CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP028564	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p3_045096, complete sequence	0 crisprs	NA	0
CP028563	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence	0 crisprs	NA	0
CP028565	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pGES5_045096, complete sequence	0 crisprs	NA	1
CP028562	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence	0 crisprs	NA	0
CP028568	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 chromosome, complete genome	5 crisprs	cas3,DEDDh,DinG,WYL,csa3,RT	7
CP028567	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence	0 crisprs	cas14j,PD-DExK,c2c9_V-U4,DEDDh	3
CP028566	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pKPC2_045096, complete sequence	0 crisprs	DEDDh	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1387 : 60517

Escherichia_phage(22.22%)

transposase,integrase

attL 16718:16734|attR 58091:58107

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA04277.1\|1387_2929_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
AWA04278.1\|4476_6120_-	phosphoethanolamine--lipid A transferase MCR-5.1	NA	NA	NA	NA
AWA04279.1\|6138_6681_-	chromate resistance protein ChrB	NA	NA	NA	NA
AWA04280.1\|6920_7481_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.8e-50	86.2
AWA04281.1\|7483_10453_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.6
AWA04282.1\|10488_10893_+	hypothetical protein	NA	NA	NA	NA
AWA04496.1\|11012_12179_+\|transposase	transposase	A0A077SLN2	Escherichia_phage	3.4e-151	69.9
AWA04283.1\|12281_13457_+	hypothetical protein	NA	NA	NA	NA
AWA04284.1\|13770_14016_+	plasmid replication protein RepB	NA	NA	NA	NA
AWA04285.1\|14120_14348_-	hypothetical protein	NA	NA	NA	NA
AWA04286.1\|14358_14757_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AWA04287.1\|14831_15182_+	mercury transporter MerT	NA	NA	NA	NA
AWA04288.1\|15194_15470_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
AWA04289.1\|15477_15690_+	hypothetical protein	NA	NA	NA	NA
AWA04290.1\|15702_18696_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	8.2e-258	47.4
16718:16734	attL	NA	NA	NA	NA
AWA04291.1\|18699_19110_-	PIN domain nuclease	NA	NA	NA	NA
AWA04292.1\|19109_19349_-	methionine repressor-like protein	NA	NA	NA	NA
AWA04293.1\|20041_22927_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-190	39.9
AWA04294.1\|23052_23667_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.3e-37	48.6
AWA04295.1\|23732_24536_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AWA04497.1\|24535_25372_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AWA04296.1\|25478_25955_+\|transposase	transposase	NA	NA	NA	NA
AWA04297.1\|26029_26890_+	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
AWA04298.1\|26902_27445_+	tunicamycin resistance protein	NA	NA	NA	NA
AWA04299.1\|27926_28118_-	hypothetical protein	NA	NA	NA	NA
AWA04300.1\|28123_28369_+	hypothetical protein	NA	NA	NA	NA
AWA04301.1\|28419_29556_+	DUF3883 domain-containing protein	NA	NA	NA	NA
AWA04302.1\|31613_33644_+	restriction endonuclease subunit M	A0A220A2U5	Liberibacter_phage	8.9e-22	25.3
AWA04303.1\|33640_34690_+	DUF1016 domain-containing protein	Q9JMP5	Wolbachia_phage	4.0e-34	33.1
AWA04304.1\|34686_36012_+	restriction endonuclease subunit S	NA	NA	NA	NA
AWA04305.1\|36008_39257_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
AWA04306.1\|39249_40554_+\|transposase	ISL3 family transposase ISSm4	A0A2D1GQC1	Lysinibacillus_phage	7.2e-57	31.0
AWA04498.1\|41028_41250_-	resolvase	NA	NA	NA	NA
AWA04307.1\|41181_42486_+\|integrase	integrase	NA	NA	NA	NA
AWA04308.1\|42532_43237_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWA04309.1\|43426_44242_-	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
AWA04310.1\|44392_45097_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWA04311.1\|45587_46580_+\|transposase	transposase	NA	NA	NA	NA
AWA04312.1\|46548_47049_-	N-acetyltransferase	NA	NA	NA	NA
AWA04313.1\|47067_47247_+	hypothetical protein	NA	NA	NA	NA
AWA04314.1\|47176_48016_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AWA04315.1\|48009_48357_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AWA04499.1\|48520_49312_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AWA04500.1\|49429_50296_-	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-12	A0A077SL40	Escherichia_phage	1.2e-55	44.5
AWA04316.1\|50343_51905_-\|transposase	IS3-like element ISAs20 family transposase	NA	NA	NA	NA
AWA04317.1\|52091_52646_-	aminoglycoside N-acetyltransferase AAC(6')-IIa	NA	NA	NA	NA
AWA04318.1\|52754_53228_-	trimethoprim-resistant dihydrofolate reductase DfrA1	G3MBI7	Bacillus_virus	3.7e-19	32.1
AWA04319.1\|53370_53703_-	quaternary ammonium compound efflux SMR transporter QacK	NA	NA	NA	NA
AWA04320.1\|53950_54607_-	quinolone resistance pentapeptide repeat protein QnrVC6	NA	NA	NA	NA
AWA04321.1\|54883_55438_-	aminoglycoside N-acetyltransferase AAC(6')-Ib'	NA	NA	NA	NA
AWA04322.1\|55617_56631_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
AWA04323.1\|56569_56860_+\|transposase	transposase	NA	NA	NA	NA
AWA04501.1\|56894_57488_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.2e-40	49.7
AWA04324.1\|57484_60517_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
58091:58107	attR	NA	NA	NA	NA

DBSCAN-SWA_2

72874 : 111966

Acidithiobacillus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA04338.1\|72874_74416_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
AWA04339.1\|74430_75186_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
AWA04340.1\|75502_76561_+	hypothetical protein	NA	NA	NA	NA
AWA04341.1\|76811_77774_+	hypothetical protein	NA	NA	NA	NA
AWA04342.1\|77834_79685_+	VWA domain-containing protein	NA	NA	NA	NA
AWA04343.1\|79941_80994_+	hypothetical protein	NA	NA	NA	NA
AWA04344.1\|81109_81595_+	hypothetical protein	NA	NA	NA	NA
AWA04345.1\|82112_83144_+\|transposase	IS630-like element ISAhy2 family transposase	NA	NA	NA	NA
AWA04346.1\|83560_84697_+\|transposase	ISAs1-like element ISAs12 family transposase	NA	NA	NA	NA
AWA04347.1\|85538_85871_-	hypothetical protein	NA	NA	NA	NA
AWA04348.1\|86049_88050_+	hypothetical protein	NA	NA	NA	NA
AWA04349.1\|88108_89383_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
AWA04350.1\|89547_91209_+	GGDEF domain-containing protein	NA	NA	NA	NA
AWA04351.1\|91171_91651_-	hypothetical protein	NA	NA	NA	NA
AWA04352.1\|91928_93065_+\|transposase	ISAs1-like element ISAs12 family transposase	NA	NA	NA	NA
AWA04353.1\|93092_94046_+	DNA cytosine methyltransferase	NA	NA	NA	NA
AWA04354.1\|94143_94638_+	hypothetical protein	NA	NA	NA	NA
AWA04355.1\|94938_95955_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
AWA04356.1\|96094_96766_+	phosphatase	NA	NA	NA	NA
AWA04357.1\|96859_97810_-\|transposase	IS1595-like element ISKpn3 family transposase	NA	NA	NA	NA
AWA04358.1\|98132_99782_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
AWA04359.1\|99842_100487_-	fructose-6-phosphate aldolase	NA	NA	NA	NA
AWA04360.1\|100798_101749_+\|transposase	IS1595-like element ISKpn3 family transposase	NA	NA	NA	NA
AWA04361.1\|102325_102883_+	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
AWA04362.1\|102903_103884_+	PTS sorbitol transporter subunit IIB	NA	NA	NA	NA
AWA04363.1\|103909_104275_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
AWA04364.1\|104361_105138_+	sorbitol-6-phosphate dehydrogenase	W8CYX9	Bacillus_phage	6.9e-07	46.3
AWA04365.1\|105239_105596_+	transcriptional regulator	NA	NA	NA	NA
AWA04366.1\|105696_106461_+	transcriptional regulator	NA	NA	NA	NA
AWA04367.1\|106493_107459_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.6e-37	33.1
AWA04368.1\|108577_109852_-\|transposase	IS4-like element ISApu2 family transposase	NA	NA	NA	NA
AWA04369.1\|110008_110380_+	hypothetical protein	NA	NA	NA	NA
AWA04370.1\|110697_111966_+\|transposase	IS4 family transposase ISApu1	NA	NA	NA	NA

DBSCAN-SWA_3

136851 : 183850

Saccharomonospora_phage(33.33%)

transposase,integrase

attL 136011:136029|attR 151838:151856

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
136011:136029	attL	NA	NA	NA	NA
AWA04393.1\|136851_138417_-\|transposase	IS21 family transposase ISAs27	K4I413	Acidithiobacillus_phage	2.9e-121	45.8
AWA04394.1\|138585_139965_+\|integrase	site-specific integrase	NA	NA	NA	NA
AWA04395.1\|139974_142572_+\|integrase	integrase	NA	NA	NA	NA
AWA04396.1\|142574_143234_+	alpha/beta hydrolase	NA	NA	NA	NA
AWA04397.1\|143582_144632_+	DUF2971 domain-containing protein	NA	NA	NA	NA
AWA04398.1\|144674_145682_+	hypothetical protein	NA	NA	NA	NA
AWA04399.1\|146311_148909_+	hypothetical protein	NA	NA	NA	NA
AWA04400.1\|149616_150375_+	hypothetical protein	NA	NA	NA	NA
AWA04401.1\|150678_150936_+	hypothetical protein	NA	NA	NA	NA
AWA04402.1\|151204_151492_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
AWA04403.1\|151479_151773_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AWA04404.1\|151908_153135_-\|transposase	transposase	O80301	Enterobacteria_phage	7.7e-154	78.6
151838:151856	attR	NA	NA	NA	NA
AWA04405.1\|153192_153597_+\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
AWA04406.1\|153655_154192_+	hypothetical protein	NA	NA	NA	NA
AWA04407.1\|155194_155866_-	protein RepA	A0A077SLP3	Escherichia_phage	1.0e-30	35.7
AWA04408.1\|157092_157497_-	hypothetical protein	NA	NA	NA	NA
AWA04502.1\|157889_158096_-	hypothetical protein	NA	NA	NA	NA
AWA04409.1\|158164_158617_-	hypothetical protein	NA	NA	NA	NA
AWA04410.1\|158699_159167_-	hypothetical protein	NA	NA	NA	NA
AWA04411.1\|159503_159932_+	hypothetical protein	NA	NA	NA	NA
AWA04412.1\|160009_160432_+	hypothetical protein	NA	NA	NA	NA
AWA04413.1\|160550_160955_-\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
AWA04414.1\|161012_162239_+\|transposase	transposase	O80301	Enterobacteria_phage	7.7e-154	78.6
AWA04415.1\|162255_162552_+	hypothetical protein	NA	NA	NA	NA
AWA04416.1\|162961_163306_+	hypothetical protein	NA	NA	NA	NA
AWA04417.1\|163691_164111_-	transcriptional regulator	NA	NA	NA	NA
AWA04418.1\|164295_164622_-	hypothetical protein	NA	NA	NA	NA
AWA04419.1\|164621_165005_-	hypothetical protein	NA	NA	NA	NA
AWA04420.1\|165689_165953_+	hypothetical protein	NA	NA	NA	NA
AWA04421.1\|165980_166325_+	hypothetical protein	NA	NA	NA	NA
AWA04422.1\|166401_166986_+	hypothetical protein	NA	NA	NA	NA
AWA04423.1\|167272_167575_+	hypothetical protein	NA	NA	NA	NA
AWA04503.1\|167940_168753_+	chromosome partitioning protein ParA	Q8JL10	Natrialba_phage	1.9e-15	30.4
AWA04424.1\|168759_169047_+	hypothetical protein	NA	NA	NA	NA
AWA04425.1\|169962_170367_-\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	53.6
AWA04426.1\|170424_171651_+\|transposase	transposase	O80301	Enterobacteria_phage	5.0e-153	78.3
AWA04427.1\|171865_172381_-	hypothetical protein	NA	NA	NA	NA
AWA04428.1\|172787_174197_-	hypothetical protein	NA	NA	NA	NA
AWA04429.1\|175057_175390_+	hypothetical protein	NA	NA	NA	NA
AWA04430.1\|175965_176349_+	hypothetical protein	NA	NA	NA	NA
AWA04431.1\|176376_177786_-\|transposase	transposase	I4AZI9	Saccharomonospora_phage	8.9e-29	29.2
AWA04432.1\|177785_178088_-	hypothetical protein	NA	NA	NA	NA
AWA04433.1\|178166_178631_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.3e-34	51.5
AWA04434.1\|178787_179441_+	hypothetical protein	NA	NA	NA	NA
AWA04435.1\|179452_180019_+	single-stranded DNA-binding protein	A0A2I7R8Y7	Vibrio_phage	4.2e-46	70.7
AWA04436.1\|180072_180414_+	hypothetical protein	A0A2I7R6Q9	Vibrio_phage	3.3e-06	40.2
AWA04437.1\|180559_181195_+	SAM-dependent DNA methyltransferase	NA	NA	NA	NA
AWA04438.1\|181578_181944_+	hypothetical protein	NA	NA	NA	NA
AWA04439.1\|182161_182566_-\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
AWA04440.1\|182623_183850_+\|transposase	transposase	O80301	Enterobacteria_phage	7.7e-154	78.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP028565

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12172 : 20129

Escherichia_phage(16.67%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA04203.1\|12172_12937_-\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AWA04204.1\|13024_13138_+	NTP-binding protein	NA	NA	NA	NA
AWA04205.1\|13443_13944_-	N-acetyltransferase	NA	NA	NA	NA
AWA04206.1\|13962_14142_+	hypothetical protein	NA	NA	NA	NA
AWA04207.1\|14071_14911_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AWA04208.1\|14904_15252_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AWA04209.1\|15473_16337_-	carbapenem-hydrolyzing class A beta-lactamase GES-5	A0A1B0VBP7	Salmonella_phage	5.6e-42	39.0
AWA04210.1\|16516_17530_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AWA04211.1\|17498_17798_+\|transposase	transposase	NA	NA	NA	NA
AWA04212.1\|17802_18390_+	recombinase family protein	E5FFF9	Burkholderia_phage	9.7e-54	56.9
AWA04233.1\|18461_20129_+	modification methylase PaeR7I	R4TFP1	Halovirus	6.2e-21	24.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP028568

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP028568_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028568_1

67465-67567

Orphan

Consensus_repeat	Method
GGGCTGTTTTCCAAGTCCAGAGGGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028568_1

>merge|CP028568|1|67465-67567|CRISPRCasFinder
GGGCTGTTTTCCAAGTCCAGAGGGGCGTGCCATGTTTGAGAGTCTGGGAGTCATCAATGTCTGGACCTGCTTGACCGGGCTGTTTTCCAAGTCCAGGGGGGCG

>CP028568|1|1|67465-67567|CRISPRCasFinder
GGGCTGTTTTCCAAGTCCAGAGGGGCG	TGCCATGTTTGAGAGTCTGGGAGTCATCAATGTCTGGACCTGCTTGACC
GGGCTGTTTTCCAAGTCCAGGGGGGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP028568.1\|AWA04561.1\|69839_70115_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185131
CP028568.1\|AWA04565.1\|75357_75879_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|381090
CP028568.1\|AWA04563.1\|70973_73454_+\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|225729
CP028568.1\|AWA04559.1\|66011_67232_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031
CP028568.1\|AWA04551.1\|56789_57719_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
CP028568.1\|AWA04552.1\|57780_58755_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
CP028568.1\|AWA04550.1\|56643_56805_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA04556.1\|62032_63823_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
CP028568.1\|AWA04569.1\|81076_81517_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA04553.1\|58733_59747_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183400
CP028568.1\|AWA04555.1\|60838_62026_+\|enoyl-[acyl-carrier-protein]-reductase-FabV	unknown	unknown	gnl\|CDD\|237460
CP028568.1\|AWA04567.1\|77186_77429_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225107
CP028568.1\|AWA04558.1\|64637_65825_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224992
CP028568.1\|AWA04568.1\|77582_81041_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|182169
CP028568.1\|AWA04562.1\|70178_70880_+\|molecular-chaperone	unknown	unknown	gnl\|CDD\|225663
CP028568.1\|AWA04564.1\|73473_74571_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366088
CP028568.1\|AWA04557.1\|63927_64557_+\|non-heme-ferritin	unknown	unknown	gnl\|CDD\|224445
CP028568.1\|AWA04554.1\|59938_60373_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|185073
CP028568.1\|AWA04566.1\|76081_77218_+\|ISAs1-like-element-ISAs12-family-transposase	unknown	unknown	gnl\|CDD\|379382
CP028568.1\|AWA04560.1\|68751_69699_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382

