+\|transposase	transposase	NA	NA	NA	NA
AUI76641.1\|1590247_1590454_-	hypothetical protein	NA	NA	NA	NA
AUI76642.1\|1590603_1591782_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1596006 : 1663298

Lactobacillus_virus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76647.1\|1596006_1597335_-\|transposase	transposase	A0A286QMQ9	Streptococcus_phage	2.7e-59	41.3
AUI76648.1\|1597399_1598299_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	6.4e-73	48.1
AUI76649.1\|1598360_1599284_-	ribonuclease BN-like family protein	NA	NA	NA	NA
AUI76650.1\|1599292_1600120_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AUI76651.1\|1600263_1600710_+	flavodoxin	NA	NA	NA	NA
AUI76652.1\|1600702_1601242_+	teichoic acid glycosylation protein	NA	NA	NA	NA
AUI76653.1\|1601265_1602408_-	UDP-N-acetylglucosamine 2-epimerase	A0A0N9R0B2	Chrysochromulina_ericina_virus	5.5e-29	30.3
AUI76654.1\|1602515_1602704_+	hypothetical protein	NA	NA	NA	NA
AUI76655.1\|1602871_1604200_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AUI76656.1\|1604196_1605429_-	helicase	A0A1B1IS59	uncultured_Mediterranean_phage	1.2e-34	28.5
AUI76657.1\|1605428_1606133_-	lysozyme	NA	NA	NA	NA
AUI76658.1\|1607473_1608043_-	hypoxanthine phosphoribosyltransferase	A0A2K9L634	Tupanvirus	4.9e-10	27.6
AUI76659.1\|1608149_1609511_-	hemolysin	NA	NA	NA	NA
AUI76660.1\|1610325_1610583_-	hypothetical protein	NA	NA	NA	NA
AUI76661.1\|1610777_1611956_+\|transposase	transposase	NA	NA	NA	NA
AUI76662.1\|1613451_1614117_-	hypothetical protein	NA	NA	NA	NA
AUI77155.1\|1614389_1615595_-\|transposase	transposase	NA	NA	NA	NA
AUI76663.1\|1617476_1618667_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	5.6e-125	58.2
AUI76664.1\|1619997_1620846_-	hypothetical protein	NA	NA	NA	NA
AUI76665.1\|1624402_1625251_-	patatin family protein	NA	NA	NA	NA
AUI76666.1\|1625318_1627718_-	phosphoketolase	NA	NA	NA	NA
AUI76667.1\|1628784_1629150_+	hypothetical protein	NA	NA	NA	NA
AUI76668.1\|1629236_1629560_-	DNA methyltransferase	NA	NA	NA	NA
AUI76669.1\|1629559_1630963_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AUI76670.1\|1630955_1631417_-	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
AUI76671.1\|1631403_1632642_-	cysteine desulfurase	Q2XUY6	environmental_halophage	1.0e-97	41.8
AUI76672.1\|1632616_1633894_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AUI76673.1\|1633905_1634700_-	Fe-S cluster assembly ATPase SufC	A0A1M7XV31	Cedratvirus	7.3e-12	27.6
AUI76674.1\|1635821_1636640_+	sugar-phosphatase	NA	NA	NA	NA
AUI76675.1\|1636704_1637028_-	hypothetical protein	NA	NA	NA	NA
AUI76676.1\|1637147_1638338_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	4.2e-120	56.7
AUI76677.1\|1638435_1638630_-	hypothetical protein	NA	NA	NA	NA
AUI76678.1\|1639429_1640356_-	purine nucleosidase	NA	NA	NA	NA
AUI76679.1\|1640472_1642488_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	5.0e-65	34.6
AUI76680.1\|1642597_1643776_-\|transposase	transposase	NA	NA	NA	NA
AUI76681.1\|1643926_1644619_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
AUI76682.1\|1644618_1645545_-	ribokinase	A0A2H4N7X4	Lake_Baikal_phage	6.3e-07	37.5
AUI76683.1\|1645628_1646432_-	DUF4931 domain-containing protein	NA	NA	NA	NA
AUI76684.1\|1648194_1648464_+	hypothetical protein	NA	NA	NA	NA
AUI76685.1\|1648482_1649826_+	hypothetical protein	NA	NA	NA	NA
AUI76686.1\|1649974_1651276_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI76687.1\|1651474_1652752_+\|transposase	transposase	Q6V7R1	Burkholderia_virus	3.4e-11	22.9
AUI76688.1\|1653448_1654633_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	1.3e-121	58.5
AUI76689.1\|1655214_1655868_-	glutamine ABC transporter permease	NA	NA	NA	NA
AUI76690.1\|1655882_1656524_-	glutamine ABC transporter permease	NA	NA	NA	NA
AUI76691.1\|1656523_1657342_-	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI76692.1\|1657352_1658093_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.2e-38	41.4
AUI76693.1\|1660293_1660926_+	uridine kinase	A0A1V0SAA3	Catovirus	6.2e-38	39.5
AUI76694.1\|1660956_1661865_-	MFS transporter	NA	NA	NA	NA
AUI76695.1\|1662492_1662912_+	DDE endonuclease	NA	NA	NA	NA
AUI76696.1\|1662983_1663298_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1684192 : 1742965