Protein	Function_ID	Function_description	E-value
CP028568.1\|AWA04565.1\|75357_75879_+\|DNA-binding-response-regulator	gnl\|CDD\|381090	cd17535, REC_NarL-like, phosphoacceptor receiver (REC) domain of NarL (Nitrate/Nitrite response regulator L) family response regulators. The NarL family is one of the more abundant families of DNA-binding response regulators (RRs). Members of the NarL family contain a REC domain and a helix-turn-helix (HTH) DNA-binding output domain, with a majority of members containing a LuxR-type HTH domain. They function as transcriptional regulators. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	8.46642e-32
CP028568.1\|AWA04560.1\|68751_69699_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	7.29593e-93
CP028568.1\|AWA04559.1\|66011_67232_-\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.63971e-104
CP028568.1\|AWA04561.1\|69839_70115_+\|hypothetical-protein	gnl\|CDD\|185131	PRK15209, PRK15209, long polar fimbrial protein LpfA; Provisional.	4.60767e-05
CP028568.1\|AWA04552.1\|57780_58755_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.28267e-43
CP028568.1\|AWA04563.1\|70973_73454_+\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|225729	COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion].	0
CP028568.1\|AWA04556.1\|62032_63823_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.32633e-51
CP028568.1\|AWA04553.1\|58733_59747_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183400	PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed.	0
CP028568.1\|AWA04555.1\|60838_62026_+\|enoyl-[acyl-carrier-protein]-reductase-FabV	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
CP028568.1\|AWA04567.1\|77186_77429_+\|hypothetical-protein	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.71224e-18
CP028568.1\|AWA04558.1\|64637_65825_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224992	COG2081, COG2081, Predicted flavoproteins [General function prediction only].	0
CP028568.1\|AWA04568.1\|77582_81041_+\|histidine-kinase	gnl\|CDD\|182169	PRK09959, PRK09959, acid-sensing system histidine kinase EvgS.	8.01985e-126
CP028568.1\|AWA04562.1\|70178_70880_+\|molecular-chaperone	gnl\|CDD\|225663	COG3121, FimC, P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion].	5.08363e-61
CP028568.1\|AWA04564.1\|73473_74571_+\|hypothetical-protein	gnl\|CDD\|366088	pfam00419, Fimbrial, Fimbrial protein.	0.000964796
CP028568.1\|AWA04557.1\|63927_64557_+\|non-heme-ferritin	gnl\|CDD\|224445	COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism].	2.12756e-87
CP028568.1\|AWA04554.1\|59938_60373_-\|universal-stress-protein	gnl\|CDD\|185073	PRK15118, PRK15118, universal stress protein UspA.	1.41472e-43
CP028568.1\|AWA04566.1\|76081_77218_+\|ISAs1-like-element-ISAs12-family-transposase	gnl\|CDD\|379382	pfam13808, DDE_Tnp_1_assoc, DDE_Tnp_1-associated. This domain is frequently found N-terminal to the transposase, IS family DDE_Tnp_1, pfam01609 and its relatives.	1.27187e-31
CP028568.1\|AWA04551.1\|56789_57719_-\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	1.26589e-24

>CP028568.1|AWA04559.1|66011_67232_-|MFS-transporter
MEKSLNTDQPLAAATAHDALNRTTYPVIAAISFSHLLNDMMQSVLLAIYPLLKLGLNLSFAQIGLITLTYQFTGSLLQPLIGLYTDRRPMPYSLPFGMGFTMIGLLSLSQAASFGAVLLSAMLIGIGSSVFHPESSRVARMAAGSQPGLAQSLFQIGGNLGSAIGPLLAALIIVPQGQGSAAWFSLFALVGVIVLSLVGRWSSHHAANFHKRMKAHLGHGLSRRQIGWSLAILGLLMFSKFFYMASLSSYYTFYLMDKFSLSLDSAQLYLFAFLFAVAAGTVLGGPIGDRIGRKRVIWISILGVAPFTLLLPHVDLFWTSVLSVIIGLILASAFSAILVYAQELVPGKVGTISGLFFGFAFGMGGIGAALLGQLADATSIETVYRVCAYLPLIGLLTAFLPTLRKG
>CP028568.1|AWA04558.1|64637_65825_+|NAD(P)/FAD-dependent-oxidoreductase
MMKQFDVVVIGAGAAGLMCAAQAGYRGRSVLVLDNAKKPGRKILISGGGRCNFTNHQAGPHAFLSANPHFCKSALARYTQQDFIELVDRHGLSYHEKTLGQLFCDESAKEIVDILLTECDWAGVALQFQTEILTVSKREEGFVLTTSQGEISCHSLVVATGGLSMPKLGATPYGFKLAEQFGLKVLPTRAGLVPFTLHQAEKEAFADLAGVSLPVAVTAEDGTCFKEAMLFTHRGLSGPAILQISSFWLAGEKIHINLLPELDIAATLREWAQAHPAQELKTVLGRELPKRFVDKLVELGQLVSKPMRQYNERELEAVATLLGDWQILPNGTEGYRTAEVTLGGVDTNELSSKTMEARKVAGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAGQYC
>CP028568.1|AWA04557.1|63927_64557_+|non-heme-ferritin
MRRKAVTTESSGSGIWLLHNETVATIVTKSQWRIIMLAKAMIEKLNEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLRQHAVEERQHMERLFTYVSETGAMPLLGAIDAPPHEFKSLGDIFRTTLEHEYHITKCINGLAHVAFTTQDYSTFNFLQWYVAEQHEEEKLFKSIVDRLSLVGEDGKGLYFIDKELAELAKGAPASIMDGNA
>CP028568.1|AWA04556.1|62032_63823_-|GGDEF-domain-containing-protein
MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDMEQFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQALTLLEQLKTAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPDSTIASLQCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYIDTDRPAQARRLLDNLLANPALAPDYRAIILGYQAMALNAQHDWAGALRTLDEAQALYQQLGYPEAGGRLLETRARALQGSGEKQLALQLLTSQGPAGAGSKALQASLLADQGRYPEAYQALNEYVNDYKQHFNQTLSQHAAAFQAEMDLARSEASNRVLQQENENKRQQLLHQQSARHYQLALVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQWQQEGPLTLLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEFLVAVPLPAADCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMYQAKRQGRNQTILAAEPNNPEQPEALASSVA
>CP028568.1|AWA04555.1|60838_62026_+|enoyl-[acyl-carrier-protein]-reductase-FabV
MIIHPQIQGCVARNCHPIGCRAAVLQQIERIRVAGPFNGPKRVLVLGASSGFGLASRIALTFGAGADTVGVSFERGPSDKGPGSAGWYNNIWFRKEAEQAGRIAINLIGDAFSTGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTGQPFSGWGLDLEQDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQTVAYSYIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAEIGGHAWVSVCKALVTKASAYIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHELDPAIQAAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLSELLP
>CP028568.1|AWA04554.1|59938_60373_-|universal-stress-protein
MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDVDLKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAVRDYQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK
>CP028568.1|AWA04553.1|58733_59747_-|tryptophan--tRNA-ligase
MHNPVILTGDRPTGKLHIGHYVGSLRQRVEAQHHYRQFVMIADLQALTDNGHNPAKVTDHVLEVMADYLAAGLDPAKTTFCLQSALPALAELTTYYLNLVSVARLERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQTNEIVRRFNSLVGKEVLTECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEIKQAVFSMYTDPNHLKVSDPGQVEGNTVFAYLDAFHPDKALVAEMKAHYQRGGLGDMRCKQVLNDCLQTLLAPMRERREAAIADKRQLLRLLQQGTEQARALTDEVLAEVKGAMGLDYFAGLN
>CP028568.1|AWA04552.1|57780_58755_+|LysR-family-transcriptional-regulator
MEMPLSRLDLNLLTVFDMLMQERNVTRAAERMHLSQSTVSHALGRLRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFRIATPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANHLSPRLWREPWFNNPLVCLSPLGSELPDVLGPDDLVSRPHIHTSSWGHSQAMVDLWLARFGVERELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYLMAGHPLTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK
>CP028568.1|AWA04551.1|56789_57719_-|EamA-family-transporter
MHRRITSEIKMRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAAGRALCGSLTLGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVVMGCIPFVTILMAPLLVSGEKITKGGLVSVVIGFVGVLVLFWPKLASGMNAGLLGAMAILFGASCFAIGLLMIKRFAKDHPVVVARNILISSAIQLLLAAPFVTDLSALTMPSQHAIGAVAVLGVFCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGALFLGEQIQSTTGVALALILGSVALNQWAQQRRVQREAALCQAS
>CP028568.1|AWA04550.1|56643_56805_-|hypothetical-protein
MSGILTTLCGGLVVIAGWQYRQRLMGLLGLLMVLLPWFFDSKLQAMLSYALSA
>CP028568.1|AWA04560.1|68751_69699_-|IS30-family-transposase
MRYHQLTEGQRYQIACLHDHGLSQAMIARKVGVHPSTISRELRRNRCAQGYQPAEAHQSATLRRCSSSKYRVPEDTLIFVTMALAADWSPEQISSVCRRIGCPVSHEWIYRYVAQDKANGGKLFRHLRQGHKRYRKGQNAKRCVIPNPVSIDERPAIVDSRSRLGDWEVDTVSGKQGSGAIVTLAERKSRLYLVQYVPAKTAAAVADAIICMLEPYKAHVHTITADNGSEFVEHERVAKVLNAQFYFAHPYSAWERGLNENSNGLLRQYVPKGSDLSQLSPDELSAFERRLNLRPRKCLDFRQPQIVFDELRQVA
>CP028568.1|AWA04561.1|69839_70115_+|hypothetical-protein
MALMPNVGSTEGKLLKNIDISNEAAHGVGIVVLDNRNKALDFESGAVYLDAPLKEGNARIKLSAAYAKDTTEEKVTPGAVSAVLPFVLTYE
>CP028568.1|AWA04562.1|70178_70880_+|molecular-chaperone
MKKLYIGAILFILGGISYASASISLSATRLIYNQKDNEVSINATNDGEQDVLIQSWLEAFDNSAPPFAITPPLAKISGKERQLLRVFYQGDGLPQDRESVLWLNVQEIPKESSSKNSIQLAILQRIKLFYRPEALSGNALSAPLNVKGYFSGGSLELSNTTPYHINLVSIQQGNNVVKAEMISPYDAVNFDVRKFKSNGVVTLRVVNDYGAARTIKGVLKSGKLCDLKFAKDD
>CP028568.1|AWA04563.1|70973_73454_+|fimbrial-biogenesis-outer-membrane-usher-protein
MLLRAKKLLTLATIIVLAVISQSVSGQVVSNVKQNKNARFNTAFLHGDRIDIDKLFSSPDIIPGVYRLELFLNNEFSSMENIHFATVNGKVKPCIPSELMERLGVNFAGLEDILYFHNNVQCVSIEKVEYANWRYEERTQRLYLSMPQSRFYHKYKGYISPELWDDGVIAFYSNYSIQSRYDHASSSGSHNSNTVILNNGFNIMAWRFRNQSNLTGQDGNSSWRSERTYLEHDLPDWSSQISVGEIYGRSDVFDSPSLRGVQVRSDESMLPDELRGYSPVVTGIAETNATVEIRQGGIMVYSTTVAPGPFELRDIPTYGSNGDLEITVIESDGRRKAQTQGFGMLPVMVRAGVGRYQYSFGQLEHESLAPSERWYFSADGAYGLLSDLTIFGGIQGMKNYGAINGGIGFGTRFGSLSVDVTHSDSSSLEGHHSGESYRFRFGRVFHDAGTTLALAGYRYATEDYRSLNEHITSSSHNITASHRYSLRSELSASVTQQLPSEWGNLNLSASEQDYWDNSQRSRTLSGGYGNYLGKLSYQVNVQHSYSQTSGDTQLMLYATYPLSFGGGSHSISFSSSHNKGENERAQRTSVGLSGGWDDYSYSISASNDQHGNNSLSASSYINTAFGSGGGGYSHGREYSSFNANWNGSVVAHAGGLNFGPVVQDGFILAEVKDVEGVGFRNSKATTGRNGFAIIDQATPYRRNEITVDTQTLPTGVETATGNAYVVPRRGSISKVSIQARSVQRVQFTLLNEEGKHYPFGTQLESKYGDILALADPNGRALAVIDRTVKSFVIREPSGRACIVDYKISGRARITTRYERAVLQCTQ
>CP028568.1|AWA04564.1|73473_74571_+|hypothetical-protein
MAIMRLFLYFLLSLFPFSVIAEGCGNINPNLVSSSSGACEINEVHPYYMGDAISVSDPEGTKVGDVMLRYKFTCMLPYDSSGHNDNYMQLGLDVRKDVSAGDKIRTTLDQRIFMKADLQKLAGQYGYIIPSIIAAPEEHGGGAGATKIRAKEVVINGKKYWCGHDQNDKVILSAYRGVGVIEPGENRLSTYSKADFVMGHFTGSGSTKPIGQSLGDFMITIGNATCKFRNSNGDITVNINNGAPMSSDEFDKIVTNFDVPLECSSVQMDVKYKIKIQNDVGRAAEGIFGLTPAVDGASGVGYKLSRVENGAVTKAMDLSRSLHIERKGPDMRAYDLSFSVSPIKLGNNVVPGNADATLLLELDYD
>CP028568.1|AWA04565.1|75357_75879_+|DNA-binding-response-regulator
MAKVLIVDDHPAIRLAVKYLLEQAQHEICGEVDNGVDAIQEFRMKSPDIVVLDLGIHRLDGLEVIKRIKTINVSAIIIILSTHNSRHVMLRCYQAGANGFVSKLEDLQQLRAAIDECSKGGKFFQSYILEQDKSSSGIDIIALERLSDQGEIVNILLKIKNSFLPTKQILIGL
>CP028568.1|AWA04566.1|76081_77218_+|ISAs1-like-element-ISAs12-family-transposase
MSIDAVFAQFFDNIHDPRQHAKIYYPFYDVLFLTVCAVIGGAEGWEDIEDFGEVHLPWFQSKGLFKNGIPVHDTIARIISGIKPEPFQAAFVRWTQAINQHTDGALVAIDGKTLRSSYDREDRTSTIHMVSAYAAANKLVLGQIKTDAKSNEITAIPELLALLDIKGCLVSIDAMGCQTEIAETILQQGGDYLLAVKGNQPKLFEAVRQALAPLAATPLCAETMTLEKAHGRIDGREYHVMAAGELAAQFPHWKQLHSIGVAISYRVENMQKITIEQRYFISSKALVQDEFARAVRGHWAIENSLHWVLDVTMGEDDCPIYRGDAAEILACIRHMGLNMLRAETSRKASVRRKQKIAGMSSEYLETVLNAGLKKLGEI
>CP028568.1|AWA04567.1|77186_77429_+|hypothetical-protein
MRVSKNWVKFNKMFTLSPWLSDREMNVFLAICQGKSNKDIAENMLLSEKTISTYKTRLMKKLAVENMVELLELAKRTHII
>CP028568.1|AWA04568.1|77582_81041_+|histidine-kinase
MQKQWLAKKVKLVLAVSQLDSPPLDVIRRKTLDGFIYEGVNADFSNVIASSLNAVIEVKSYRSRQDAMQAVINGDADFISSVRESEDSNEIALTQPYLKDAFSLYKRIGLQDRDIKKVALVELSIPRHLIRKYLPNVDIEYFPSPYSAVAAAVYGNVDAVLIDSISGNFIKNKFYNGLLDTGKEIVEEDQGLSFATVQENNILQGILDVALLNLPHIYRVTILKRWNGGKMSVLDGVGITDEDKSALRKKSPITIAINTNIPPLSYIDKNGNYAGVMADILQHVANKLAVDFDILQVSSYVDAIRAVESGNADLIFMSPSPSRWRQFVFTRSFIFEPVVYLVRSHNVGRIYLDNMTHGGSLAVLDRDILSSVLINDEFTKNTIKFSQLEDALSCVLNGKCQAIVLPLSVARYFSDVKYSGRLAIAGEAFQSTPFGVGFAGTTENRNLIETLDKVISLIPPDGLNSLEGFREVSVKRSAITWWDLYQDFGVAISISIIIISWVLLWSVSLRKQIKLRRAVEADLNTKLNFIQELVDSTPHPVYSRDDAGRLTLCNHSYSAFLGEDKKTLLGTIFSETESRWPYLKPLLQVYEDSICDGLPRHDDYTLWLENRKVHLYHWLQPIRDSTGQVNGVVGGWIDVSERIRLLDELAAASQEAQKSNRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLHEEDKTSLSIAHGSARDLLSLIGDILDISKIESGRLELRPEPHEIAALTASVVTVFTALARQKNLQLELAAGEPRWVQIDGICYKQILSNLISNAIKYTEQGSVRVELQSKTSDGWCTLQLVIRDTGIGIAPVEQARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLLLESEPGHGTCISIEMKLPLASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQQLAYLGHDATAAESGREALALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTHRCLILGLTADARQEQVSEGLTAGMDDCLFKPVGLEELERCLCRHMQHQEQREIERCVQEIKQCLGPLTGNQPALMLPLLHEFVRASDDDLLGLQQAAEGGELARFLDYVHRLKGGARIMGAMTLVAVCGEIESGGIAPQGLPMALRQLQHAYGIVRQAMVQMQAEPE
>CP028568.1|AWA04569.1|81076_81517_-|hypothetical-protein
MSQKGVLVALLAGCCAMAAQAGTHTYQLNWPATASKSTGMEISLTHPGQQPVNSVSTSSPVQAEAINVSNPDFNTTYQLQARTLYASLPEQAGTDFKLALNGQPLPRHHALPLTQATRYFLSYLAPAARPDQTGEAAYELLVYWHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028568_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028568_2

740111-740215

Orphan

Consensus_repeat	Method
GGTGACATGAGTCGTTTTCAGGCCATTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028568_2

>merge|CP028568|2|740111-740215|CRISPRCasFinder
GGTGACATGAGTCGTTTTCAGGCCATTGCACTGGAAGCGGGACTGTATGGTACCCCAGCCGTTTCGACATTTTGGAGGTGATATGAGTCGTTTTCAGGCCATTGC

>CP028568|2|2|740111-740215|CRISPRCasFinder
GGTGACATGAGTCGTTTTCAGGCCATTGC	ACTGGAAGCGGGACTGTATGGTACCCCAGCCGTTTCGACATTTTGGA
GGTGATATGAGTCGTTTTCAGGCCATTGC

Protein	Signature genes	Signature genes Name	Protein_function
CP028568.1\|AWA05125.1\|734191_735196_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190
CP028568.1\|AWA05130.1\|737107_737584_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
CP028568.1\|AWA05143.1\|751802_753956_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP028568.1\|AWA05135.1\|741836_742676_+\|isopenicillin-N-synthase-family-oxygenase	unknown	unknown	gnl\|CDD\|226022
CP028568.1\|AWA05139.1\|746711_748337_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381139
CP028568.1\|AWA05124.1\|733618_734062_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240034
CP028568.1\|AWA05131.1\|737892_738513_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
CP028568.1\|AWA05128.1\|736328_736556_+\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA05123.1\|732229_733381_-\|chorismate-binding-protein	unknown	unknown	gnl\|CDD\|273350
CP028568.1\|AWA05126.1\|735278_735755_-\|organic-hydroperoxide-resistance-protein	unknown	unknown	gnl\|CDD\|274649
CP028568.1\|AWA05132.1\|738678_739920_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340888
CP028568.1\|AWA05141.1\|749141_751235_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA05138.1\|745376_746690_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
CP028568.1\|AWA05142.1\|751295_751760_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA05134.1\|741064_741628_-\|DNA-repair-protein	unknown	unknown	gnl\|CDD\|378521
CP028568.1\|AWA05129.1\|736701_737019_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225653
CP028568.1\|AWA05137.1\|744204_744921_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270422
CP028568.1\|AWA05136.1\|742890_744204_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
CP028568.1\|AWA05127.1\|735798_736293_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP028568.1\|AWA05140.1\|748446_749172_-\|DUF3142-domain-containing-protein	unknown	unknown	gnl\|CDD\|371478

Protein	Function_ID	Function_description	E-value
CP028568.1\|AWA05135.1\|741836_742676_+\|isopenicillin-N-synthase-family-oxygenase	gnl\|CDD\|226022	COG3491, PcbC, Isopenicillin N synthase and related dioxygenases [General function prediction only].	1.99068e-38
CP028568.1\|AWA05130.1\|737107_737584_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.22775e-48
CP028568.1\|AWA05143.1\|751802_753956_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	4.86578e-99
CP028568.1\|AWA05125.1\|734191_735196_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	2.53953e-171
CP028568.1\|AWA05139.1\|746711_748337_-\|hypothetical-protein	gnl\|CDD\|381139	cd17624, REC_OmpR_PmrA-like, phosphoacceptor receiver (REC) domain of PmrA-like OmpR family response regulators. This subfamily contains various OmpR family response regulators including PmrA, BasR, QseB, tctD, and RssB, which are components of two-component regulatory systems (TCSs). The PmrA/PmrB TCS controls transcription of genes that are involved in lipopolysaccharide modification in the outer membrane of bacteria, increasing bacterial resistance to host-derived antimicrobial peptides. The BasS/BasR TCS functions as an iron- and zinc-sensing transcription regulator. The QseB/QseC TCS activates the flagella regulon by activating transcription of FlhDC. The RssA/RssB TCS regulates swarming behavior in Serratia marcescens. OmpR family DNA-binding response regulators contain N-terminal receiver (REC) and C-terminal DNA-binding winged helix-turn-helix effector domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	0.000826174
CP028568.1\|AWA05124.1\|733618_734062_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240034	cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.01726e-51
CP028568.1\|AWA05131.1\|737892_738513_-\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	1.14517e-53
CP028568.1\|AWA05123.1\|732229_733381_-\|chorismate-binding-protein	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	4.46728e-66
CP028568.1\|AWA05126.1\|735278_735755_-\|organic-hydroperoxide-resistance-protein	gnl\|CDD\|274649	TIGR03561, organ_hyd_perox, peroxiredoxin, Ohr subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein. [Cellular processes, Detoxification].	3.39776e-57
CP028568.1\|AWA05132.1\|738678_739920_+\|MFS-transporter	gnl\|CDD\|340888	cd17330, MFS_SLC46_TetA_like, Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.44462e-41
CP028568.1\|AWA05138.1\|745376_746690_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	1.7728e-167
CP028568.1\|AWA05134.1\|741064_741628_-\|DNA-repair-protein	gnl\|CDD\|378521	pfam10973, DUF2799, Protein of unknown function (DUF2799). Some members in this family of proteins are annotated as yfiL which has no known function.	6.33836e-28
CP028568.1\|AWA05129.1\|736701_737019_+\|hypothetical-protein	gnl\|CDD\|225653	COG3111, COG3111, Periplasmic protein with OB-fold [Function unknown].	0.00960974
CP028568.1\|AWA05137.1\|744204_744921_-\|hypothetical-protein	gnl\|CDD\|270422	cd13704, PBP2_HisK, The periplasmic sensor domain of histidine kinase receptors; the type 2 periplasmic binding fold protein. This subfamily includes the periplasmic sensor domain of the histidine kinase receptors (HisK) which are elements of the two-component signal transduction systems commonly found in bacteria and lower eukaryotes. Typically, the two-component system consists of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. The two-component systems serve as a stimulus-response coupling mechanism to enable microorganisms to sense and respond to changes in environmental conditions. Extracellular stimuli such as small molecule ligands and ions are detected by the N-terminal periplasmic sensing domain of the sensor kinase receptor, which regulate the catalytic activity of the cytoplasmic kinase domain and promote ATP-dependent autophosphorylation of a conserved histidine residue. The phosphate is then transferred to a conserved aspartate in the response regulator through a phospho-transfer mechanism, and the activity of the response regulator is in turn regulated. The sensor domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space through their function as an initial high-affinity binding component. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.76243e-15
CP028568.1\|AWA05136.1\|742890_744204_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	2.87123e-165
CP028568.1\|AWA05127.1\|735798_736293_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	6.60573e-22
CP028568.1\|AWA05140.1\|748446_749172_-\|DUF3142-domain-containing-protein	gnl\|CDD\|371478	pfam11340, DUF3142, Protein of unknown function (DUF3142). This bacterial family of proteins has no known function.	7.88709e-15

>CP028568.1|AWA05132.1|738678_739920_+|MFS-transporter
MEGIKGQASLWVLVMTVTLAVAGFSLPSPVLAPLMLDPAQGMLTPEASDWSRKVWLGVIMGLYPLFQLVGAPWLGKLSDRHGRKPVLTLCLVGVLVGYALMALGIAWRSLPLLLLSRVVEGFFNGDIAIVQAMAADMSTAKTKARSFAWINIGMNLGWVVGPMIGGYAAVVSGDYSLAAWLAVAMTLINLLLVLWLLPNRPAAARSEQPPPALSSRQLLLQPALLPYFVLTLLSYGAVQLYFTYFNVWLVERLAWDPVQLAQAAVLVSVPMILGSWLGSRLARHWRGSSLGVVGHLVMAAGMLMFVLPGHWWGLALTFIPTGIGMSLGELATSVAVSNRSHAEQQGQAMGLYRGLAVGSEILAVVVGSLVLLAGTEWPFYLATLCSLLCAVGFYGLRRAADRRQRLDVQVEAG
>CP028568.1|AWA05131.1|737892_738513_-|transcriptional-regulator
MNASTDKILFLLKSHGPQSAAELGEQLQMTSMGARQHLMTLEADGWVSFNDEARGRGRPVRLWHLTEQAWQRFPDSHSELTLQLIDNIQQLFGEVGMERLIAQREQQQLARYQAELTQPALADRLAALTAQRTREGYMADFRQEEDGSWLLWESHCPICAAARACRGFCRSELEMFRRLLAPAGVEREQYLLEGDHRCLYRIRPQP
>CP028568.1|AWA05130.1|737107_737584_-|Lrp/AsnC-family-transcriptional-regulator
MLKLDRIDRHILELMQENGRISNLELAELVGLSPSPCSRRVKALEDAGLIDTHVTLLNARQLGLTLTAYIHISMDRHTPERFENFDRAISELPEVLECDLITGNDADYQLKVVVRDMEHYQHFLLDKLTHIPGVTGVRSSFVLRRIKHKTALPLNHLG
>CP028568.1|AWA05129.1|736701_737019_+|hypothetical-protein
MQSSLVGLSILWGLASFGVQGDFIESRDSVAPSWQAESRVEMEGYLIESLGEDRWLFDNGSESLLVSLPQGQWVPTGERLRVSGEPQQEQAGWLLQVQDVSQVAV
>CP028568.1|AWA05128.1|736328_736556_+|hypothetical-protein
MKLLLPLFALLLTACSTGSHAPSMAIDDADAWQAICKDGTRVRAVVEEGICADHRGVAMWTNKPRAARMAEEAAK
>CP028568.1|AWA05127.1|735798_736293_+|MarR-family-transcriptional-regulator
MCANYSTPDFPGVYWPQSSARCPMSELKKQVCFALYSASNAVMRAYRPLLDKLDLTYTQYLVMLSLWARDEVSLKEIGQETGLDAGTLTPIVKRLESKGWLTRTVSSEDERQKCIGLTEAGRQLQQEVRECCLADNLRNQVDLADAELAQLKQLCDRISAQLGR
>CP028568.1|AWA05126.1|735278_735755_-|organic-hydroperoxide-resistance-protein
MHTNKIRDPDMKTLYRTQAIAQAGRNGEVHTLDNSLQLALALPTALGGNGKGNNPEQLLAAGYAACFSNALIHVAHKLGAPLSSAPVTAGIELLALDDGRFNFAITLDVALAATQPEQAAQAEQIVRLAHQTCPFSNAMRGNVVTRLLLNGAPLDETA
>CP028568.1|AWA05125.1|734191_735196_-|NADP-dependent-oxidoreductase
MNQSSHQIQLLRRPVGLPSLADFTLTEVALPELQAGEVRVANQWLSVDPYMRGRMSEAKSYVPPFPLNGPLDGGAIGVVEASRHPDFAVGDRVSSMLGWRDRFVANGAQLTRLPDTRLPPQLFLGALGMPGMTAWTGLNRIAKLQAGETVLVSAASGAVGSMVVQLAKRAGARVIGSTGSADKVAYLKSLGADEVINYRETPDLDAELARLAPEGIHVYFENVGGAMLDAALNHMVVHGRIVMCGLIEQYNGQSEASGPRNLSQVIRKRLTMQGLIVFDHWQHYGEFLAEVTPAFDAGTLQAEETVYQGLASMPQAFIGLFEGRNTGKMLVKLT
>CP028568.1|AWA05124.1|733618_734062_-|NUDIX-domain-containing-protein
MSTPYPRVGVGVILTNRQGQVLLGKRKGSHAPYWSIAGGHLELGETFESAAIREVAEETGFQISNPSVIAVTNNLETWRESGLHYVSVTLLAGVEGEPQLLEPEKCEGWVWCDPRNLPEPHFDASRQSIACWLADRCYLPTPNQPTP
>CP028568.1|AWA05123.1|732229_733381_-|chorismate-binding-protein
MGQVFIQFLWLGCVSFGGPAAHIGYFQRTFVERLGWLTQAEFAQLLALCQLLPGPASSQLGFAIGRQRAGLAGALAAFAGFTLPSFLLLLTAAIGLGQLGNNVWLDATLHGLKLLALVVVADAVLTMSRQFCKTTRNQGIMVATAAALWWQPGLLTQLVMLAGAALLCARVGEPQTPGPQPSPAQSIPVHQPHWPTLLLFALLFVGLPLLGGPVGQLVADFYRAGSLVFGGGHVVLPLLAESVGHSLNQQQFLTGYSLAQLVPGPMFTLATYLGAQLLPATPVGGALLATLALFLPGFLLLWAMGPCWQSWLARPRLAGTVAGINAAVVGLLLAALYQPVWQSAVLAPTDLALAAIGFYLLRGLKLPILALATLLVVATLLLA
>CP028568.1|AWA05134.1|741064_741628_-|DNA-repair-protein
MSPKILLLTLPFLLAGCSSLSEEECRTMSWYNLGYQDGEQGKTRAATRDYVSTCGEYGLKVDEAEWKRGYTKGLELYCIPELAYSKGKSGAEYQGVCPNDASFLTQYDRGRQEYLVEKQLSDLKSDMERTERDIETLERQIRNENDSKQRDYYRAQRERAIRHYEGLRRDYNRIRFPDRVIQFSFGN
>CP028568.1|AWA05135.1|741836_742676_+|isopenicillin-N-synthase-family-oxygenase
MKVLTVDYRSPDAAQRFTESLRTTGFGVLTNHPIPKELVQSIYDNWYRFFMSEQKQDFLFNRETQDGYFPPSVSEVAKGHSQKDIKEYFHLYPWGQMPAELKEQAMEYYRLANNLAAELLGWVEQYTPSDIAAHYSCPLSSMIEESQKTLLRVLHYPPFDGTEELGAIRAAAHEDINLLTILPAANEPGLQVKGSDGEWMDVPCDFGTLIINIGDMLQEASHGYYPSTTHRVINPTGGSAAKSRISLPLFLHPRPDVVLSERHTAHSYLMERLRELGVI
>CP028568.1|AWA05136.1|742890_744204_+|sodium-dependent-transporter
MKQSQWSSRLGYILAAAGSAVGLGAIWKFPYVTAANGGGAFLLVFLLFSFTLGVAVLMGETLLGSLSRRGVVGAFGELMGKRWRWVGAMGLLSSLLIYSFYSVVGGWTLGYTGMALAGSLQHGDGAALTARFNDYVGDPLWPVLTHLLFAGLTWWFVQGGVQKGVERTLRWMMPALFIMILMLVAFGLTLPNAMAGVRHFLMPDFSKLGMSGVLDAMGLAFFSLSIGLGIHTTYGAYLPSSDGVGRSSLWVVLLASLIAVLAGLMIFPVLAATGIDPASGPGLTFMTMPAVFQQLPFGQGLAVVFFALLVVAALSSAISLLEHLQCFVSESLGWSRRAACGLITVLVMAGGIPVSLSFGPWAQVTLFGKNIFELLDFVTSNLMMPMFGLALTLLLGWKLGRQALPAGLALHWRTLVMGCWRWLAPLLIGGILVRGLV
>CP028568.1|AWA05137.1|744204_744921_-|hypothetical-protein
MKWLLPWLLLPGLAQATQPPLTLLSHELPPFTHTSDGKLGGLAVQLVQEAQQEMGVDYPIKIYPLKRALALTRVEPGFALFVILRTPQREPQFKWVGPLFLNRVVIYQGRGSQPLTDLAQLRQLARVGVLLGNADDELLTREGYTNLVRCQTIEDAIERLMLGKIDAFPMGEQIMPAILAKMKFSPRSVVNSGLLLQENWLYIVFSKSEDDAVIARWQAAIDKVRDRHPQPQQPIRQP
>CP028568.1|AWA05138.1|745376_746690_+|sodium-dependent-transporter
MSQVQWSSRIGHVLAAAGSAIGLGAIWKFPYVTATNGGGAFLLMFLLFSFTLGVAVLVGETLLGSRSQRGVLGAFHKLVGPNWRWMGYMGILCGFFIYSFYSVVGGWTVGYAALAVSGQLNLSEGTALTALFNGYVSHPWWPVLTHLVFAGLTWWFVQGGLQKGVERALRWMMPALFVMMMLLVVTGLSMPGAMAGVRQFLLPDFSMLTGQGVLDALGLAFFSLSIGLGVHTTYGAYLPSSEGVLRSGVWVVILASLISVLAGLMIFPVLASTGIDPTAGPGLTFMTMPAVFNHLPFGQGLAVVFFLLLLVAALSSSISMLEHLVRFTTEEWGWSRRGACRVLTLLIMASGIPVSLSFGPWSELTLFGKTIFDLLDYLTSNLMMPLFGLVLTLLLGWRLGESVLPDGLSPLLRGCLLWCWRLVAPLLIAGILVRGLL
>CP028568.1|AWA05139.1|746711_748337_-|hypothetical-protein
MQILLIEDDTMLSMALCQGLSQQDIASSQLTHCKEIASLPTLLRQQPFDAIICRQNHHQGQEGIRMLQEAHYLGLLEPGCVLLLLDADLDLQQYPPSDLYFPLQLAIPFTADQLTAILRELVLLTGLTRALPAPMRLREWQVSCALCEDLLYQQQKYRELGPLLDRIKGYMLLQQQNYFHAAQHYAVCTTEHDAWWPRKGLIHALLGLGKLESARKDLARNRERLPAPLQLELALACLLHERQWEGAWDVLTLLLQKQAWQPEWRQAAILLALLLKDEGKALEQANALSLRFFGDHKFRVSIENFILNASLAVLWHYPSAARISALQQEYRYLSQAVTLRAHEEALLKALMLSLDYRFDEALLLLAKHPPESARDHHLNQLLGFAVSQFCGLPHHAQRYLSQLSQYQARVAPAPLVQQLFKQVIGDFMKQLERRELRLTYLRQERQRASAAGQHQLAVQYALTLQEEFPALPGDAWQLLELLQLCWPAGMAAPRVALLVDRLERRLNHSASFMEHHAKEYHKTLLQIRSHLNPRLPTTPPN
>CP028568.1|AWA05140.1|748446_749172_-|DUF3142-domain-containing-protein
MGQAAQILLVMLALLGAEASAAVEASHYRQFWLWAGVRPQPELQQAERLYLHQGEIGPLDARQPVRFQGQGIAPSKLPVKELWLAYRVERLDWDEALLKNLTNQLAAWQRKGNGVRGVQINFDARTHRLADYGDFLRQLRRQLPADCAISITGLLDWTRTGDVTTLNALAGVVDELVVQTYRGRRTEPGYARYLQALTRLTLPFKVGLVQGGEWDPTWESRLADSAAYGGAVVFLINPSGA
>CP028568.1|AWA05141.1|749141_751235_-|hypothetical-protein
MPASRLLLEAPMKLTPLWLALCSLPALACGPDGCETPLTLQLTAAQCHLNGLPFLSPDNDTRTNLALLLADEQAFSLPKAPLPLPFAIEDLLNPALLNPTQAEPAPAVPDPLLALAAGLGIEQSTTQAALERAAGWSEGRCISNNPVAAEAFLQALVDTSALGADERSQLARQRLAMLGQCAQQIETAPEDKAMPLSAAGQGFADYLAASQRFYQGEFAQADTLFAALAGQDQPWLKETADYMRIRVALNQSQQSAFDDWGTLDRNQIDQAAVQRAEQFIADYRSRYPEGRYLDSANGLLRRLAWFKGDEAALAGLFLQASRQPGNPELLNEIDLKLLMQPGFTGSAAMPQLTLVQDLRRLRLHESWDEWQPLQSGELAQQSAQFASTPAWLAYLQQAERYYLAKDYAAVIAAAPALGKGPLDNLAFSQQVLKGMALAASQALSEAEQQWRALLASQPTPLQDQLLQLALAMTLERAGRLEQVFAKESPIQSDHYRIPLLEYVAPAPLLRRMVQDEQASDTLRQRAGHTLRYKQLTHGDYRGFLQDLALAPLATPFDWQGSQEYQCPALTAVVTTLADNPKSPKALNCLGEFFLSQGLDWDPLLQRPGADTLAGSRDLFAGQQRSRLDWYQQVIASPKAAKEEKAYALYRAINCYAPSGNNSCGNQEIPLSQRKGWFNTLKRQHGTSQWAKQLKYYW
>CP028568.1|AWA05142.1|751295_751760_-|hypothetical-protein
MHPTRAPLLLLTLLLGGCATPGHQQLGAALSGLEGELQRLEEELAAMNGLHYQKAIDAPLSLRRRLSAPVPTAQGLRPSRSTLTDGPLLRYDYRLPAGMASLPLAEPCLRYEFELRHLGRLGQLTLHWQGAAGSGEQLIQQRDCPFSAKGPGLQ
>CP028568.1|AWA05143.1|751802_753956_-|PLP-dependent-aminotransferase-family-protein
MPVRQGRRCTFFASLCGLWRHSVPEHHHAERGQRPQAAVEPAPASVRVDPAAELMTEQHPGKADWQSGHGEDRHDAPQTRPVSTARQTEQTDGGDPHHPGLGVEELKAQPLQQGQRARTSLRIAGGAGHRDAPCQPQQIEAAQHLQAQLEQRPTLEQGVEPQRQHQLQDGLSHHDTDQMGQGATHPEVGAGGGQHEVVGARRAAGEQRKAKQGGIPFDRHLCTPELRTLYRYNVPLLVVIGFKFTLYCRYISINGFIVTMTIWTPDLTPFAGPLYLKLVKAIEQAIQDGSLPPETRLPTHRALADKLGVTVGTVTRAYGEAERRGLLAARVGHGTWVKGDHEDPANAWVIRKEEGHRIELWQNLPVQLDRAAIIRPMLAEVADGDLNALLGYDKEAGQPSQRQLFIDWLAEQGVAGSEEYLLFSHGAQHGIMLSLLATGCVGETLFCEGLSYPGMLGNARQLKNQVVGLAMDAEGLLPDALEAACRTRRAKLLYLTPTLQNPTTATMSLARREAIVAIARRHDLLIIEDDVNGLLPQQPVTPLVNLAPERVIYLGSLAKIACGGLRVGFVLTPPALRGAFAQAMRLSSWMVSPLLIELACKLVSQRQIMPLVEQQRQILARRGELLRHLLPGACWQAGSMHAWLPLPEPWRSQEFAEAANALDVGVASGEHFAAGQFAAPQGVRLSLSQPATDARVAEGLERLAGLLRAAPPTNTLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028568_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028568_3