Lactococcus_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76711.1\|1684192_1685599_+\|transposase	transposase	NA	NA	NA	NA
AUI76712.1\|1685816_1686017_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-20	71.4
AUI76713.1\|1687192_1688599_+\|transposase	transposase	NA	NA	NA	NA
AUI76714.1\|1689087_1690440_-	23S rRNA (uracil-5-)-methyltransferase RumA	F5CA72	Streptococcus_phi-m46.1-like_phage	1.9e-116	48.2
AUI76715.1\|1690804_1692181_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
AUI76716.1\|1692779_1693958_+\|transposase	transposase	NA	NA	NA	NA
AUI76717.1\|1694121_1694826_+	hypothetical protein	NA	NA	NA	NA
AUI76718.1\|1694869_1695562_-	hypothetical protein	NA	NA	NA	NA
AUI76719.1\|1695628_1696549_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.1e-18	25.8
AUI76720.1\|1696573_1698004_-\|tRNA	aspartyl/glutamyl-tRNA amidotransferase subunit B	NA	NA	NA	NA
AUI76721.1\|1698008_1699448_-\|tRNA	aspartyl/glutamyl-tRNA amidotransferase subunit A	NA	NA	NA	NA
AUI76722.1\|1699447_1699756_-\|tRNA	asparaginyl/glutamyl-tRNA amidotransferase subunit C	NA	NA	NA	NA
AUI77157.1\|1699769_1700897_-	sex pheromone biosynthesis protein	NA	NA	NA	NA
AUI76723.1\|1700930_1702937_-	DNA ligase (NAD(+)) LigA	A0A0K2QQN8	Ralstonia_phage	7.1e-104	36.1
AUI76724.1\|1702977_1705224_-	ATP-dependent DNA helicase PcrA	A7KV33	Bacillus_phage	6.9e-132	41.3
AUI76725.1\|1705309_1705957_-	N-acetylmuramidase	S5M633	Brevibacillus_phage	1.0e-27	47.7
AUI76726.1\|1706194_1706665_-	SprT family protein	NA	NA	NA	NA
AUI76727.1\|1706652_1707351_-	glycosyl transferase	L7RBS6	Acanthamoeba_polyphaga_moumouvirus	9.6e-08	26.5
AUI76728.1\|1707353_1708784_-	capsular biosynthesis protein	NA	NA	NA	NA
AUI76729.1\|1708788_1709943_-	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
AUI76730.1\|1712955_1714197_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	9.1e-118	57.0
AUI76731.1\|1714392_1715223_-	NAD(+) synthase	G3MA24	Bacillus_virus	5.7e-68	51.4
AUI76732.1\|1715219_1716698_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.1e-114	46.9
AUI76733.1\|1716785_1717886_-	galactosyltransferase	NA	NA	NA	NA
AUI76734.1\|1717893_1718622_-	acetylglucosaminyldiphospho-UDP acetyl-beta-D-mannosaminyltransferase	NA	NA	NA	NA
AUI76735.1\|1719946_1720333_+	glycerol-3-phosphate cytidylyltransferase	A0A0F7LBI5	uncultured_marine_virus	7.1e-13	47.2
AUI76736.1\|1720396_1721098_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUI76737.1\|1721186_1722302_-	hypothetical protein	NA	NA	NA	NA
AUI76738.1\|1722691_1723243_-	hypothetical protein	NA	NA	NA	NA
AUI76739.1\|1726590_1727286_-	glycerophosphodiester phosphodiesterase	M1ICP4	Paramecium_bursaria_Chlorella_virus	1.8e-14	25.8
AUI77158.1\|1727337_1727997_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AUI76740.1\|1728555_1729134_-	phosphoglycerate mutase	A0A1X9IGJ2	Lactococcus_phage	3.3e-22	37.1
AUI77159.1\|1729203_1730262_-	surface exclusion protein	NA	NA	NA	NA
AUI76741.1\|1730399_1731095_-	hypothetical protein	A0A249XZV3	Enterococcus_phage	3.2e-11	50.0
AUI76742.1\|1732794_1733187_-	hypothetical protein	NA	NA	NA	NA
AUI76743.1\|1733297_1733498_+	hypothetical protein	NA	NA	NA	NA
AUI76744.1\|1733596_1733995_+	hypothetical protein	NA	NA	NA	NA
AUI76745.1\|1734148_1735900_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	1.8e-87	36.7
AUI76746.1\|1736106_1737348_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	9.7e-120	57.5
AUI76747.1\|1737622_1738777_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
AUI76748.1\|1738793_1739507_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUI76749.1\|1740519_1741926_+\|transposase	transposase	NA	NA	NA	NA
AUI76750.1\|1742107_1742965_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1798676 : 1853812