1420416-1420497

Orphan

Consensus_repeat	Method
CGTGCCGTTTGTGAACAGGAGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028568_3

>merge|CP028568|3|1420416-1420497|CRISPRCasFinder
CGTGCCGTTTGTGAACAGGAGGCGTGATGAGGGAGTTATCCACATTTGCCGGCCCCATGCGTGCCGTTTGTGAGCAGGAGGC

>CP028568|3|3|1420416-1420497|CRISPRCasFinder
CGTGCCGTTTGTGAACAGGAGGC	GTGATGAGGGAGTTATCCACATTTGCCGGCCCCATG
CGTGCCGTTTGTGAGCAGGAGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP028568.1\|AWA05706.1\|1422263_1423439_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
CP028568.1\|AWA05704.1\|1418687_1420205_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143434
CP028568.1\|AWA05696.1\|1410037_1410511_-\|transcriptional-regulator-SlyA	unknown	unknown	gnl\|CDD\|179596
CP028568.1\|AWA05695.1\|1408980_1410036_-\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
CP028568.1\|AWA05698.1\|1411566_1412874_+\|citrate:sodium-symporter	unknown	unknown	gnl\|CDD\|377030
CP028568.1\|AWA05714.1\|1430151_1431054_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|183967
CP028568.1\|AWA05712.1\|1428741_1429548_+\|M48-family-peptidase	unknown	unknown	gnl\|CDD\|320690
CP028568.1\|AWA05710.1\|1425931_1427227_+\|two-component-system-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|182895
CP028568.1\|AWA05709.1\|1425233_1425923_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
CP028568.1\|AWA05701.1\|1416025_1416718_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
CP028568.1\|AWA05703.1\|1417818_1418625_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
CP028568.1\|AWA05697.1\|1410829_1411021_+\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA05699.1\|1412885_1414436_+\|oxaloacetate-decarboxylating-malate-dehydrogenase	unknown	unknown	gnl\|CDD\|237414
CP028568.1\|AWA05713.1\|1429535_1430042_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP028568.1\|AWA05700.1\|1414453_1416022_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
CP028568.1\|AWA05707.1\|1423438_1424593_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP028568.1\|AWA05711.1\|1427603_1428578_+\|phosphate-binding-protein	unknown	unknown	gnl\|CDD\|273991
CP028568.1\|AWA05705.1\|1420500_1422177_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225822
CP028568.1\|AWA05708.1\|1424633_1425131_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
CP028568.1\|AWA05702.1\|1416815_1417715_-\|EamA/RhaT-family-transporter	unknown	unknown	gnl\|CDD\|273359

Protein	Function_ID	Function_description	E-value
CP028568.1\|AWA05706.1\|1422263_1423439_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	0
CP028568.1\|AWA05704.1\|1418687_1420205_-\|aldehyde-dehydrogenase	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
CP028568.1\|AWA05696.1\|1410037_1410511_-\|transcriptional-regulator-SlyA	gnl\|CDD\|179596	PRK03573, PRK03573, transcriptional regulator SlyA; Provisional.	1.05279e-33
CP028568.1\|AWA05695.1\|1408980_1410036_-\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	2.347e-65
CP028568.1\|AWA05698.1\|1411566_1412874_+\|citrate:sodium-symporter	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	2.51347e-159
CP028568.1\|AWA05714.1\|1430151_1431054_+\|transcriptional-regulator	gnl\|CDD\|183967	PRK13310, PRK13310, N-acetyl-D-glucosamine kinase; Provisional.	3.16053e-109
CP028568.1\|AWA05712.1\|1428741_1429548_+\|M48-family-peptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	1.29687e-86
CP028568.1\|AWA05710.1\|1425931_1427227_+\|two-component-system-sensor-histidine-kinase-PhoR	gnl\|CDD\|182895	PRK11006, phoR, phosphate regulon sensor histidine kinase PhoR.	0
CP028568.1\|AWA05709.1\|1425233_1425923_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	1.37954e-135
CP028568.1\|AWA05701.1\|1416025_1416718_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	1.67073e-63
CP028568.1\|AWA05703.1\|1417818_1418625_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.48111e-27
CP028568.1\|AWA05699.1\|1412885_1414436_+\|oxaloacetate-decarboxylating-malate-dehydrogenase	gnl\|CDD\|237414	PRK13529, PRK13529, oxaloacetate-decarboxylating malate dehydrogenase.	0
CP028568.1\|AWA05713.1\|1429535_1430042_+\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.46736e-12
CP028568.1\|AWA05700.1\|1414453_1416022_+\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	2.63621e-113
CP028568.1\|AWA05707.1\|1423438_1424593_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	5.64919e-159
CP028568.1\|AWA05711.1\|1427603_1428578_+\|phosphate-binding-protein	gnl\|CDD\|273991	TIGR02136, ptsS_2, phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975. [Transport and binding proteins, Anions].	2.20214e-86
CP028568.1\|AWA05705.1\|1420500_1422177_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225822	COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription].	1.08712e-124
CP028568.1\|AWA05708.1\|1424633_1425131_+\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.20646e-37
CP028568.1\|AWA05702.1\|1416815_1417715_-\|EamA/RhaT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.44782e-19

>CP028568.1|AWA05704.1|1418687_1420205_-|aldehyde-dehydrogenase
MIYTAPGQAGALVSFKSRYDNFIGGEWVAPRAGRYFENISPVDGKVFCEVARSDAADIELALDAAHKAFASWSKTSVTERSNLLLRIADRIEQNIEVLAIAETWENGKAVRETLAADLPLVVDHFRYFAGCIRAQEGSAAELDQNTVSYHFKEPIGVVGQIIPWNFPLLMAAWKLAPVLAAGCCSVLKPAEQTPVTIMLMMDLIKDILPAGVVNVVNGFGAEAGQALATSNRIQKLAFTGSTEVGAHILRCAADKLIPSTVELGGKSPNIYFADVMQHESSYIDKAVEGMLMTFFNQGEVCTCPSRALVQASIYDDFMDKVLARARTIVQGNPLDTATQVGAQASREQFDKILSYMEIGRGEGAKMLIGGGPARVSGLEGGFYIQPTIFSGQNKMRVFQEEIFGPALGVTTFKDEAEALAIANDTQYGLGAGLWTRDSNLAWRMGRGIQAGRVWVNCYHAYPAHAAFGGYKKSGIGRETHKMMLDHYQNTKNLLVSHDINPLGFF
>CP028568.1|AWA05703.1|1417818_1418625_+|AraC-family-transcriptional-regulator
MAIRHYHPTDLHLPEPNPLYLRYQQIQAESACAPHSHPWGQLSLISLGVMEIVLDDHRLVAPADYLIWVPADLEHASYNQQALDYTSIYVNHALAARLPAEPRLLQMTPLIRAILADFCDRKLGHMEDEWDVRQAELLVEKLTRTRCQDSYLPMSQDKLLAPMLAALHSDPADPRTLAQWAEQLHTTERTLARRCVRELGMNFGQWRARLKLLKALAWLKGELPVQEIGWRLGYGSTSAFIAMFNRELGCSPQRYRQQLGIGAGQAAL
>CP028568.1|AWA05702.1|1416815_1417715_-|EamA/RhaT-family-transporter
MRIFYPLMFPLLAVLIWATNTVVSKAAADVLDPAAISFYRWVIAALALTPFCLPQLWRRRGEIRPWLGKLLVLAALGMVLYQCLAYYAAHTTSATNMGVIGSLIPLLTLLQSALFFGQRPGKQALLGMSISLFGVFWLLSLGQPLALLHDGINQGDGLMLLGSASYALYGLLIRRWQLPFGPWLNLYIQILLAVLLLIPVALCAESLAVPAEGWGLVLFAGIASSLFAAYCWMRGLACMGAERTSVFMNLMPLCTALIAVISLGEPIHGYHLLGGGLILAGVMLSQFKPKARPALLEEA
>CP028568.1|AWA05701.1|1416025_1416718_+|response-regulator
MEPIFTLVIEDDERIGSILAELVSSTPGFSLLGRAESLTQADLMMRAAQPQLLLVDISLPDGSGLEWVNRLRSHNREAYVIMVTASCDVETIQQALNQGVQDYIIKPLRLFRIQQSLDEILTLHRRICERGSLEQSDLDRLMGKVRPQGREVRDTPKGIDAITLRQVLELLAGEPDSAFSTDTVALRLSLSRTTARRYLEYLESEDRVDVDLNYGQRGRPERRYHWRRGS
>CP028568.1|AWA05700.1|1414453_1416022_+|sensor-histidine-kinase
MKLRHQLVTLSLGLSLLLIVILGSLLALFIRHLLEVNLEEKGGDLARVLAADSRVVQALEWGSDPGLRDYVQGICSRTDAAYMVVTDEHARRLSHPSPELVGGLFRGEDIWPSLNERSSYCSKDVGTLGPAIRCFAPVIGADGRAIGAVVVGYLMQTVEGIYLDRIALLISAIGAVLGCGLLLALWIQHRLRRTLLDLEPETIVNRFVLQELVLEHISEGVIALDSQGHIRMLNSAAFYQLRLPGTGRHSLLGQPLAELSPPLAPALTQLETELGFTVHGESFIGRWQAVEGKIPGRLLIFSRPEVTGSLGMQVTHLRQYAEMLRMQTHEFANKLSSLSGLLQLGHVDQAVELIQQESEACQTMLHDLLRAIEDKPVAGLILGKFSRARELGVELVLDPDSALGEYPAAVSADLITLIGNLLDNGIRAAWARRKQCPPRVLISLNDFGRRLVIEVEDSGEGVDEALADHLFDYGISRQTGDHGVGLFLVKETVARRGGVIEWRRTAEQTTLFGIYLNKNQLV
>CP028568.1|AWA05699.1|1412885_1414436_+|oxaloacetate-decarboxylating-malate-dehydrogenase
MNDIMMGTSLPYAERKRQGLMGRMPHKEESLAQQRRRIYRLVSAMQSPFDQHLLLRQLQEDNPVLFYELVRHHLPELLPIIYTPVVGEACQRHSDLYLRSHGLYLSWHDRDELDGIFAAVEQEVDVIVISDGERVLGLGDLGIGGMGICIGKLALYSAAGGINPARTLPLCVDVGTNNPELLEDDSYLGWQAPRVDGEPYYQFMDKVVAAIRKRWPQVVLQFEDFAGKHAANLLARYRDELCMFNDDIQGTAAVASACVLAGLQQAGSALAETPVLIVGAGSAGCGIAAMLAQLAGSTARVQLFDQDGLVCLDRAGLTPAQQPFARPAAEACNSLAALIERLRPGVLIGVSGQGSLFDAAVLTAMGEVCERPVILPLSNPTRSAEATPAQVWQATGGRALLATGSPFPPVTVDGAARVVSQCNNVYVFPGIGLGACAVKARRISDGMLRAAVQAVGAYPLAEGRLLPPIEQVGEVARAVARAVALCARAEGLADFEGDPAPLIDQTWWRPHYWSAS
>CP028568.1|AWA05698.1|1411566_1412874_+|citrate:sodium-symporter
MKNLSTPPTRIALFGDRQIAGMPMMIFLGLATCVLFSGWNGSLPLGMVGALALMFVLGTLLTELGERITPIREYLGGGTILAIFGGAALFEYRILPVEAGQVIIGFMKEGGFLNFFIASLVTGSVFGMSGALLKNAAMRYLPVILGGVALALLSVGLVGALMGYGFKNAVLLIGLPIMGGGMGAGAVPLVEILSGPLQMSSADLLSRMVPAVVIANTLAILVGTLLARLGRRYPSLTGNGKLMIKESAAGVAEEKVQAPTLESLGLGLFISSSMFVLGSLLGNFIPMHPFALMILAVAVIKVSGLLPRRYEQAAADWYQFVVSNLTPSLLVGIGVAYTSIPELISAFSVSYFVLVLVTVVGGALGAALVGRMIGFYPIEAAITGGLCMANMGGTGDVAVLSAAQRMTLMPFAQISSRLGGAVMLILATLLISLLA
>CP028568.1|AWA05697.1|1410829_1411021_+|hypothetical-protein
MMGQLNRETIAVERYESGDPNFSIESLLVEVEYVADGHYGLSLESTETCHEFDPANIPLLLAE
>CP028568.1|AWA05696.1|1410037_1410511_-|transcriptional-regulator-SlyA
MMKDLEMLRELSLAERVGRLHRLWRTVADLELAPLGLTHPRWTALWKLSRLGGHLSQKTLAEALEIELPSLMRTLGQLEEQGLVERHCCSQDKRARIVTLTPAGKALLDQIEDRIMEIRRELLAGISQRELEQFEDIVHRICANALGKIGAQSEERE
>CP028568.1|AWA05695.1|1408980_1410036_-|HlyD-family-secretion-protein
MTPDQQFKRWIKWAMGAFVLVFAYFLLADLKMPLTPQAMATRVVTKMAPQVSGKVVEVAVGNNQHVKQGDLLFVLDPAPFELAVEQARLALAQAEQQNRQLDATLNAASADFSSLQTQAALKLREAERIDALYRRHMVSEQQKDDADSAFRTAQANLLASKARMTQARVNRGLPGDDNLLLRQARNRLAQAELNLDYSRVHASQDGIITNLQLKPGSFAAAGAPLLALVSEQVDVIADFREKSLRHVNQDSQALVAFDGEPGRLYPARVTSLDAGVSAGQFDANGLLASPTESDRWVRDAQRLRLHLALEQLPAHLPAGARATVQLLPDNALTGLLARAQIRLLSLLHYIY
>CP028568.1|AWA05705.1|1420500_1422177_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MSELSQSSASPIERSWQRCLHQGLSRRQSAELDLLPQGELSARQEQHRVLIASFQRFVLPLFGQLLAGRPCRLLLCDGEGAILAASGDDGFARHAERIFLRSGARWGEASKGTNAIGTALAEQNEVQVLGNQHFFAQHSFLSCSACPLLGPDGQLLGVLDISTDAAHHDGDMLGTVRLLAMTLENALLARQPGWLVDLEPQSLWSARLLLGEEGELLGANRAGRLWLGQHPFDGKQLLRDRRGLRLVPEAHPVATLPGLPADAGGSHGQQVPLKMLERGISLLIEGETGSGKEHLVRELHGQSSRRAQPLVCVNCGALPAELVEAELFGYVGGAFSGARSQGSQGYLRAAHGGILMLDEIGELPLLAQTRLLRVLQERAVTPVGSHRPEAVDFWLVSASHRDLAAMVAAGTFREDLYYRICGWRQLLAPLRDWPTRERQALVQRLLAEMDPALHLTDEAERHLLAHPLPGNVRQLKQALEVACVLAEGQGWIEPAHLHLPTVAVGPAATTALAGSTLRQQNRQRVQQTLTECDGNVSEAARRLGISRTTLYRALREAG
>CP028568.1|AWA05706.1|1422263_1423439_+|acyl-CoA-dehydrogenase
MTRTRFDWQDPFFLDGQLGEEERLIRDAARDYCQARLMPRVLEANRREQFDRTIMNELGELGLLGATLPEQYGCAGVNHVAYGLIAREVERVDSGYRSAMSVQSSLVMHPIHAYGDEAQRQRWLPGLARGELVGCFGLTEPDAGSDPGSMKSRAERVDGGYLLTGNKMWITNSPIADLFVVWAKLDGEIIGFVLEKGMAGLSAPKIEGKFSLRASITGEIVMERVFVPEANRLAGVSGLKGPFGCLNKARYGIAWGALGAAEFCWHAARQYGLDRQQFGRPLAATQLFQLKLANMQTEIALGLQGCLQAGRLMDEGRCPVELVSLIKRNSCGKALEIARVARDMHGGNGISDEFHVIRHVMNLEAVNTYEGTHDIHALILGRAQTDLQAFE
>CP028568.1|AWA05707.1|1423438_1424593_+|CoA-transferase
MGPLAGVRVLDLSRVLAGPWASQLLADLGADVVKVEAPGRGDDTRHWGPPELVAGEAAYFHAANRGKRSIALDLARDRETLLALVDRADVVIENFKVGGLARYGLDYPSLKARRPALIYCSITGFGQDGPWAQRPGYDLLIQGLGGLMSITGQPDEAPGGGPVKVGVALVDILTGLYATIGIQAALRHREQTGEGQQIDLALLDVSVAVLANQAMNYLATGQAPGRLGNGHPNIVPYDVYPTRDGHLILAVGNDGQFAALAALLGEPGWAMDPDFASNSARVRQRHRLNALIAKRLLARSSAEWSAMLEAAGVPGGPILTLDALFALEQGAVRGWVQQVQRGEQPLPTLANPLHLSATPVRYGRASPALDGDRDSVLRDWLGQG
>CP028568.1|AWA05708.1|1424633_1425131_+|VOC-family-protein
MSSHLPRCWSPGPSPAMMHPVHSSVEELPMAQHIGALALLVADYDAAITFFTQGLGFELLEDTPLDEPGKPGKRWVRVAPKGAPGSALLLARAATPEQRAAIGQQGGGRVFLFLETDDFWGDYQRMQAYGVHFCEQPRSEAYGTVVVFEDISGNRWDLLQLAAAN
>CP028568.1|AWA05709.1|1425233_1425923_+|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MAKRILVVEDEAPIREMLCFVLEQKGYETVEAEDFADGLAKVREPYPELIVLDWMMPGGSGIQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVMRRVSPTSVDEVIEVQGLKLDPVSHRVSAEEKALDMGPTEFKLLHFFMTHPERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKAIEETGHDRLIQTVRGAGYRFSTRL
>CP028568.1|AWA05710.1|1425931_1427227_+|two-component-system-sensor-histidine-kinase-PhoR
MLQPYAWRRQLWRMAFFYAPFALVGWLTNTLALCLLAATVLHLGWHYRFQKRLSDWLWHDRSLVPPNGSGSWEYIFNGIYKLQQRHRARRRELAGLIRRFREGAEALPDAAVVFRTDGSILWCNRLAEQLLGFRWPEDAGQHIGNLIRHPAFGAYLGKGQYDEPFEMTSPINEEKFLEFRIMPYAEDQAMLVVRDVTRLRSLEKTRKHFVSNVSHELRTPLTVLKGYLEMTEEPPPPAMWAKAHKVMMEQTIRMDNLVNQLLTLSRIEAAPTVDLSHLVDMPAMLGLLEQEARALSGERAHQIEFMVQPNLLVRGDQDQLRSAVSNLVYNAIHYTPAGRKITVEWRKQGAMALFAVQDEGEGIPPEHLARLTERFYRVDKARSRHTGGSGLGLAIVKHALSHHDCQLDIESRVGLGSRFSFLIPGRMVVVK
>CP028568.1|AWA05711.1|1427603_1428578_+|phosphate-binding-protein
MKLNKLAGVIGFTAATLFSVSTLAAGVDKNLPDYTPTSGISGNLSSVGSDTLANMMTLWAEEFKRMYPNVNVQIQAAGSSTAPTALTEGVAQFGPMSRAMKSGEEEAFEKRYGYKPTAIRVAVDALAVFVNKDNPIKGLTMPQLDAIFSSTLKCGEAKAATKWADLGLDGNWSSKDLQLFGRNSVSGTYGYFKEHALCNGDFKSGVNEQPGSASVVQSVSSSLNGIGYSGIGYVTSGVRAVPLSKDGKTFIEATSDNAITGKYPLSRFLYVYVNKHPNKPLSPMEQEFLKMVLSKAGQNIVAKDGYVPVPAKVVEADLKKLGIM
>CP028568.1|AWA05712.1|1428741_1429548_+|M48-family-peptidase
MTSPLFKLGLAALCSTLLASCAQSPTGRSQMLLFSPQQMSKLGADSFEEMKKQEKVSTDAKMNAYVSCVAKAVTAQVPSQYGITSWEVVVFDSKQVNAFALPGGKIGVYSGLLKVAKNQDQLATVIGHELTHVLAQHSNERLSRSQLTGLGLAAADIAMGSSEYRGATMAALGLGVEVGVMLPYGREQESEADRLGLDLMARAGFNPAEAIPLWQNMSAAAGGNAPPQLLSTHPSNENRIAELQAQQAEAVPLYEQARASGLVPQCKA
>CP028568.1|AWA05713.1|1429535_1430042_+|N-acetyltransferase
MQGISLRMARPDDAAAMTVMQRASWLAAYGGVLGADMLAQLAVTEHLQIWQRRLAEAGPRPMLLCQDEVVIGLLYWQPETTGEYPTAWIRAFYLHPDHWRQGHGKRLWQAVAMQMRRAGCEGVRLWLLDGNHIGEGFYLRRGFMFDGQERTLMSLGQPCLQRQMFRLL
>CP028568.1|AWA05714.1|1430151_1431054_+|transcriptional-regulator
MYYGFDIGGTKIAFAVYDGALNLCHEERMSTPGNDYEGLQQLIRERVEQADARFGARGAVGIGFPGILNRHDHSIVAANLPSINGRHLGADLAELLERPVKVDNDANCFLWSEVHQGAAAGADSALGVTIGTGIGGAVYLAGKLIQGRNWLAGEIGHYPLPATMLMKYPDLPRPRCGCGRLVCFETYASGTGLERLYHHFHGQRASGHQIVGRFEAHEPHAVATVDCWLEIMAAGLATAISVVDPDVVVLGGGLSGLPALYEQLPLRLPGHLLPGVALPEIREARFGGAGGVRGAALLNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028568_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028568_4

3998135-3998340

Orphan

Consensus_repeat	Method
ACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	PILER-CR
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP028568_4

>merge|CP028568|4|3998135-3998340|PILER-CR,CRISPRCasFinder
AAAAGGTGGGTTAGCCGGCTAAGGGGATTGGCATCTGAAAAACACCCATAAAAATGAAATCCAATGCCATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCGATCCTAAAGAGTTGAGGGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATATCATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG

>CP028568|4|1|3998135-3998340|PILER-CR
AAAAGGTGGGTTAGCCGGCTAAGGGGATTGGCA	TCTGAAAAACACCCATAAAAATGAAATCCAATGCCATCAAGACCATGATGGCCTGTA
AAAAGGTGGGTTTGCCGATCCTAAAGAGTTGAG	GGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATATCATCAAGACCATGATGGCCTGTA
AAAAGGTGGGTTTGCCG

>CP028568|4|4|3998202-3998340|CRISPRCasFinder
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	ATCCTAAAGAGTTGAGGGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATAT
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG

Protein	Signature genes	Signature genes Name	Protein_function
CP028568.1\|AWA07765.1\|4006599_4006893_+\|DUF1315-domain-containing-protein	unknown	unknown	gnl\|CDD\|225681
CP028568.1\|AWA07763.1\|4004130_4004931_-\|DUF2989-domain-containing-protein	unknown	unknown	gnl\|CDD\|371419
CP028568.1\|AWA07766.1\|4007145_4008153_-\|L-asparaginase-1	unknown	unknown	gnl\|CDD\|181876
CP028568.1\|AWA07760.1\|3999331_4001347_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	unknown	unknown	gnl\|CDD\|239240
CP028568.1\|AWA07751.1\|3987739_3988195_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	unknown	unknown	gnl\|CDD\|235777
CP028568.1\|AWA07753.1\|3989931_3991410_+\|sodium/panthothenate-symporter	unknown	unknown	gnl\|CDD\|236519
CP028568.1\|AWA07755.1\|3993890_3994907_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176214
CP028568.1\|AWA08861.1\|3992917_3993766_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP028568.1\|AWA07767.1\|4008667_4009867_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP028568.1\|AWA07762.1\|4003566_4004124_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240042
CP028568.1\|AWA07758.1\|3997546_3998110_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
CP028568.1\|AWA07754.1\|3991487_3992915_+\|PTS-N-acetylglucosamine-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|273920
CP028568.1\|AWA07761.1\|4001657_4003502_+\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|182860
CP028568.1\|AWA07768.1\|4010051_4011923_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
CP028568.1\|AWA07756.1\|3995432_3996311_+\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|283886
CP028568.1\|AWA08860.1\|3989678_3989942_+\|DUF997-domain-containing-protein	unknown	unknown	gnl\|CDD\|377626
CP028568.1\|AWA07764.1\|4005128_4006559_+\|glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|236219
CP028568.1\|AWA07757.1\|3996495_3997473_+\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
CP028568.1\|AWA07759.1\|3998676_3999225_-\|NAD(P)H-nitroreductase	unknown	unknown	gnl\|CDD\|182761
CP028568.1\|AWA07752.1\|3988210_3989551_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	unknown	unknown	gnl\|CDD\|236307

Protein	Function_ID	Function_description	E-value
CP028568.1\|AWA07765.1\|4006599_4006893_+\|DUF1315-domain-containing-protein	gnl\|CDD\|225681	COG3139, COG3139, Uncharacterized protein conserved in bacteria [Function unknown].	1.20717e-28
CP028568.1\|AWA07763.1\|4004130_4004931_-\|DUF2989-domain-containing-protein	gnl\|CDD\|371419	pfam11207, DUF2989, Protein of unknown function (DUF2989). Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed.	4.67959e-90
CP028568.1\|AWA07766.1\|4007145_4008153_-\|L-asparaginase-1	gnl\|CDD\|181876	PRK09461, ansA, cytoplasmic asparaginase I; Provisional.	0
CP028568.1\|AWA07760.1\|3999331_4001347_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	gnl\|CDD\|239240	cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provides a hydrid ion to the C5 atom of substrate, and Tyr and His are proposed to form a catalytic dyad that protonates the C4 atom of the substrate and completes the reaction.	0
CP028568.1\|AWA07751.1\|3987739_3988195_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	gnl\|CDD\|235777	PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein.	1.86945e-78
CP028568.1\|AWA07753.1\|3989931_3991410_+\|sodium/panthothenate-symporter	gnl\|CDD\|236519	PRK09442, panF, sodium/pantothenate symporter.	0
CP028568.1\|AWA07755.1\|3993890_3994907_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176214	cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
CP028568.1\|AWA08861.1\|3992917_3993766_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.76012e-70
CP028568.1\|AWA07767.1\|4008667_4009867_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.81318e-176
CP028568.1\|AWA07762.1\|4003566_4004124_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240042	cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.15623e-39
CP028568.1\|AWA07758.1\|3997546_3998110_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	5.54818e-91
CP028568.1\|AWA07754.1\|3991487_3992915_+\|PTS-N-acetylglucosamine-transporter-subunit-IIBC	gnl\|CDD\|273920	TIGR01998, N-acetylglucosamine_and_glucose_PTS, PTS system, N-acetylglucosamine-specific IIBC component. This model represents the combined B and C domains of the PTS transport system enzyme II specific for N-acetylglucosamine transport. Many of the genes in this family also include an A domain as part of the same polypeptide and thus should be given the name "PTS system, N-acetylglucosamine-specific IIABC component". This family is most closely related to the glucose-specific PTS enzymes. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.59429e-94
CP028568.1\|AWA07761.1\|4001657_4003502_+\|signal-peptide-peptidase-SppA	gnl\|CDD\|182860	PRK10949, PRK10949, signal peptide peptidase SppA.	0
CP028568.1\|AWA07768.1\|4010051_4011923_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	9.10854e-70
CP028568.1\|AWA07756.1\|3995432_3996311_+\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|283886	pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA). This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.	1.50618e-139
CP028568.1\|AWA08860.1\|3989678_3989942_+\|DUF997-domain-containing-protein	gnl\|CDD\|377626	pfam06196, DUF997, Protein of unknown function (DUF997). Family of predicted bacterial membrane protein with unknown function.	2.52143e-20
CP028568.1\|AWA07764.1\|4005128_4006559_+\|glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|236219	PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed.	0
CP028568.1\|AWA07757.1\|3996495_3997473_+\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	1.21535e-140
CP028568.1\|AWA07759.1\|3998676_3999225_-\|NAD(P)H-nitroreductase	gnl\|CDD\|182761	PRK10828, PRK10828, putative oxidoreductase; Provisional.	3.05811e-88
CP028568.1\|AWA07752.1\|3988210_3989551_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	gnl\|CDD\|236307	PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated.	0