Enterobacteria_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76792.1\|1798676_1799918_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	2.0e-117	56.7
AUI76793.1\|1800098_1800506_-	hypothetical protein	NA	NA	NA	NA
AUI76794.1\|1800593_1801334_-	hypothetical protein	A0A0A7NTY4	Lactobacillus_phage	6.8e-121	83.1
AUI76795.1\|1802183_1803788_-	ABC transporter	W8CYL7	Bacillus_phage	1.3e-15	23.3
AUI76796.1\|1803959_1805366_+\|transposase	transposase	NA	NA	NA	NA
AUI76797.1\|1805515_1806430_+	prolyl aminopeptidase	NA	NA	NA	NA
AUI76798.1\|1806519_1807521_+	adenosine deaminase	NA	NA	NA	NA
AUI76799.1\|1807568_1808072_+	nucleoside 2-deoxyribosyltransferase	C1KFI2	Lactobacillus_virus	1.2e-12	31.2
AUI76800.1\|1808486_1808891_+	hypothetical protein	NA	NA	NA	NA
AUI76801.1\|1809074_1810376_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AUI76802.1\|1810428_1811001_-	elongation factor P	NA	NA	NA	NA
AUI76803.1\|1811035_1811950_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	3.6e-31	33.2
AUI76804.1\|1812008_1812569_+	arylesterase	NA	NA	NA	NA
AUI76805.1\|1814115_1816422_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AUI76806.1\|1816571_1817258_+\|protease	metalloprotease	NA	NA	NA	NA
AUI76807.1\|1817319_1817970_+	fructose-2,6-bisphosphatase	NA	NA	NA	NA
AUI76808.1\|1818186_1819986_-	ABC transporter	NA	NA	NA	NA
AUI76809.1\|1819998_1820748_-	bacitracin ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-34	39.5
AUI76810.1\|1820894_1822166_-	hypothetical protein	NA	NA	NA	NA
AUI76811.1\|1822254_1822926_+	hypothetical protein	NA	NA	NA	NA
AUI76812.1\|1823349_1824354_-	L-asparaginase 1	NA	NA	NA	NA
AUI76813.1\|1826417_1826924_+	transcriptional regulator	NA	NA	NA	NA
AUI76814.1\|1828116_1828992_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.2e-76	50.3
AUI76815.1\|1829156_1831262_-	ornithine decarboxylase	NA	NA	NA	NA
AUI76816.1\|1831486_1832938_+	amino acid permease	NA	NA	NA	NA
AUI76817.1\|1834576_1834783_-	hypothetical protein	NA	NA	NA	NA
AUI76818.1\|1834895_1836194_-	MFS transporter	NA	NA	NA	NA
AUI76819.1\|1839406_1840585_+\|transposase	transposase	NA	NA	NA	NA
AUI76820.1\|1841053_1842040_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	1.3e-29	37.8
AUI76821.1\|1842056_1842665_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.5e-44	50.3
AUI76822.1\|1842686_1843571_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.7e-92	57.5
AUI76823.1\|1843575_1844613_-	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.4e-86	47.1
AUI76824.1\|1845124_1846297_-	MerR family transcriptional regulator	NA	NA	NA	NA
AUI76825.1\|1846324_1847458_-	hypothetical protein	NA	NA	NA	NA
AUI76826.1\|1847687_1849241_-	hypothetical protein	A0A1S5SA14	Streptococcus_phage	3.4e-29	27.4
AUI76827.1\|1849669_1850848_-\|transposase	transposase	NA	NA	NA	NA
AUI76828.1\|1850969_1851209_-	hypothetical protein	NA	NA	NA	NA
AUI76829.1\|1851256_1851562_-	hypothetical protein	NA	NA	NA	NA
AUI76830.1\|1851646_1852387_-	hypothetical protein	NA	NA	NA	NA
AUI76831.1\|1852633_1853812_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1858124 : 1921937