>CP028568.1|AWA07758.1|3997546_3998110_+|sugar-O-acetyltransferase
MTEYDKMITSQPYNCMAPELDLLRRETARLYRRFNRSDEEDEQLALLQKIVGELALDAFICPPLYCTYGRHIYIGERSYINMGATLLDNAPIHIGAEVMIGPNVQIYTAAHALDADERIQGVETALPVTIEDRVWIGGGAILLPGVTIGREAIVGAGAVVTKDVPAGARVVGNPARVLPAKGKTPVS
>CP028568.1|AWA07757.1|3996495_3997473_+|D-2-hydroxyacid-dehydrogenase-family-protein
MRIAILDDYQDQVRHLPCFTRLAGHDVTILTQSEPDPERLAAKLAGVEALVLIRERTRIDEALLRRLPSLRFISQTGKISQHIDPLLCQRHGVAVAEGIGSPVAPAELCWALIMAASRHLPAYCHALAQGQWQQSGTLGLGRTLQGLTLGIWGYGKIGRLVAGYGRAFGMSVLIWGSEGSRQQAERDGHASASDKEAFFRDADILSLHLRLHEATRGCVTRTDLARMKADSLLVNVSRAELVEPGALYAELAANPTRRAALDVFDAEPATAQSEPLLRLPNVLATPHLGYVECNSYQLYFQVAFDNLIAFAEGRPTNLVLPVAGR
>CP028568.1|AWA07756.1|3995432_3996311_+|50S-ribosomal-protein-L11-methyltransferase
MPWIQIRINATAKTADKVSNMLLGRGAQAVTFMDAKDVPVYEPMPGETPLWGETEVMGLFDAETDPAPTIAFFQQIFGEDVGYKVEQLEDKDWVREWMDHFHPMQFGERLWICPSWRDVPNPDAVNVMLDPGLAFGTGTHPTTALCLQWLDGLDLAGKTVVDFGCGSGILGIAALKLGAARVIGIDIDPQAIQASRDNAMRNGVADQIELYLPADQPQDVEADVVVANILAGPLRELAPLIAGHGKAGSLMALSGVLESQTPELETIYGQWFEMDPTAVKEEWCRLSGRKLG
>CP028568.1|AWA07755.1|3993890_3994907_+|zinc-binding-alcohol-dehydrogenase-family-protein
MKAIALTHYLPSDHPHCFIEANLADPTPGPRDLLVRVKATSINPVDTKVRAPKAKVESSPRVLGWDAVGEVIAVGREVTLFKAGDRVWYAGDISRPGSNSALQLVDERIAALAPTSLSDLEAAALPLTAITAWETLFERMGLTRESRGRLLIIGGAGGVGSIAIQLARQLTGMEVIATASRPETRAWCLQMGAHQVVSHHQLQEELTALGITQVDAIFCTNATEQHWDAMASLISPFGHICTIAESSVPWDLSLLKSKSVTFSQEFMFTRSLFQTPDMIEQHNLLGLVAALVDQGVVKTTLSKVVAELTPATLAQAHAEVEAGRMVGKLVIDMSRFGN
>CP028568.1|AWA08861.1|3992917_3993766_-|LysR-family-transcriptional-regulator
MGLFATVVEQGSFTGAADLLGMPKSSVSQKISRLESQLGVRLLQRTTRRLSLTPQGEVYVEQCRALLALARSANLAMARLRAAPAGRVRITAPEATGTLLLGRILAEFRALYPEVVLELTLCDEQLDLVGEGYDLALRAAPLKDSSLICRRIGQVPRHLVAAPAYLAAHGTPQQLSELSRYACLVHTSLPVWPLQEGGWRPQGACLSNSLLALRELAINEGGIALLPHHVCEGDLAAGRLQKVLPSHPIPANPFYLIYPSREHLAPALRSLMDFVAERLPFA
>CP028568.1|AWA07754.1|3991487_3992915_+|PTS-N-acetylglucosamine-transporter-subunit-IIBC
MPVQNARQILTQALQRLGYALLLPVSILPLAALLYRLGQPDVLDLAVLSLTGRALFSQMPLIYAVAIAFGLSRQGEGTQALAGAVNFLLLSSALGTLAPGLHTDMICGLLAGLTTAIVYPWLKRHPMPHWLRLVNGDFTSLLASALTCLLLAFPLALLWPLLEQGITLLASELLTTPFGAFCYGVLNRLLIPLGLHQVLGSLIGLGESNLQALASAQPLHEGYVAGLYPIIMFGLPGACFAIWLHRQRMQRLPQGGLLLTLALTSALVGITEPIEFLFAFTAPWLFLAHALLTGLSLATCSALGIKVGSYFSAGLLDLVLSYHAGEHSFWLIPVGILFFVAYTLLFYQLLERTPLSLPSKPIAPEHPRLASVAPSDPQMLAIQYLKVLGGMDNLQAMSVCLTRLSLRVRDISLVDQSRLLGLGCLSWIQLNDHQLVLVLGPNASLIEGQIRMLAERQSVPLGLKPNQESAGQSGW
>CP028568.1|AWA07753.1|3989931_3991410_+|sodium/panthothenate-symporter
MNLELMLPLIIYLVLVLGVGFWASRHRVSGDFVQEYFIGNRSMGGLVLAMTLVATYTSASSFIGGPGAAYKIGLGWVLLAMIQLPTVWLTLGVLGKKFAIIARRVNAVTINDMLWARYQSKAVVVLGSVTIILAFIATMVVQFIGGARLLETATGLSYQQGLLLFASCVLLYTVIGGFRAVVMTDALQGIIMLIGTGALLAGILVAGDGLPNLIHQLKVIDPKLVSPQGAGDLLTQPFMLSFWVLVCIGVVGLPHSALRCFGYRDSKALHRGILIGTIVSALLMFGMHLAGALGRAILPSMDSPDKIMPSLMMEVLPPWLAGVFLAAPMAAIMSTIDSQLIQASATLVKDLYLNYLSPEKAGQEKLEVRVPRLSLLCTLILGTLVLLAALQPPEMIIWLNLLAFGGLQAVFLWPLVLGLYWSRANGPGALASMVCGILCYAILSQWEIKPAGLHAIVPSLGLGLIAFVLVSLLTPAPSQHVRRLFEPQSSMD
>CP028568.1|AWA08860.1|3989678_3989942_+|DUF997-domain-containing-protein
MNRFALARREAALCLLLTLLYFLAWYGTAYFIPAEIECWDMPLWFLLSCILMPLLFIVLCGLMVDRLFVDIPLDSPPLDAKEPSHES
>CP028568.1|AWA07752.1|3988210_3989551_+|acetyl-CoA-carboxylase-biotin-carboxylase-subunit
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASTDSYLNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAIEAMKKAGVPCVPGSDGPVDSDAKHNAAIAKRIGYPVIIKAAGGGGGRGMRVVRSEAELSAAIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQVLADGQGNALYLGERDCSMQRRHQKVVEEAPAPGITEEMRKFIGERCVRACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVTELVTSVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAPGGLGVRWDSHIYAGYKVPPYYDSMIGKLICYGENRDVAIARMRQALDELVVEGIKTNVSLQKEIMKDENFQHGGTNIHYLHKKLGL
>CP028568.1|AWA07751.1|3987739_3988195_+|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein
MDIRKIKKLIELVEESGIAELEISEGEESVRISRNFSGQVTAAPQMIMQQAAAPVAAPAAAPAAAAPAADAIPSGHLMRSPMVGSFYRSSSPEAKPFVEVGQHVNVGDTLCIVEAMKMMNQIESDKAGVIKAILVENGQAVEFDEPLFIIE
>CP028568.1|AWA07759.1|3998676_3999225_-|NAD(P)H-nitroreductase
MDALHLLLNRHSCGRLAEPAPSGEVLDNILKAGLRAPDHGTLTPWQFILFEGEGRERLGTLLAQAARSCGEDEESIKKCQEAPLRAPLLIAVATRYQEHPKVPRLEQELSAGCALMAMQMAAQAQGFNGIWRSGWFIFDEQINEGLGLTPEDQLVGFLYLGTPMLEARKLRELPVSEFVRRF
>CP028568.1|AWA07760.1|3999331_4001347_-|NADPH-dependent-2,4-dienoyl-CoA-reductase
MSRYPTLLTPLDLGFTQLRNRVLMGSMHTGLEEEKGGFDKLAAFYGERARGGVGLIVTGGIAPNLRGRLVPHGSQLSFPWQVAKHKKVTSAVHQEGGKIALQILHAGRYAYHPFSLAPSALKAPISPFKPRAMSERQIRGTIRDFAATAQLARSAGYDGVEVMGSEGYLINQFICERTNKRTDGWGGSSENRMRFPVEIVRAIRERVGPDFIIIFRLSMLDLVEQGSSLEEVIALGQALEQVGVTLINTGIGWHEARIPTIATSVPRGAFSWVTAELKKHLKVPLITTNRINTPEVAERILAGGEADMVSMARPFLADPEFVIKAAENRADEINTCIACNQACLDHVFKQKRASCLVNPRACFETELTFGRVPQPKKLAVVGAGPAGLAFACYAAERGHQVSLFDQASEIGGQFNFAKQIPGKEEFHETLRYFAKRLEKCGVELYLGQRQSAESLLGGGFDEVILATGIRPRTPNIPGIEHAKVMSYLDVLRDHKPVGEKVAVIGAGGIGFDVAEYLVEGKGDRSRDHWLKEWGIDKQLGERGGLMAPVIDAPERQVWLLQRKESKVGDGLGKTTGWIHRTVLKNRKVEMLSGVQYLRIDDEGLHIQVGEQQQCLPVDQVIICAGQEPLKELQAGLQAAGKPVHIIGGADVAAELDAKRAIRQGAELAAVI
>CP028568.1|AWA07761.1|4001657_4003502_+|signal-peptide-peptidase-SppA
MSIFKGLGWLFRSLWRLLNFTRLMLVNLLFLVVVLIIVFSVSQKEAPSAPIEGALTLNLSGVLVEQRSQTDPTVQLLRQVDNSDELPSEIVLSDLLWAIKSAKDDDRIKALVIKPQGLQGTSFSKLQEVASAIDAFKESGKPVIAMADFYTQGQYLLAAHADHVLLNQSGAVVIEGLGVYQTYYKSALEKLNITPHVFKVGTYKSFVEPYTRDEMSPESKEANQRWLDQLWQSYVADVAEQREIEPDAVAPGKDRFLELLRKAGGNAANYALDNGLVDQLATRDEMTQAVIKEVGESDDHGWKGVGLKEYLAAIPSQYPQSGKDEVGLIVASGAIMDGVQPAGTIGGDSLADLLADARRDDKVKALVLRVDSPGGSAFAAEQIRAELLALKQAGKPVVISMGSYAASGGYWISADADKIFASPTTLTGSIGVFGMFATIDKALSQFGVHTDGVGTTDYVGVGLTRALPEHVGQAIQLNVEDTYQRFVGLVSKGRGLSPEETEKAAEGRVWTGQDAKALGLVDEFGDQEAAIKAAAELANLKEWQVTPIEQEESAKDKFLRQLFDSSAQVLASHLQSWLPAGLGKALVEVNRSLDPLTRFNDPQGTYALCPVCTP
>CP028568.1|AWA07762.1|4003566_4004124_-|NUDIX-domain-containing-protein
MNHIESLASDWPHPFDIRLTHGRVNTDGRQLERVTVRAVVLRGDQLLLVHSRVNGDLMFPGGGIEQGECHRTALARELREECGAELVAVGALLGETREYRPAREADYDAYCIRSFYYLCQVGEAWCDPQPQPYEIRLGFTPGWFELAEALQTNKTQLAGPCPQWTVRETRVLAELHHWHESGLLA
>CP028568.1|AWA07763.1|4004130_4004931_-|DUF2989-domain-containing-protein
MTPFPARSLLFGLCCGLLLTACDDDRIHNICANYPALCQDLVDDGWCRYERSDIIRARYYLQAEGTQRRQYELMRSLERYLKCAERSTNIEYKRAREQKSPRVEGMLAAGEQLAQLDAATRNANYPYLLLWHWTNNTNELARQQFLALEGQPVLEEPELQLALGGIYAKSEPQKAIALMQHALSLYREGEPVNGRILTSLSTLYMGQKQYGQAYLWGKVSESFQNAAEVSATRFSLYHSLSKQEQESLDSQAATLVEQLKSGTYRP
>CP028568.1|AWA07764.1|4005128_4006559_+|glyceraldehyde-3-phosphate-dehydrogenase
MTHEHYLQAWQESQELAEAMQPLIGRLYRQQGIEITIFGRPLQNASTIDILKAHRVVRRHQGAPLPIQQSFPLLQAILALNPTAAEIDLGKLAVGYWQDHQDEAGIDDYLRAKLAPALGRGVPAPTDVVLYGFGRIGRLLARLLIERTGAANSLRLRAIVVRGGRDGDLEKRASLLRRDSVHGPFNGSIEVDVERSAIIANGTFIQVIYANSPADIDYTAYGIHDALIVDNTGVWRDEAGLSEHLKARGAARVLLTAPGKGEMKNVVFGVNHEVIGPADKIISAASCTTNAITPVLKVMQDKYGIRHGHVETVHSYTNDQNLIDNYHKGERRGRSAALNMVMTSTGAAKAVAKALPELKGKLTGNAIRVPTPNVSLAIINLSLEQTTDRESLNAYLQQMALSSALHRQIDFSASTELVSSDMVGSRFAGIVDSQATIAEGDHCVLYVWYDNEFGYSCQVVRVMEQMAGAVRQDLPA
>CP028568.1|AWA07765.1|4006599_4006893_+|DUF1315-domain-containing-protein
MSFQQGEFLQAIRQMPAEVYERLKTAVELGKWPDGKPLTDEQKATSLQAVMAWQAMHLDNPEHMNIGRDGEIVMKSKSELKRQYRDEEEIVRVDLNH
>CP028568.1|AWA07766.1|4007145_4008153_-|L-asparaginase-1
MKKSIYIAYTGGTIGMQRSDHGYVPMAGFMEDCLARMPEFHRPEMPDYHIHEYAPLIDSSDMTPADWQRIAEDIRDNYDKYDGFVILHGTDTMSFTASALSFMLEDLHKPVIITGSQIPLAELRSDGQQNLLNALYIAANYPIHEVTLFFNNQLYRGNRSKKVHADGFHAFDSPNYPPLLNAGIAISLEAGELGVPSERPLVLHDITPQPIGVVTLYPGISAEVIANILQQPVRALILLSFGVGNAPQNPAMLALLSEASARGVIIVNLSQCLHGKVNMGGYATGNALSRAGVISGFDMTAEAALTKLHFLLSQDLPAPRIRELMQQSLRGELTP
>CP028568.1|AWA07767.1|4008667_4009867_+|sodium/glutamate-symporter
MLQLDSYATLVAATLVLLLGRLLVTRVGLLRTFNIPKPVAGGLVVALVLLLLRSTLQMELQFDTSLQTPLMLAFFASIGLSADLASLKRGGKAVLTFLLVVTGLLLVQNSLGVGLATLLGLDPHMGLLAGSITLSGGHGTGAAWGATFTEKYGVQSAAELAIACATFGLVLGGLIGGPVARYLVKKVKVPGEEHNRDDAPQGFEMPDMERPLTTFSLIETLALIAISLKGGEMLSAYLKGGAFELPVFVCVLFVGVLLRNVLTLLNWHEVSDREVSLLGNVSLSLFLAMALMSLRLWDLANLALPIFVLLAAQTVAMALYAIFVTFRVMGSNYDAAVLAAGHCGFGLGATPTAIANMQAITQRFGPSHLAFLVVPMVGAFFIDIINAMVIKLFLALPFL
>CP028568.1|AWA07768.1|4010051_4011923_-|methyl-accepting-chemotaxis-protein
MKNLSLKQKILLSVVIALSLVILLLSWQSYTSQKSLLLQGSQEQVQRLGSQQAASVSDWLAARRDVIQALGNKAGAEPLNALQQAQVSGRFQLTYFGESGGKMNDSDPSINRDGYDPRSRGWYQEAMSKGGLIVTKPYLDVAYNIMVVTLAQPAQGGVVGGDLSIASLVEDVTKMKLPADGFAIMMHKDGTVIAYKDAAKAMKPATEIDNDLTNALIEQSKTSNSLVPAYFDNEGRDKLLWAVDIPNTDWELVLVLDKETLEAPLSSLLMTQLGLALLVLVGSILAISWLVSMLLGPLSKVSQALARIADGNGDLTQRIKIDTNDEVGQLANSFNRFVGSQHQLIGNIRKLANELNADAERSLVTNQAAVDELQRQQQEVTMVATAVTEMASATMEIAGNAENTAAAAQQSAQSSEQGKMLVNQTRQSINGLAEEVGQATEVIGELSRHAQAISGILSTIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQEIQSTIETLQQTTARAVSLMQTSQGLADNSVKDADAAAAALEEITQAVSLISDMAGQIATAAEEQTQVTGEITQNTTAIKDVSDEITAAAMRDLDQAESLKGRATDLNQQVSTFIL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028568_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028568_5

4645702-4645783

Orphan

Consensus_repeat	Method
GGTAAAGATACCGGCTTACTTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028568_5

>merge|CP028568|5|4645702-4645783|CRISPRCasFinder
GGTAAAGATACCGGCTTACTTGCCACGCACGGCCCCCATCATGTCCCGCCTCAGTGACGGTAAAGATACCGGCTTACTTTCC

>CP028568|5|5|4645702-4645783|CRISPRCasFinder
GGTAAAGATACCGGCTTACTTGCC	ACGCACGGCCCCCATCATGTCCCGCCTCAGTGAC
GGTAAAGATACCGGCTTACTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
CP028568.1\|AWA08317.1\|4650852_4652526_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	unknown	unknown	gnl\|CDD\|274176
CP028568.1\|AWA08306.1\|4636658_4637699_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237562
CP028568.1\|AWA08308.1\|4642031_4642853_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
CP028568.1\|AWA08319.1\|4652915_4653563_-\|MSHA-biogenesis-protein-MshJ	unknown	unknown	unknown
CP028568.1\|AWA08892.1\|4648790_4649789_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274350
CP028568.1\|AWA08891.1\|4641568_4641994_-\|MSHA-biogenesis-protein-MshP	unknown	unknown	unknown
CP028568.1\|AWA08313.1\|4645143_4645605_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA08322.1\|4655088_4656036_+\|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase	unknown	unknown	gnl\|CDD\|225313
CP028568.1\|AWA08321.1\|4654155_4655019_-\|MSHA-biogenesis-protein-MshI	unknown	unknown	gnl\|CDD\|227306
CP028568.1\|AWA08323.1\|4656111_4658070_-\|RNase-E-specificity-factor-CsrD	unknown	unknown	gnl\|CDD\|236833
CP028568.1\|AWA08312.1\|4644394_4645066_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
CP028568.1\|AWA08318.1\|4652596_4652923_-\|MSHA-biogenesis-protein-MshK	unknown	unknown	gnl\|CDD\|274166
CP028568.1\|AWA08315.1\|4647048_4648758_-\|type-II/IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|225363
CP028568.1\|AWA08307.1\|4637903_4639409_-\|hypothetical-protein	unknown	unknown	unknown
CP028568.1\|AWA08305.1\|4635710_4636616_-\|rod-shape-determining-protein-MreC	unknown	unknown	gnl\|CDD\|237560
CP028568.1\|AWA08309.1\|4642852_4643413_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227302
CP028568.1\|AWA08310.1\|4643399_4643882_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|225076
CP028568.1\|AWA08311.1\|4643936_4644380_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|225076
CP028568.1\|AWA08320.1\|4653562_4654156_-\|MSHA-biogenesis-protein-MshI	unknown	unknown	unknown
CP028568.1\|AWA08316.1\|4649884_4650775_-\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|132060

Protein	Function_ID	Function_description	E-value
CP028568.1\|AWA08306.1\|4636658_4637699_-\|rod-shape-determining-protein	gnl\|CDD\|237562	PRK13927, PRK13927, rod shape-determining protein MreB; Provisional.	0
CP028568.1\|AWA08308.1\|4642031_4642853_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	2.07789e-07
CP028568.1\|AWA08892.1\|4648790_4649789_-\|hypothetical-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.6715e-08
CP028568.1\|AWA08317.1\|4650852_4652526_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	gnl\|CDD\|274176	TIGR02519, related_to_type_II_protein_secretion_protein, pilus (MSHA type) biogenesis protein MshL. Members of this family are predicted secretins, that is, outer membrane pore proteins associated with delivery of proteins from periplasm to the outside of the cell. Related families include GspD of type II secretion (TIGR02517), the YscC/HrcC family from type III secretion (TIGR02516), and the PilQ secretin of type IV pilus formation (TIGR02515). Members of this family are found in gene clusters associated with MSHA (mannose-sensitive hemagglutinin) and related pili, and appear to be the secretin of this pilus system. [Cell envelope, Surface structures].	1.292e-87
CP028568.1\|AWA08322.1\|4655088_4656036_+\|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase	gnl\|CDD\|225313	COG2515, Acd, 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism].	4.75656e-61
CP028568.1\|AWA08321.1\|4654155_4655019_-\|MSHA-biogenesis-protein-MshI	gnl\|CDD\|227306	COG4972, PilM, Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion].	0.000513701
CP028568.1\|AWA08323.1\|4656111_4658070_-\|RNase-E-specificity-factor-CsrD	gnl\|CDD\|236833	PRK11059, PRK11059, regulatory protein CsrD; Provisional.	0
CP028568.1\|AWA08312.1\|4644394_4645066_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	8.96394e-09
CP028568.1\|AWA08318.1\|4652596_4652923_-\|MSHA-biogenesis-protein-MshK	gnl\|CDD\|274166	TIGR02500, Yop_proteins_translocation_protein_D, type III secretion apparatus protein, YscD/HrpQ family. This family represents a conserved protein of bacterial type III secretion systems. Gene symbols are variable from species to species. Members are designated YscD in Yersinia, HrpQ in Pseudomonas syringae, and EscD in enteropathogenic Escherichia coli. In the Chlamydiae, this model describes the C-terminal 400 residues of a longer protein. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	8.59679e-05
CP028568.1\|AWA08315.1\|4647048_4648758_-\|type-II/IV-secretion-system-protein	gnl\|CDD\|225363	COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].	0
CP028568.1\|AWA08305.1\|4635710_4636616_-\|rod-shape-determining-protein-MreC	gnl\|CDD\|237560	PRK13922, PRK13922, rod shape-determining protein MreC; Provisional.	7.19045e-103
CP028568.1\|AWA08309.1\|4642852_4643413_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227302	COG4967, PilV, Tfp pilus assembly protein PilV [Cell motility and secretion / Intracellular trafficking and secretion].	7.77803e-06
CP028568.1\|AWA08310.1\|4643399_4643882_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	9.5821e-09
CP028568.1\|AWA08311.1\|4643936_4644380_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	1.49907e-10
CP028568.1\|AWA08316.1\|4649884_4650775_-\|DUF2075-domain-containing-protein	gnl\|CDD\|132060	TIGR03015, pepcterm_ATPase, putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking].	8.70259e-74

>CP028568.1|AWA08313.1|4645143_4645605_-|hypothetical-protein
MSRQSQQDEHWLGSYRRLAVGILLLIMVATLARSYLVHREEALAVSLTLLGEQFAERAQRLHGLWLDQRRPAVLHADGMAWQFDERGWPLGAGTVMTPSENCRWLWEQLIGKAASTQPPVQALASLDGEGCEFGWENNWLIYQFSDGRVRQKP
>CP028568.1|AWA08312.1|4644394_4645066_-|type-II-secretion-system-protein
MTTTRLVPRYSGVASPHRAAGFSLIELVIVIVILGILAVTALPRFLDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPTDTQVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRGSGNDLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQVTTNIN
>CP028568.1|AWA08311.1|4643936_4644380_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MKKQAGFTLIELVIVIIILGILAVTAAPKFLNLQDDAKKAAADGVKGAVASASQLVYSRAVLDGSEKDDTGTKTVKLADNSTVTIKYGYPTATSGGIGKAATIDPLWVGSVSGSGSTYVYQTSGSTCTVVYTEANASGAASTAKSGC
>CP028568.1|AWA08310.1|4643399_4643882_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MQKGFTLIELVLVILLIGILAAFAVPKWLGKGGFETQTVRDELLTRLRLVQTVNMHEPADRCTQLVVVSPRFAHRTYAACPASDDMSSGWTDNLRTRGRLVAASDGISISLDNNNRFVLRFDQMGRPLGTCAAGCTLLVSDGRETGRIKIESEGYIHESP
>CP028568.1|AWA08309.1|4642852_4643413_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MRAPERGFTLIELIVGIVLLAVALTGILGLLINQAPQAVDPVQQVRAAQLAQRLAGEIQQTSFDEQSDHNGGRYRCGEVVAGVTIQACSTHYGPDGESTPYMFNDVDDFDTAGSWKDASFYTQSGGIIAGDEYRNYQVRIAVNPVDFSDGNFKSCTAPCSVGKRIDLQVRLPDESVLDFSFYRGNY
>CP028568.1|AWA08308.1|4642031_4642853_-|type-II-secretion-system-protein
MRTASGFTLIELVMVILLLGIMATFTSQFIGIGSQIYGDAGSREQLMSDARFAMERLNRELRDALPGSERIETLDGSWDDSGPCLRFWPISTSSRYLALNRAQSGSTSTLELVMATPASAANPLNQDANTVKVGDLMVVFPLPTSAAGSLVNGCEYGRCVARVTEVLAPVSGAQTVRYASGETLAGISPGSRVYFANQQVRYCVEGSTMTRSSAAIGAPVAAGVLMAESLRAGNFYREVSAFNAEGEFGLRLVFERKGEVVTFNHKLGVFNVP
>CP028568.1|AWA08891.1|4641568_4641994_-|MSHA-biogenesis-protein-MshP
MIALFVIVVMAMLAAAMGRFLLDSSEKNTVEVRSVRALLAAQSGLEVALYRLFPNRTLAQPMPPVVCQATSTLNFASNPGLTNCQAVVRCATVPVTYNGSVTTGYRLESVGTCGNSDLNSANPDFAVSRTLMVEAYDGGQI
>CP028568.1|AWA08307.1|4637903_4639409_-|hypothetical-protein
MINGSTILPSGNVNVSFDSNGIGQLTLQYPDAGVLRLDATFLRNDVTGTLKLTGSDTVAVIPKAIALQAQGQSGCSGSNDNTYAACPVYRKAGESFTLQARALNEQDQLTPGFAASNKAISWALLAPAAGGTGTFSPTAISLANGVANNVVANWSEVGVIHLGVSNFVPYPAYQDELPQLETVLRWSEPIGRFVPWDYSLSGGFITPACNAFTYMSQPFASGFVLTARNLQKGTTQNYQGAFAKGVAEMVAANALDGVDRSGRITQAPTLSWASGIASVNQQSPFGLNTRFDRATSPEAPFTTLSFGIKVDDKDGGTTLLANPNINAAVAGSCAGASCDAVRLGTQKLLYGRLLAGTEAGVASAPLAIPLKMQYYEAGNWQPNKEDQCTRLSLAADGIRFLNPSHSFDAATRYLSLGAGRKIKLGLGSSAPGGASAQATDGEILFQFANPDISVRIPYRVDLSKQPSQPLWLSDPATLQGEAIFGSSRGNDRIIYRREVMH
>CP028568.1|AWA08306.1|4636658_4637699_-|rod-shape-determining-protein
MFKKLRGVFSNDLSIDLGTANTLIYVKDQGIVLNEPSVVAIRQERGNAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNYFRPSPRVLVCVPCGSTQVERRAIKESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAIISLNGVVYSQSVRIGGDKFDEAIISYVRRNYGSLIGEATAERIKHEIGSAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPELASDISERGMVLTGGGALLKDIDRLLMEETGIPVVVAEDPLTCVARGGGKALELIDMHGGDLFHYE
>CP028568.1|AWA08305.1|4635710_4636616_-|rod-shape-determining-protein-MreC
MKPIFGRGPSLQLRLFLAVIISIAAIVADSRFGVFSHVRVYLSSLVSPLQYMANAPGIMLDTMSTQVQTRAGLIEQTKQQEQQLFTLRSRLLKMDHLEHENQRLRELLGSPVHKESRKMVAELLSVDSDPFSHQVLINKGALDGVYNGQPVINDQGVIGQVLHVGSTTSRVLLITDSSHGIPVRVLRNDLRAIASGSGELDKLELRNLPRNTDVQVGDLLVTSGLGGRFPEGYPVATVTRSDYVEGKPFAQVEAKPLVALDRLRYLLLLWTDKKPEVHDDEEAPTPAAAPAAAPSAAGATR
>CP028568.1|AWA08315.1|4647048_4648758_-|type-II/IV-secretion-system-protein
MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLIDLGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKVTVAMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHEEYQDASFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRIDGILHENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMPVQYGESVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTTLYGALSELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILLVGEMRDNETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVAQRLVRRVCEHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGVYELLELDQPMMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAEDLG
>CP028568.1|AWA08892.1|4648790_4649789_-|hypothetical-protein
MLLLTLICGLALGILGWRTWIYWQQSQRVVEARQLQAAGEPKPDAIARAVPAAVPASAEQEPVDQVVALPTPRHLAAPPTAEPQQEQESAADDADVAAIDEEGPSDEELQPDLYAELAAEQEAPAAAPRKPGVLKIETVNLSEAELATLAERKATTAMAKGQLRDAQDNYYQVLVHDPRNQGAREQLAGLLYGEGRLSEASQLLEEGLRFDPEQADFRLLLARLAISGGDQLKALGWLTGHRPDLASNLDYYATWAGLSQELGQHADAADLYVKLLRQQPDQGRWWLGLGVAEDGQGHSQRALDAYRNAQLHGNLGEASTSWLEQRIAQLAP
>CP028568.1|AWA08316.1|4649884_4650775_-|DUF2075-domain-containing-protein
MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEGFIKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVRDQSELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQIVLFGQPELDARLAKPHLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLFGGRALRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRLVPRRWWPLVLLLGCALAYGVWQ
>CP028568.1|AWA08317.1|4650852_4652526_-|pilus-(MSHA-type)-biogenesis-protein-MshL
MKKHHLCLISAAMLTAGCTSYRHPEPVQAKDALRHAMTEQNKGGALTSVPKSVQSELLQLNRPPQAISMPEPRLRIAAHDVDAVEFFGSLFKGSRYSVAVHPGVAGQISVELKDVTLTEVLAVVGDMYGFDVQRKGNVFHVYPAGLRTETIPVNYLMMSRRGLSRTSVSTGGVTANDNNGNSNSFDNANNSTNNNSTSNRSSNGSSNSDSNGTRIETDTSSDYWTDLRDTLQTLIGSGDGRAVITSPQAGLVTIRAYPKELKAVREFLNQSESHLKRQVVLEARILEVALNEGYEQGVDWSGLSASWDGNKGITGGGSLTPSTIANTPNQIFSALGGGAGFKISDGNFNVAVNLLKTQGDVNTLSSPRVTATNNQKAVIKVGTDEYFVTNASTTTTTSGTSAPIVTPNVELTPFFSGIALDVTPQIDEEGKVLLHIHPSVIDTEEQKKTIDVGTADPLILPLAKSSIRESDTVVQANNGDIIVIGGLMKTDKQEIVSKVPLLGDIPWVGEAFTNRRESTKKVELVILLKPTVVEKDTWQNELQRSSELLDKWYPPKG
>CP028568.1|AWA08318.1|4652596_4652923_-|MSHA-biogenesis-protein-MshK
MARWFPLWACLFSLLAQAQPELLQDPTAPLSGATSGASATGQREAGLPRLQSIMLGNGPALAVLNGSSYRVGQQVDGYRVVAIGADAVVLEKGGKRQSLTLFASKVRI
>CP028568.1|AWA08319.1|4652915_4653563_-|MSHA-biogenesis-protein-MshJ
MSLKEQWQAWADKIAALSQRERVLILLTGVVVVGAVAIYGWLDGAAVRLEQERLALSTAQRDLEIMDLENQGKQAKLARDPDLHVRTQLAQLDGELGKLDAELKAQTVDLIQAHEMPAVLEALLSRSANLHMVALTSLTPEPLMAGEQRINLFKHGIRLKLEGGYFDVYQYLKALEGLPRHFYWKQFDYQVQEYPKAVVEMEIYTLSTSKEFIRG
>CP028568.1|AWA08320.1|4653562_4654156_-|MSHA-biogenesis-protein-MshI
MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAWQQHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLVTKQEELTAKQGLMRQLGSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNRFKQTPSLAGKQFGELTLSRDKEGRLAFQLSGIEREKP
>CP028568.1|AWA08321.1|4654155_4655019_-|MSHA-biogenesis-protein-MshI
MKQLFRRSTPSRQVGLLLASDRIMLASLGNPPIFATRAINGPQEWPQAMAELFSRHGLAKSKVRVALAASLYQQVQIDKPAVPDAEMAGALPWAIKDYVSESVLQLAMDYVDLPTPPAGRPRINVICVPKVRVQQLADAVNGIARLDAIVSDELAMTALYEPDQTVRMLLWQPKGQDLQLLVFHQGGLCFSRQLRGFGALTGEHEPDAMLLDSLALEIQRSLDYLVGQLKLPELGQMQLAIASPFIGTLVRHMEQTFGFAVSAMANKAILSGVEYLSAYAAALGEDA
>CP028568.1|AWA08322.1|4655088_4656036_+|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase
MTDYSLSPQSPPMALPPLQPALLPSPLQAVSHPLLSAYGVQLWCKRDDLIHPAISGNKWRKLKYHLLHAREQGKRHLLSFGGAYSNHIHALAAAGCQSGLRTTGIIRGEPEAVSNCTLSAAKGWGMDLVFVDRQSYRRRQDPAWLAQFEDEETLIVPEGGSSPLAIPGVAELVDEVPFSPDLWVLPCASGGTLAGLIAGKRAPQQILAIAVLKGGSFIADEVHRLHPAAADTPGWRIALDHHDGGYAKFSPALWQWVQAFSAETGLPLEPIYSGKAMWGLFRELAAGRIPRGSKIVFIHTGGMQGLAGLREQGRL
>CP028568.1|AWA08323.1|4656111_4658070_-|RNase-E-specificity-factor-CsrD
MDVVGHTERHMKLTTQLVSFITLCVIAAMAMVLLGGVFSFRELGMEMQQKKVNSLVEIIDKQLEVADDHQDLTRWLPTLLRSAHVVELEIRQDKQRIYWFRDVQQPTDESLLIPYHQPMPHQPGMQADFKLERPFKEFEYSIKAMSGISLGVFIVVFGLWYSIRWLRLQLRGAELLAERAQLILDNKLTKLAHDPADEWPQPASQALDYLLAELADARKERSRFDNFIRSNAFVDKMTGIGNRLFFDNRLESAIMEASVMSGGMLLIELAGLEELDPELNGRQSQDLLMEASASIAAFVRKHNGALQARYAGQVFAVLLPNMSESEMVDGAGQLHKSLQRLHWPEAVNPDTAVYLGAVCYQAEDSLLKVQEEAELALKSARLQGHTGWFLYEKQLDEEQSSKGTVRWRTLIGRRIEEHGIDFYVQPVQQERDQVVLQQDLLIRIHDEQGRELQAGVFMPMAEKAGLLLPLDRLVAEQTLGLLRQRSEQSCPISLTLCAQSLLHREFQRWLFFDLFQLPRSTNERLILQLSEAQVTRHYEALKRPLRALRMLGCQLAIDHAGQDVVSTQYIKEFEINFLKLHPSLVREIHTRQVNQMAVRSLVGGCANTRTRVIAVGVESGDEWKMLRHLGVHAGQGPWFAEPERLVLEPAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

373912 : 437283

uncultured_Mediterranean_phage(21.43%)

transposase,integrase,protease

attL 370830:370846|attR 390271:390287

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
370830:370846	attL	NA	NA	NA	NA
AWA04809.1\|373912_374893_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
AWA04810.1\|375360_375621_+	hypothetical protein	NA	NA	NA	NA
AWA04811.1\|375696_376824_-	Fic family protein	D7RWK9	Brochothrix_phage	1.7e-06	25.7
AWA04812.1\|377253_377565_+	hypothetical protein	NA	NA	NA	NA
AWA04813.1\|377672_378653_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
AWA04814.1\|378994_379501_-	hypothetical protein	NA	NA	NA	NA
AWA04815.1\|379497_379917_-	hypothetical protein	NA	NA	NA	NA
AWA04816.1\|381401_382349_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
AWA04817.1\|383063_384566_-\|integrase	site-specific integrase	NA	NA	NA	NA
AWA04818.1\|384567_385761_-	hypothetical protein	NA	NA	NA	NA
AWA04819.1\|385921_386500_-	single-stranded DNA-binding protein	R9TR60	Vibrio_phage	1.2e-53	58.9
AWA04820.1\|387023_387683_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AWA04821.1\|387778_390604_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	56.3
390271:390287	attR	NA	NA	NA	NA
AWA04822.1\|392878_393490_+	outer membrane protein OmpW	NA	NA	NA	NA
AWA04823.1\|393700_395680_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.0e-27	27.3
AWA04824.1\|395688_397173_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWA04825.1\|397236_398028_-	N-acetyltransferase	NA	NA	NA	NA
AWA04826.1\|398356_399253_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
AWA04827.1\|399315_400380_-	DUF3103 domain-containing protein	NA	NA	NA	NA
AWA04828.1\|400530_401682_-	hypothetical protein	NA	NA	NA	NA
AWA04829.1\|401680_402373_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWA04830.1\|402383_403580_-	NnrS family protein	NA	NA	NA	NA
AWA08664.1\|409538_409856_+	DUF496 domain-containing protein	NA	NA	NA	NA
AWA04831.1\|410072_413156_+	penicillin-binding protein	NA	NA	NA	NA
AWA04832.1\|413242_413788_-	ribosome-associated protein	NA	NA	NA	NA
AWA04833.1\|413880_415224_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
AWA04834.1\|415309_416566_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
AWA04835.1\|416583_416841_-	BolA family transcriptional regulator	NA	NA	NA	NA
AWA04836.1\|416840_417113_-	STAS domain-containing protein	NA	NA	NA	NA
AWA04837.1\|417109_417742_-	phospholipid-binding protein MlaC	NA	NA	NA	NA
AWA04838.1\|417751_418243_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
AWA04839.1\|418250_419030_-	ABC transporter permease	NA	NA	NA	NA
AWA04840.1\|419029_419830_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	7.3e-20	31.2
AWA04841.1\|420037_421033_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.3e-42	36.8
AWA04842.1\|421032_421587_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	2.9e-39	60.7
AWA04843.1\|421583_422144_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AWA04844.1\|422094_422658_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AWA04845.1\|422661_423387_+	lipopolysaccharide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-20	29.5
AWA04846.1\|423452_424892_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
AWA04847.1\|424913_425201_+	ribosome hibernation promoting factor	NA	NA	NA	NA
AWA04848.1\|425203_425650_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
AWA04849.1\|425692_426559_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	6.1e-12	35.1
AWA04850.1\|426579_426852_+	HPr family phosphocarrier protein	NA	NA	NA	NA
AWA04851.1\|428876_429617_-	oxo-acid lyase	NA	NA	NA	NA
AWA04852.1\|429616_430732_-	DgaE family pyridoxal phosphate-dependent ammonia lyase	NA	NA	NA	NA
AWA04853.1\|430715_431855_-	amidohydrolase/deacetylase family metallohydrolase	NA	NA	NA	NA
AWA04854.1\|431898_432549_-	hypothetical protein	NA	NA	NA	NA
AWA04855.1\|432560_433337_-	hypothetical protein	NA	NA	NA	NA
AWA04856.1\|433377_433674_-	cytoplasmic protein	NA	NA	NA	NA
AWA04857.1\|433673_434039_-	transcriptional regulator	NA	NA	NA	NA
AWA04858.1\|434039_434402_-	transcriptional regulator	NA	NA	NA	NA
AWA04859.1\|434710_435832_-	outer membrane-stress sensor serine endopeptidase DegS	A0A1B1IT49	uncultured_Mediterranean_phage	3.5e-20	24.7
AWA04860.1\|435921_437283_-\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	3.5e-22	28.6