Streptococcus_phage(15.38%)

transposase,integrase

attL 1862452:1862468|attR 1869142:1869158

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI76835.1\|1858124_1859303_-\|transposase	transposase	NA	NA	NA	NA
AUI76836.1\|1859424_1859862_-	hypothetical protein	NA	NA	NA	NA
AUI76837.1\|1861470_1862937_-	poly-gamma-glutamate biosynthesis protein	NA	NA	NA	NA
1862452:1862468	attL	NA	NA	NA	NA
AUI76838.1\|1862960_1863926_-	hypothetical protein	NA	NA	NA	NA
AUI76839.1\|1865505_1866411_-	glycosyltransferase	NA	NA	NA	NA
AUI76840.1\|1866413_1867523_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.3e-163	73.4
AUI76841.1\|1867738_1868788_+\|integrase	integrase	H7BWC8	unidentified_phage	5.4e-47	34.6
AUI77162.1\|1869149_1870133_-	hypothetical protein	NA	NA	NA	NA
1869142:1869158	attR	NA	NA	NA	NA
AUI76842.1\|1871367_1871940_-	hypothetical protein	A0A1V0SD50	Indivirus	6.6e-07	35.3
AUI76843.1\|1871932_1873216_-	hypothetical protein	NA	NA	NA	NA
AUI76844.1\|1873230_1874007_-	glycosyltransferase	NA	NA	NA	NA
AUI76845.1\|1874027_1875107_-	hypothetical protein	NA	NA	NA	NA
AUI76846.1\|1875106_1875604_-	glycosyltransferase	NA	NA	NA	NA
AUI76847.1\|1875603_1876053_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
AUI77163.1\|1876068_1876719_-	multidrug MFS transporter	NA	NA	NA	NA
AUI76848.1\|1876838_1877609_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUI76849.1\|1877608_1878403_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUI76850.1\|1878413_1879298_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUI76851.1\|1879309_1880371_-	transcriptional regulator	A0A1X9I5X1	Streptococcus_phage	1.1e-15	31.1
AUI76852.1\|1880845_1882111_+	GTPase HflX	NA	NA	NA	NA
AUI76853.1\|1882132_1883143_+	hypothetical protein	NA	NA	NA	NA
AUI76854.1\|1883353_1884286_-	hydrolase	M9MUG9	Rhodococcus_phage	5.9e-13	36.9
AUI76855.1\|1885289_1886396_+	plasmid replication initiation protein	NA	NA	NA	NA
AUI76856.1\|1886799_1887081_+	damage-inducible protein J	NA	NA	NA	NA
AUI76857.1\|1887127_1887313_+	hypothetical protein	NA	NA	NA	NA
AUI76858.1\|1887389_1887668_-	hypothetical protein	NA	NA	NA	NA
AUI76859.1\|1887690_1887900_-	hypothetical protein	NA	NA	NA	NA
AUI76860.1\|1888170_1890231_+	nickase	NA	NA	NA	NA
AUI76861.1\|1890360_1890936_-	hypothetical protein	NA	NA	NA	NA
AUI76862.1\|1891065_1891338_-	hypothetical protein	NA	NA	NA	NA
AUI76863.1\|1891771_1893247_-	hypothetical protein	NA	NA	NA	NA
AUI76864.1\|1893249_1895925_-	helicase	A0A2H4J643	uncultured_Caudovirales_phage	1.1e-40	26.0
AUI76865.1\|1895960_1898507_-	DNA methylase	NA	NA	NA	NA
AUI76866.1\|1898511_1902201_-	hypothetical protein	NA	NA	NA	NA
AUI76867.1\|1902216_1902636_-	hypothetical protein	NA	NA	NA	NA
AUI76868.1\|1902767_1903106_-\|transposase	transposase	NA	NA	NA	NA
AUI76869.1\|1903246_1903555_-\|transposase	transposase	NA	NA	NA	NA
AUI76870.1\|1903986_1904481_-	hypothetical protein	NA	NA	NA	NA
AUI76871.1\|1904570_1905131_+	hypothetical protein	NA	NA	NA	NA
AUI76872.1\|1905409_1906294_+	hypothetical protein	NA	NA	NA	NA
AUI76873.1\|1906459_1907017_+	resolvase	A0A1J1J8Z4	Escherichia_phage	6.9e-33	45.1
AUI76874.1\|1907210_1907912_-	hypothetical protein	NA	NA	NA	NA
AUI76875.1\|1908090_1908933_-\|transposase	transposase	Q6J1X2	Lactobacillus_phage	1.1e-154	98.2
AUI76876.1\|1908986_1909238_-\|transposase	transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
AUI76877.1\|1909698_1910505_+	peptide transporter	A0A1V0DZZ0	Clostridioides_phage	2.3e-21	30.1
AUI76878.1\|1910518_1910767_+	hypothetical protein	NA	NA	NA	NA
AUI77164.1\|1912443_1912743_+\|transposase	transposase	NA	NA	NA	NA
AUI76879.1\|1913492_1914836_-	hypothetical protein	NA	NA	NA	NA
AUI76880.1\|1914848_1915118_-	hypothetical protein	NA	NA	NA	NA
AUI76881.1\|1916155_1916932_-	hydrolase	A0A1V0DZX6	Clostridioides_phage	1.3e-18	47.2
AUI76882.1\|1917149_1917512_-	ATPase	NA	NA	NA	NA
AUI76883.1\|1917848_1919411_-\|transposase	transposase	NA	NA	NA	NA
AUI76884.1\|1919364_1920015_-\|transposase	transposase	A0A7Q0	Microcystis_virus	5.2e-40	45.2
AUI76885.1\|1920080_1920401_-	hypothetical protein	NA	NA	NA	NA
AUI76886.1\|1920448_1920658_-	hypothetical protein	NA	NA	NA	NA
AUI76887.1\|1920752_1921937_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.1e-123	59.1

DBSCAN-SWA_17

2092653 : 2145640

Gordonia_phage(10.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUI77029.1\|2092653_2093511_-\|transposase	transposase	NA	NA	NA	NA
AUI77030.1\|2093662_2094142_-	hypothetical protein	NA	NA	NA	NA
AUI77031.1\|2094239_2094602_-	hypothetical protein	NA	NA	NA	NA
AUI77032.1\|2094670_2095969_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.7e-18	33.5
AUI77033.1\|2095972_2097262_-	adenylosuccinate synthase	L7Y4J5	Megavirus	5.8e-67	36.3
AUI77034.1\|2097472_2098465_+	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.7e-130	67.3
AUI77035.1\|2098903_2099959_-	cell surface protein	NA	NA	NA	NA
AUI77036.1\|2100147_2101326_+\|transposase	transposase	NA	NA	NA	NA
AUI77037.1\|2101785_2102799_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	8.0e-64	41.4
AUI77038.1\|2103365_2104544_-\|transposase	transposase	NA	NA	NA	NA
AUI77039.1\|2105025_2105316_-	hypothetical protein	NA	NA	NA	NA
AUI77040.1\|2105500_2106679_-\|transposase	transposase	NA	NA	NA	NA
AUI77041.1\|2107428_2108820_-	amino acid permease	NA	NA	NA	NA
AUI77042.1\|2109870_2111244_-	amino acid permease	NA	NA	NA	NA
AUI77043.1\|2111289_2112642_-	amino acid permease	NA	NA	NA	NA
AUI77044.1\|2112732_2113497_-	hypothetical protein	NA	NA	NA	NA
AUI77045.1\|2113590_2114232_-	signal peptidase I	NA	NA	NA	NA
AUI77046.1\|2114338_2116462_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	3.8e-116	40.2
AUI77047.1\|2116746_2117676_-	acyltransferase	NA	NA	NA	NA
AUI77048.1\|2117644_2118970_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AUI77174.1\|2119058_2119760_+	macrolide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.6e-32	34.7
AUI77049.1\|2121708_2122899_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	6.0e-119	56.7
AUI77050.1\|2123440_2123695_+	hypothetical protein	NA	NA	NA	NA
AUI77051.1\|2123741_2123978_+	hypothetical protein	NA	NA	NA	NA
AUI77052.1\|2124016_2125537_-	sugar transporter	NA	NA	NA	NA
AUI77053.1\|2128301_2128709_-	hypothetical protein	NA	NA	NA	NA
AUI77054.1\|2129117_2129825_-	hypothetical protein	NA	NA	NA	NA
AUI77055.1\|2129873_2130074_-	transcriptional regulator	NA	NA	NA	NA
AUI77056.1\|2130407_2130755_+\|transposase	transposase	NA	NA	NA	NA
AUI77175.1\|2130794_2131025_+\|transposase	transposase	NA	NA	NA	NA
AUI77057.1\|2130999_2132337_+\|transposase	transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
AUI77058.1\|2132555_2133500_-	penicillin-binding protein	NA	NA	NA	NA
AUI77059.1\|2133499_2134786_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
AUI77060.1\|2134778_2135018_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
AUI77061.1\|2135076_2136315_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.5e-24	27.4
AUI77062.1\|2136314_2137829_-	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9KZV5	Tupanvirus	4.4e-34	28.4
AUI77063.1\|2137844_2137997_-	cytochrome C554	NA	NA	NA	NA
AUI77064.1\|2138218_2139397_+\|transposase	transposase	NA	NA	NA	NA
AUI77065.1\|2139556_2139853_-	hypothetical protein	NA	NA	NA	NA
AUI77066.1\|2139872_2141009_-	hypothetical protein	NA	NA	NA	NA
AUI77067.1\|2144461_2145640_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: CP015498.1|AUI76651.1|1600263_1600710_+|flavodoxin

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP015498.1|AUI76651.1|1600263_1600710_+|flavodoxin

1600263_1600710_+

148 aa aa

1596006-1663298

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP015498_2	Orphan	2.1\|866068\|39\|CP015498\|CRISPRCasFinder	866068-866106	39	1652795-1652757	0

1. spacer 2.1|866068|39|CP015498|CRISPRCasFinder matches to CP015498 position: 1652795-1652757, mismatch: 0

ggctctttgtcaaatcctgttgatagagagtaaatgaat	CRISPR spacer
ggctctttgtcaaatcctgttgatagagagtaaatgaat	Protospacer
***************************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP015498

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information