DBSCAN-SWA_2

913329 : 923265

uncultured_Mediterranean_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA05284.1\|913329_914076_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	7.2e-70	54.1
AWA05285.1\|914080_914698_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.0e-34	46.4
AWA08684.1\|914700_915276_+	DedA family protein	NA	NA	NA	NA
AWA05286.1\|915286_916327_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	8.6e-13	35.6
AWA05287.1\|916374_917358_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.7e-34	34.1
AWA05288.1\|917442_918456_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.1e-108	58.3
AWA05289.1\|918635_918851_+	30S ribosomal protein S21	NA	NA	NA	NA
AWA05290.1\|918866_919310_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.7e-26	48.6
AWA05291.1\|919398_921186_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.0e-74	41.1
AWA05292.1\|921399_923265_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-34	32.6

DBSCAN-SWA_3

1118749 : 1180912

Salmonella_phage(14.29%)

transposase,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA05446.1\|1118749_1118965_-\|lysis	lysis protein	NA	NA	NA	NA
AWA05447.1\|1118979_1119948_-	hypothetical protein	NA	NA	NA	NA
AWA05448.1\|1120067_1120874_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
AWA05449.1\|1121025_1122432_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AWA05450.1\|1122521_1123391_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AWA05451.1\|1123504_1123840_-	hypothetical protein	NA	NA	NA	NA
AWA05452.1\|1123965_1124307_-	DUF2956 domain-containing protein	NA	NA	NA	NA
AWA05453.1\|1124393_1126223_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AWA05454.1\|1126219_1127167_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
AWA05455.1\|1127554_1129096_-	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
AWA05456.1\|1129274_1130129_-	Tim44 domain-containing protein	NA	NA	NA	NA
AWA05457.1\|1130309_1130411_+	hypothetical protein	NA	NA	NA	NA
AWA05458.1\|1130561_1131956_+	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	5.0e-181	71.5
AWA05459.1\|1132022_1132115_+	hypothetical protein	NA	NA	NA	NA
AWA05460.1\|1132292_1133366_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.1e-22	26.6
AWA05461.1\|1133560_1133809_-	ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.5e-19	52.9
AWA05462.1\|1133810_1135172_-	U32 family peptidase	Q6DW11	Phage_TP	1.1e-164	76.2
AWA05463.1\|1135405_1136107_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AWA05464.1\|1136225_1137173_+\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
AWA05465.1\|1137481_1138204_+	hypothetical protein	NA	NA	NA	NA
AWA05466.1\|1138233_1138725_+	adhesin	NA	NA	NA	NA
AWA05467.1\|1138792_1141231_+	hypothetical protein	NA	NA	NA	NA
AWA05468.1\|1141691_1142672_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
AWA05469.1\|1143627_1144266_-	DNA-binding response regulator	NA	NA	NA	NA
AWA05470.1\|1144386_1147815_+	two-component system sensor histidine kinase/response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	5.9e-42	29.7
AWA05471.1\|1147776_1148070_-	hypothetical protein	NA	NA	NA	NA
AWA05472.1\|1148841_1150089_+	cysteine desulfurase-like protein	NA	NA	NA	NA
AWA05473.1\|1150142_1151204_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AWA05474.1\|1151214_1151685_-	chemotaxis protein CheD	NA	NA	NA	NA
AWA05475.1\|1151695_1152499_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
AWA05476.1\|1154258_1155206_-\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
AWA05477.1\|1155886_1156459_-	chemotaxis protein CheW	NA	NA	NA	NA
AWA05478.1\|1156471_1158394_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
AWA05479.1\|1158409_1160623_-	chemotaxis protein CheA	NA	NA	NA	NA
AWA05480.1\|1160649_1160976_-	anti-sigma factor antagonist	NA	NA	NA	NA
AWA05481.1\|1160990_1161359_-	response regulator	W8CYM9	Bacillus_phage	1.0e-16	40.5
AWA05482.1\|1161368_1162583_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.2e-11	33.1
AWA05483.1\|1162886_1163975_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
AWA05484.1\|1164178_1165120_+	LysR family transcriptional regulator	NA	NA	NA	NA
AWA05485.1\|1165247_1165856_+	LysE family translocator	NA	NA	NA	NA
AWA05486.1\|1165958_1167818_+	U32 family peptidase	Q6DW11	Phage_TP	2.5e-15	40.2
AWA05487.1\|1168584_1169061_-	cysteine methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-21	52.9
AWA05488.1\|1169057_1170617_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
AWA05489.1\|1170826_1171228_+	hypothetical protein	NA	NA	NA	NA
AWA05490.1\|1171297_1172851_-	carboxypeptidase M32	NA	NA	NA	NA
AWA05491.1\|1172878_1173460_-	DNA endonuclease SmrA	NA	NA	NA	NA
AWA05492.1\|1173613_1173799_-	DUF3149 domain-containing protein	NA	NA	NA	NA
AWA05493.1\|1173931_1174825_-	TraB/GumN family protein	NA	NA	NA	NA
AWA05494.1\|1174912_1175245_+	DUF1904 domain-containing protein	NA	NA	NA	NA
AWA05495.1\|1175402_1176230_-	short-chain dehydrogenase	NA	NA	NA	NA
AWA05496.1\|1176348_1177794_-	outer membrane porin, OprD family	NA	NA	NA	NA
AWA05497.1\|1177942_1180912_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.6

DBSCAN-SWA_4

2454721 : 2517043

Catovirus(13.33%)

transposase,tRNA,integrase

attL 2487234:2487251|attR 2518999:2519016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA06542.1\|2454721_2455666_-\|tRNA	tRNA dihydrouridine(16) synthase DusC	NA	NA	NA	NA
AWA06543.1\|2455875_2456253_+	DUF454 domain-containing protein	NA	NA	NA	NA
AWA06544.1\|2456282_2456930_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.3e-30	42.7
AWA06545.1\|2457112_2459659_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.0e-43	36.3
AWA06546.1\|2459782_2460112_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AWA06547.1\|2460915_2461863_-\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
AWA06548.1\|2464106_2465177_+	transcriptional regulator	NA	NA	NA	NA
AWA06549.1\|2465261_2465684_+	CBS domain-containing protein	NA	NA	NA	NA
AWA06550.1\|2465909_2469809_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	2.8e-56	27.3
AWA06551.1\|2469875_2470742_+	hypothetical protein	NA	NA	NA	NA
AWA06552.1\|2470767_2471136_+	50S ribosomal protein L25	NA	NA	NA	NA
AWA06553.1\|2471329_2474512_+	sensor histidine kinase	A0A1V0SGX0	Hokovirus	9.0e-61	31.0
AWA06554.1\|2474508_2475510_+	HD domain-containing protein	W8CYM9	Bacillus_phage	1.6e-11	30.4
AWA06555.1\|2475499_2476144_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AWA06556.1\|2476171_2477272_-\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
AWA06557.1\|2477268_2478306_-	selenide, water dikinase SelD	NA	NA	NA	NA
AWA06558.1\|2478688_2479873_-	acyltransferase	NA	NA	NA	NA
AWA06559.1\|2480133_2480778_+	glutathione S-transferase family protein	NA	NA	NA	NA
AWA06560.1\|2481262_2482456_-	methyltransferase domain-containing protein	NA	NA	NA	NA
AWA06561.1\|2482561_2483992_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-26	33.4
AWA06562.1\|2484077_2484350_+	acylphosphatase	NA	NA	NA	NA
AWA06563.1\|2484435_2485071_-	glutathione S-transferase family protein	NA	NA	NA	NA
AWA06564.1\|2485289_2487323_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
2487234:2487251	attL	NA	NA	NA	NA
AWA06565.1\|2487509_2488592_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AWA06566.1\|2488701_2489346_+	uridine kinase	A0A1V0SAA3	Catovirus	1.4e-32	38.5
AWA06567.1\|2489409_2489991_+	dCTP deaminase	I4AZP2	Saccharomonospora_phage	1.4e-28	40.8
AWA06568.1\|2490024_2490117_-	hypothetical protein	NA	NA	NA	NA
AWA06569.1\|2490398_2491868_+	inorganic phosphate transporter	NA	NA	NA	NA
AWA06570.1\|2492224_2492659_-	mercuric resistance operon regulatory protein	NA	NA	NA	NA
AWA06571.1\|2492730_2493081_+	mercuric transporter	NA	NA	NA	NA
AWA06572.1\|2493094_2493370_+	mercuric transporter periplasmic component	NA	NA	NA	NA
AWA08774.1\|2493405_2493828_+	mercury transport protein MerC	NA	NA	NA	NA
AWA06573.1\|2493879_2495574_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
AWA06574.1\|2495591_2495954_+	transcriptional regulator	NA	NA	NA	NA
AWA06575.1\|2495950_2496187_+	mercury resistance protein	NA	NA	NA	NA
AWA06576.1\|2496183_2496891_+	EAL domain-containing protein	NA	NA	NA	NA
AWA06577.1\|2496929_2498645_+\|transposase	transposase	NA	NA	NA	NA
AWA06578.1\|2498647_2499508_+\|transposase	transposase	NA	NA	NA	NA
AWA06579.1\|2501899_2502655_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
AWA06580.1\|2502669_2504211_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
AWA08775.1\|2505356_2506139_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-33	35.0
AWA06581.1\|2506314_2506815_-	N-acetyltransferase	NA	NA	NA	NA
AWA06582.1\|2506833_2507013_+	hypothetical protein	NA	NA	NA	NA
AWA06583.1\|2507324_2508509_+	saccharopine dehydrogenase family protein	NA	NA	NA	NA
AWA06584.1\|2508596_2509262_-	type B chloramphenicol O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	1.2e-23	42.4
AWA06585.1\|2509684_2509879_+	hypothetical protein	NA	NA	NA	NA
AWA08776.1\|2509839_2511312_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AWA06586.1\|2512497_2513058_-	ETC complex I subunit	NA	NA	NA	NA
AWA06587.1\|2513267_2513621_-	N-acetyltransferase	NA	NA	NA	NA
AWA06588.1\|2513639_2513819_+	hypothetical protein	NA	NA	NA	NA
AWA06589.1\|2513748_2514588_-	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
AWA06590.1\|2514581_2514929_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AWA08777.1\|2515092_2515884_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AWA06591.1\|2516029_2517043_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
2518999:2519016	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2915057 : 2961107

uncultured_Mediterranean_phage(13.33%)

transposase,bacteriocin,plate,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA06920.1\|2915057_2915816_-\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
AWA06921.1\|2916000_2917521_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-88	42.6
AWA06922.1\|2917542_2918031_-\|bacteriocin	bacteriocin production protein	NA	NA	NA	NA
AWA06923.1\|2918217_2919513_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.0e-92	49.9
AWA06924.1\|2919556_2919787_+	hypothetical protein	NA	NA	NA	NA
AWA06925.1\|2919852_2921217_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-79	42.1
AWA08800.1\|2921342_2921951_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AWA06926.1\|2922028_2924551_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	4.7e-89	48.4
AWA06927.1\|2924752_2925244_-	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
AWA06928.1\|2925393_2925624_+	alanine dehydrogenase	NA	NA	NA	NA
AWA06929.1\|2926229_2927180_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.4e-62	44.5
AWA06930.1\|2927237_2928485_+	diguanylate cyclase response regulator	A0A127AWB9	Bacillus_phage	6.5e-15	32.2
AWA06931.1\|2928595_2929066_-	hypothetical protein	NA	NA	NA	NA
AWA08801.1\|2929085_2929793_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AWA06932.1\|2929789_2930506_+	arginyltransferase	NA	NA	NA	NA
AWA06933.1\|2930575_2930794_+	translation initiation factor IF-1	NA	NA	NA	NA
AWA06934.1\|2930863_2933116_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	9.2e-169	43.7
AWA06935.1\|2933175_2933493_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.4e-14	49.4
AWA06936.1\|2933721_2933940_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-17	63.2
AWA06937.1\|2934047_2934911_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.8e-27	31.2
AWA06938.1\|2935961_2937503_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
AWA06939.1\|2937517_2938273_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
AWA06940.1\|2939185_2939371_-	hypothetical protein	NA	NA	NA	NA
AWA06941.1\|2942279_2944325_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.1e-33	26.4
AWA06942.1\|2944335_2944623_-	type VI secretion system PAAR protein	G4KK81	Yersinia_phage	2.3e-08	39.4
AWA06943.1\|2944880_2946311_-	hypothetical protein	NA	NA	NA	NA
AWA06944.1\|2946357_2949843_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
AWA06945.1\|2949884_2951330_-	type VI secretion system protein TssA	NA	NA	NA	NA
AWA06946.1\|2951338_2951944_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
AWA06947.1\|2951943_2953482_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AWA06948.1\|2953484_2956127_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	6.3e-92	33.4
AWA08802.1\|2956147_2956858_-	type IV secretion protein DotU	NA	NA	NA	NA
AWA06949.1\|2956949_2958284_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AWA06950.1\|2958286_2958802_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AWA06951.1\|2958801_2960052_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
AWA06952.1\|2960108_2961107_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_6

3969820 : 3977724

Staphylococcus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA07733.1\|3969820_3970405_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.3e-30	48.7
AWA07734.1\|3970488_3971700_+\|protease	serine protease	V5LS29	Emiliania_huxleyi_virus	4.0e-09	26.9
AWA07735.1\|3971762_3972872_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.9e-65	39.0
AWA07736.1\|3973013_3973667_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.7e-20	36.4
AWA07737.1\|3973721_3974831_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.6e-49	35.2
AWA07738.1\|3974927_3975377_-	transcriptional regulator NrdR	NA	NA	NA	NA
AWA07739.1\|3975499_3975832_-	NIPSNAP family protein	NA	NA	NA	NA
AWA07740.1\|3975907_3976387_-	hypothetical protein	NA	NA	NA	NA
AWA07741.1\|3976470_3977724_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.3e-100	53.5

DBSCAN-SWA_7

4097655 : 4144043

Ralstonia_phage(14.29%)

transposase,tRNA,protease,integrase

attL 4115410:4115469|attR 4144749:4144816

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWA07847.1\|4097655_4099071_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AWA07848.1\|4099261_4101433_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-27	36.5
AWA07849.1\|4101531_4102200_+	opacity-associated protein A	NA	NA	NA	NA
AWA07850.1\|4102472_4102682_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.4e-15	57.1
AWA07851.1\|4103869_4104415_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	5.5e-27	37.5
AWA07852.1\|4104461_4105541_+	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
AWA07853.1\|4105446_4106442_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
AWA07854.1\|4106438_4106690_+	DUF2132 domain-containing protein	NA	NA	NA	NA
AWA07855.1\|4106694_4106946_+	DUF2960 domain-containing protein	NA	NA	NA	NA
AWA07856.1\|4106948_4107347_+	hypothetical protein	NA	NA	NA	NA
AWA07857.1\|4107460_4108030_-	DUF417 domain-containing protein	NA	NA	NA	NA
AWA07858.1\|4108072_4108507_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AWA07859.1\|4108515_4109433_+	AraC family transcriptional regulator	NA	NA	NA	NA
AWA07860.1\|4109493_4109988_-	hypothetical protein	NA	NA	NA	NA
AWA07861.1\|4110159_4112133_+	PAS domain S-box protein	G3MA91	Bacillus_virus	8.4e-09	24.7
AWA07862.1\|4112200_4112707_-	ribonuclease E inhibitor RraB	NA	NA	NA	NA
AWA07863.1\|4112970_4115265_+\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA
4115410:4115469	attL	NA	NA	NA	NA
AWA07864.1\|4116115_4117735_+	hypothetical protein	NA	NA	NA	NA
AWA07865.1\|4118266_4119247_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
AWA07866.1\|4119315_4119897_-	hypothetical protein	NA	NA	NA	NA
AWA07867.1\|4120052_4121000_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
AWA07868.1\|4122225_4122759_+	hypothetical protein	NA	NA	NA	NA
AWA07869.1\|4122755_4123058_+	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.0e-07	39.2
AWA07870.1\|4123080_4123707_+	hypothetical protein	NA	NA	NA	NA
AWA07871.1\|4123703_4124138_+	DUF2787 domain-containing protein	NA	NA	NA	NA
AWA07872.1\|4124354_4124534_-	hypothetical protein	NA	NA	NA	NA
AWA07873.1\|4124630_4125872_+\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	1.5e-27	30.9
AWA07874.1\|4125962_4126385_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWA07875.1\|4126654_4127428_+	hypothetical protein	NA	NA	NA	NA
AWA07876.1\|4127748_4128594_+	hypothetical protein	A0A0R6PH67	Moraxella_phage	6.1e-33	30.5
AWA07877.1\|4128653_4129409_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
AWA07878.1\|4129423_4130965_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
AWA07879.1\|4131386_4132055_+	TM2 domain-containing protein	NA	NA	NA	NA
AWA07880.1\|4132067_4132757_+	hypothetical protein	NA	NA	NA	NA
AWA07881.1\|4132917_4134354_+	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	2.0e-07	32.3
AWA07882.1\|4135889_4136375_-	hypothetical protein	NA	NA	NA	NA
AWA07883.1\|4136362_4137988_-	thiamine biosynthesis protein ThiF	NA	NA	NA	NA
AWA07884.1\|4137993_4139142_-	hypothetical protein	NA	NA	NA	NA
AWA08863.1\|4139151_4140138_-	patatin	A0A1B2LRS3	Wolbachia_phage	6.7e-23	26.7
AWA07885.1\|4140453_4140699_-	hypothetical protein	NA	NA	NA	NA
AWA07886.1\|4140685_4142878_-	DUF927 domain-containing protein	NA	NA	NA	NA
AWA07887.1\|4142891_4144043_-\|integrase	site-specific integrase	Q4ZCC1	Staphylococcus_virus	6.4e-09	24.4
4144749:4144816	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP028567

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP028565

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP028568

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection