CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP028545	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p3_020143, complete sequence	0 crisprs	NA	0
CP028544	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p2_020143, complete sequence	0 crisprs	DEDDh	1
CP028546	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p4_020143, complete sequence	0 crisprs	NA	0
CP028547	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid pKPC2_020143, complete sequence	0 crisprs	NA	1
CP028543	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p1_020143, complete sequence	0 crisprs	csa3,cas3,RT	2
CP028548	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 chromosome, complete genome	1 crisprs	csa3,RT,cas3,DEDDh,DinG,WYL	11

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1796 : 51815

Escherichia_phage(33.33%)

transposase,integrase,protease

attL 8127:8186|attR 59256:60078

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ87353.1\|1796_2450_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVZ87354.1\|2669_3134_+	mRNA interferase PemK	NA	NA	NA	NA
AVZ87355.1\|3130_3235_+	hypothetical protein	NA	NA	NA	NA
AVZ87356.1\|4444_5149_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87357.1\|5617_6175_-	hypothetical protein	NA	NA	NA	NA
AVZ87429.1\|6302_6653_-	hypothetical protein	NA	NA	NA	NA
AVZ87358.1\|6700_7405_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87359.1\|7395_7590_+	hypothetical protein	NA	NA	NA	NA
AVZ87360.1\|7691_8066_+	hypothetical protein	A0A248SL90	Klebsiella_phage	2.2e-27	62.7
8127:8186	attL	NA	NA	NA	NA
AVZ87361.1\|8191_8896_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87362.1\|8961_9150_-	hypothetical protein	NA	NA	NA	NA
AVZ87430.1\|9241_9778_+	recombinase	Q1MVP4	Enterobacteria_phage	2.8e-84	100.0
AVZ87363.1\|9960_10821_+	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
AVZ87364.1\|10990_11746_+	16S rRNA (guanine(1405)-N(7))-methyltransferase RmtB1	NA	NA	NA	NA
AVZ87365.1\|12195_12900_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87366.1\|14101_14359_+	hypothetical protein	NA	NA	NA	NA
AVZ87367.1\|14404_15184_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.4e-52	92.0
AVZ87368.1\|15367_16372_-	hypothetical protein	NA	NA	NA	NA
AVZ87369.1\|16401_16605_-	hypothetical protein	NA	NA	NA	NA
AVZ87370.1\|16650_17172_-	hypothetical protein	NA	NA	NA	NA
AVZ87431.1\|17229_17580_-	hypothetical protein	NA	NA	NA	NA
AVZ87371.1\|17658_18603_-	hypothetical protein	NA	NA	NA	NA
AVZ87432.1\|18763_19198_-	hypothetical protein	NA	NA	NA	NA
AVZ87372.1\|19181_19412_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AVZ87373.1\|19408_19825_+	PIN domain nuclease	NA	NA	NA	NA
AVZ87374.1\|19898_21461_+	ATP-dependent endonuclease	NA	NA	NA	NA
AVZ87375.1\|21445_22468_+	DNA helicase UvrD	NA	NA	NA	NA
AVZ87376.1\|23746_24628_+	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
AVZ87377.1\|25862_26159_-	transcriptional repressor protein KorC	NA	NA	NA	NA
AVZ87378.1\|26487_26913_-	antirestriction protein	A0A2D0W8Z5	Bordetella_virus	5.3e-17	37.3
AVZ87379.1\|27023_27302_-	hypothetical protein	NA	NA	NA	NA
AVZ87380.1\|28844_29405_+\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
AVZ87381.1\|29408_32375_+\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
AVZ87382.1\|32615_33476_+	class A extended-spectrum beta-lactamase SHV-12	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AVZ87383.1\|33496_34258_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AVZ87384.1\|34248_34482_+	hypothetical protein	NA	NA	NA	NA
AVZ87385.1\|34519_35422_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AVZ87386.1\|37055_37760_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87387.1\|38009_38990_-\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ87433.1\|39503_39899_+	hypothetical protein	NA	NA	NA	NA
AVZ87388.1\|39895_40507_+	DUF2913 domain-containing protein	NA	NA	NA	NA
AVZ87389.1\|40503_41454_-\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	6.6e-76	55.6
AVZ87390.1\|41600_41801_-	hypothetical protein	NA	NA	NA	NA
AVZ87391.1\|41854_42487_-	LacI family DNA-binding transcriptional regulator	A0A1V0E035	Clostridioides_phage	2.5e-07	31.9
AVZ87392.1\|42849_44055_+	ParA family protein	Q1MVJ3	Enterobacteria_phage	1.1e-205	89.2
AVZ87393.1\|44051_45023_+	ParB/RepB/Spo0J family partition protein	Q1MVJ4	Enterobacteria_phage	1.4e-113	68.9
AVZ87394.1\|45158_46430_-	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	6.1e-154	63.0
AVZ87395.1\|46429_46852_-	peptidase	A0A1W6JNS2	Morganella_phage	3.1e-30	51.5
AVZ87396.1\|47031_47703_-	DNA breaking-rejoining protein	A0A2H4J5W2	uncultured_Caudovirales_phage	5.1e-83	61.7
AVZ87397.1\|48061_48739_+	DNA methylase	A0A2I7RE86	Vibrio_phage	1.6e-28	36.9
AVZ87398.1\|48738_48960_+	hypothetical protein	NA	NA	NA	NA
AVZ87399.1\|48970_49390_+	DUF1380 domain-containing protein	NA	NA	NA	NA
AVZ87400.1\|49443_50223_+	hypothetical protein	NA	NA	NA	NA
AVZ87401.1\|50627_51134_+	antirestriction protein	A0A1I9S7Y0	Rhodococcus_phage	4.8e-09	31.8
AVZ87402.1\|51176_51368_+	hypothetical protein	NA	NA	NA	NA
AVZ87403.1\|51554_51815_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	4.1e-12	46.2
59256:60078	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP028543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4961 : 66699

uncultured_Caudovirales_phage(29.41%)

protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ87058.1\|4961_5885_+\|transposase	IS5/IS1182 family transposase	Q9MCT5	Escherichia_phage	2.1e-175	98.4
AVZ87059.1\|6557_6815_-	hypothetical protein	NA	NA	NA	NA
AVZ87060.1\|7434_8871_+	diguanylate cyclase	NA	NA	NA	NA
AVZ87061.1\|9853_11131_-	DUF2254 domain-containing protein	NA	NA	NA	NA
AVZ87062.1\|11193_13197_-\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	9.7e-21	25.9
AVZ87199.1\|14230_15438_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	1.7e-100	63.2
AVZ87063.1\|16866_17298_-	silver-binding protein SilE	NA	NA	NA	NA
AVZ87064.1\|17548_19024_-	Cu(+)/Ag(+) sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-27	30.1
AVZ87065.1\|19016_19697_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.1e-31	35.6
AVZ87066.1\|19886_21272_+	hypothetical protein	NA	NA	NA	NA
AVZ87067.1\|21300_21654_+	copper ABC transporter substrate-binding protein	NA	NA	NA	NA
AVZ87068.1\|21767_23060_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AVZ87069.1\|23070_26217_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	4.0e-61	22.5
AVZ87070.1\|26303_26744_+	hypothetical protein	NA	NA	NA	NA
AVZ87071.1\|26870_29318_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	7.6e-84	35.8
AVZ87072.1\|29358_29556_+	DUF2933 domain-containing protein	NA	NA	NA	NA
AVZ87073.1\|29589_30327_-	peptidase M23	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
AVZ87074.1\|30615_31065_-	copper resistance protein	NA	NA	NA	NA
AVZ87075.1\|31298_33116_+	multicopper oxidase PcoA	NA	NA	NA	NA
AVZ87076.1\|33115_34012_+	copper resistance protein B	NA	NA	NA	NA
AVZ87077.1\|34051_34432_+	copper resistance system chaperone PcoC	NA	NA	NA	NA
AVZ87078.1\|34436_35366_+	copper resistance protein D	NA	NA	NA	NA
AVZ87079.1\|35420_36101_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AVZ87080.1\|36097_37498_+	sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-18	26.3
AVZ87081.1\|37714_38149_+	copper-binding protein	NA	NA	NA	NA
AVZ87200.1\|38380_38560_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AVZ87082.1\|40302_40812_+	porin	NA	NA	NA	NA
AVZ87083.1\|40861_41359_-	N-acetyltransferase	NA	NA	NA	NA
AVZ87084.1\|41690_42017_+	transcriptional regulator	NA	NA	NA	NA
AVZ87201.1\|42016_42727_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-92	77.0
AVZ87085.1\|42735_43281_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
AVZ87086.1\|43356_43719_+	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AVZ87087.1\|45615_46152_+	N-acetyltransferase	NA	NA	NA	NA
AVZ87088.1\|46184_46610_-	arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	72.9
AVZ87089.1\|46622_47912_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.9e-171	74.0
AVZ87090.1\|47959_49711_-	arsenical pump-driving ATPase	NA	NA	NA	NA
AVZ87091.1\|49728_50091_-	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AVZ87092.1\|50140_50491_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.4e-23	50.9
AVZ87093.1\|50848_51118_+	hypothetical protein	NA	NA	NA	NA
AVZ87094.1\|51105_51681_+	hypothetical protein	NA	NA	NA	NA
AVZ87095.1\|51711_52206_+	DNA-binding protein	NA	NA	NA	NA
AVZ87096.1\|52249_52618_+	hypothetical protein	NA	NA	NA	NA
AVZ87097.1\|52651_52855_+	hemolysin expression modulator Hha	NA	NA	NA	NA
AVZ87098.1\|52903_53161_+	hypothetical protein	NA	NA	NA	NA
AVZ87099.1\|53236_53491_+	hypothetical protein	NA	NA	NA	NA
AVZ87100.1\|53666_53933_+	DUF1778 domain-containing protein	NA	NA	NA	NA
AVZ87101.1\|53920_54403_+	N-acetyltransferase	NA	NA	NA	NA
AVZ87202.1\|54614_55961_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
AVZ87102.1\|57803_58766_-\|protease	Zn-dependent protease	NA	NA	NA	NA
AVZ87103.1\|58752_59502_-	diguanylate cyclase	NA	NA	NA	NA
AVZ87104.1\|59739_59937_-	hypothetical protein	NA	NA	NA	NA
AVZ87105.1\|59936_62732_-	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	5.2e-129	41.0
AVZ87106.1\|62846_63416_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AVZ87203.1\|63450_63732_-	DNA-binding protein	A0A1B1IUF9	uncultured_Mediterranean_phage	5.2e-05	38.2
AVZ87107.1\|65718_66699_+\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1

DBSCAN-SWA_2

73168 : 106162

Escherichia_phage(45.45%)

integrase,transposase,bacteriocin

attL 83068:83127|attR 90960:91779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ87112.1\|73168_73873_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AVZ87113.1\|75207_76212_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AVZ87114.1\|76503_77172_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.9e-130	99.5
AVZ87115.1\|77891_78137_-	hypothetical protein	NA	NA	NA	NA
AVZ87116.1\|78142_78334_+	hypothetical protein	NA	NA	NA	NA
AVZ87117.1\|78815_79358_-	tunicamycin resistance protein	NA	NA	NA	NA
AVZ87118.1\|79370_80231_-	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
AVZ87119.1\|81054_82425_-\|transposase	IS1182 family transposase ISCfr1	NA	NA	NA	NA
83068:83127	attL	NA	NA	NA	NA
AVZ87120.1\|83130_83835_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87121.1\|83780_84098_-\|transposase	transposase	NA	NA	NA	NA
AVZ87122.1\|84036_85050_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AVZ87123.1\|85194_85692_+	trimethoprim-resistant dihydrofolate reductase DfrA12	A0A0A0PL85	Bacillus_phage	7.5e-23	40.9
AVZ87124.1\|85803_86094_+	hypothetical protein	NA	NA	NA	NA
AVZ87125.1\|86099_86891_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AVZ87126.1\|87054_87402_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AVZ87127.1\|87395_88235_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AVZ87128.1\|88164_88344_-	hypothetical protein	NA	NA	NA	NA
AVZ87129.1\|88362_88863_+	N-acetyltransferase	NA	NA	NA	NA
AVZ87130.1\|89168_89282_-	NTP-binding protein	NA	NA	NA	NA
AVZ87131.1\|89369_90134_+\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AVZ87132.1\|90474_91011_+	recombinase family protein	E5FFF9	Burkholderia_phage	6.8e-46	60.6
AVZ87133.1\|91022_91727_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ87134.1\|91793_93191_+	HAMP domain-containing protein	A0A1B0V854	Salmonella_phage	1.1e-58	99.2
90960:91779	attR	NA	NA	NA	NA
AVZ87135.1\|93729_96039_+	ATPase	NA	NA	NA	NA
AVZ87136.1\|96042_97359_+	ATP-binding protein	NA	NA	NA	NA
AVZ87137.1\|97355_99551_+	DEAD/DEAH box helicase	NA	NA	NA	NA
AVZ87207.1\|100172_100361_+	hypothetical protein	NA	NA	NA	NA
AVZ87138.1\|100504_100693_+	hypothetical protein	NA	NA	NA	NA
AVZ87139.1\|100997_101855_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
AVZ87208.1\|101847_101925_-	RepA leader peptide Tap	NA	NA	NA	NA
AVZ87140.1\|102141_102420_-	replication protein	NA	NA	NA	NA
AVZ87209.1\|102740_103292_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	1.1e-19	35.2
AVZ87141.1\|103560_103839_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AVZ87142.1\|103840_106162_-\|bacteriocin	klebicin B-related nuclease bacteriocin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP028544

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 110241

115

Salmonella_phage(82.52%)

capsid,tail,integrase,terminase

attL 3652:3676|attR 20855:20879

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ87216.1\|0_1098_+	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	1.7e-72	45.1
AVZ87217.1\|1528_1741_-	hypothetical protein	J9Q7S8	Salmonella_phage	4.3e-28	80.0
AVZ87218.1\|1740_2076_-	hypothetical protein	J9Q7Z5	Salmonella_phage	2.1e-37	67.6
AVZ87219.1\|2072_2252_-	hypothetical protein	NA	NA	NA	NA
AVZ87220.1\|2785_3862_-	recombinase	J9Q736	Salmonella_phage	8.5e-197	96.1
3652:3676	attL	NA	NA	NA	NA
AVZ87221.1\|3864_4131_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.1e-33	83.0
AVZ87222.1\|4130_5075_-	exonuclease	J9Q7S6	Salmonella_phage	2.8e-172	93.6
AVZ87223.1\|5135_6143_-	regulator	J9Q7Z3	Salmonella_phage	2.1e-144	88.3
AVZ87224.1\|6262_6694_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.1e-65	91.6
AVZ87225.1\|6849_7149_-	hypothetical protein	NA	NA	NA	NA
AVZ87226.1\|7159_7579_-	hypothetical protein	A0A291AWZ9	Escherichia_phage	6.3e-47	62.6
AVZ87227.1\|7779_8223_-	hypothetical protein	J9Q7S4	Salmonella_phage	9.9e-59	83.0
AVZ87228.1\|8219_9389_-	uracil-DNA glycosylase	J9Q7Z2	Salmonella_phage	4.4e-207	92.3
AVZ87229.1\|9410_10112_-	hypothetical protein	S5YLC4	Mycobacterium_phage	6.4e-20	37.1
AVZ87230.1\|10108_12472_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	86.6
AVZ87231.1\|12446_12650_-	hypothetical protein	J9Q6I7	Salmonella_phage	3.3e-25	80.6
AVZ87232.1\|12652_13885_-	porphyrin biosynthesis protein	J9Q733	Salmonella_phage	2.2e-212	86.4
AVZ87233.1\|13981_16261_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	7.2e-246	63.6
AVZ87234.1\|16863_17244_+	transcriptional regulator	NA	NA	NA	NA
AVZ87235.1\|17238_18339_-\|integrase	integrase	A0A1P8DTG6	Proteus_phage	1.6e-17	28.4
AVZ87236.1\|18587_18998_-	toxin YafO	NA	NA	NA	NA
AVZ87329.1\|19007_19418_-	hypothetical protein	NA	NA	NA	NA
AVZ87237.1\|19707_19953_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	5.3e-14	47.4
AVZ87238.1\|19949_20336_-	hypothetical protein	Q716B1	Shigella_phage	4.1e-45	70.4
AVZ87239.1\|20345_21122_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	8.5e-90	65.4
20855:20879	attR	NA	NA	NA	NA
AVZ87240.1\|21233_22106_-	hypothetical protein	NA	NA	NA	NA
AVZ87241.1\|22895_23195_-	C-type natriuretic protein	J9Q7S1	Salmonella_phage	3.6e-28	66.3
AVZ87242.1\|23191_23344_-	hypothetical protein	J9Q7Z1	Salmonella_phage	1.6e-16	82.0
AVZ87243.1\|23588_24056_-	hypothetical protein	J9Q7R9	Salmonella_phage	1.3e-48	63.9
AVZ87244.1\|24135_24924_-	hypothetical protein	J9Q7Z0	Salmonella_phage	1.5e-70	51.1
AVZ87245.1\|25044_26160_-	DNA primase	J9Q720	Salmonella_phage	8.2e-203	91.3
AVZ87246.1\|26313_27654_-	DNA helicase	J9Q7G4	Salmonella_phage	3.5e-240	95.5
AVZ87247.1\|27718_28444_-	hypothetical protein	J9Q7R8	Salmonella_phage	2.5e-128	88.8
AVZ87248.1\|28616_30380_-	hypothetical protein	X2KLG0	Campylobacter_phage	5.6e-12	27.4
AVZ87249.1\|30376_30739_-	hypothetical protein	J9Q7G3	Salmonella_phage	1.2e-43	97.9
AVZ87250.1\|30738_31404_-	plasmid stability protein	J9Q7R7	Salmonella_phage	2.9e-102	83.7
AVZ87251.1\|31697_32282_+	hypothetical protein	A0A2H4J5U3	uncultured_Caudovirales_phage	6.5e-34	42.6
AVZ87252.1\|32478_32730_-	hypothetical protein	J9Q7R6	Salmonella_phage	2.0e-24	73.5
AVZ87253.1\|32732_33425_-	hypothetical protein	J9Q7Y7	Salmonella_phage	2.7e-119	89.1
AVZ87254.1\|33438_33762_-	hypothetical protein	J9Q6E7	Salmonella_phage	2.3e-49	95.3
AVZ87255.1\|33857_35303_-	endosialidase chaperone	A0A0H4TGH1	Klebsiella_phage	4.4e-39	37.5
AVZ87256.1\|35355_47526_-	DUF1983 domain-containing protein	J9Q713	Salmonella_phage	1.8e-29	58.3
AVZ87257.1\|47542_48154_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.1e-76	72.1
AVZ87258.1\|48141_48939_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	5.4e-140	85.3
AVZ87259.1\|48931_49630_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	1.2e-122	87.4
AVZ87260.1\|49716_50052_-\|tail	phage tail protein	J9Q6E1	Salmonella_phage	2.6e-51	84.5
AVZ87261.1\|50095_54631_-\|tail	phage tail tape measure protein	J9Q712	Salmonella_phage	0.0e+00	69.8
AVZ87262.1\|54638_54872_-	hypothetical protein	J9Q7F7	Salmonella_phage	3.4e-34	93.5
AVZ87263.1\|54988_55306_-	hypothetical protein	J9Q7R3	Salmonella_phage	1.8e-46	93.3
AVZ87264.1\|55367_56114_-	hypothetical protein	J9Q7Y4	Salmonella_phage	8.1e-106	82.6
AVZ87265.1\|56181_56574_-	hypothetical protein	J9Q6D8	Salmonella_phage	5.0e-46	66.7
AVZ87266.1\|56575_57049_-	hypothetical protein	J9Q711	Salmonella_phage	1.9e-76	93.6
AVZ87267.1\|57039_57384_-	hypothetical protein	J9Q7F6	Salmonella_phage	7.4e-54	92.1
AVZ87268.1\|57481_58315_-	hypothetical protein	J9Q7R2	Salmonella_phage	4.8e-131	83.4
AVZ87269.1\|58314_58749_-	hypothetical protein	J9Q7Y3	Salmonella_phage	1.1e-62	84.0
AVZ87270.1\|58796_59225_-	hypothetical protein	J9Q6D6	Salmonella_phage	7.9e-29	71.6
AVZ87271.1\|59302_60181_-\|capsid	phage major capsid protein	J9Q710	Salmonella_phage	4.7e-153	94.2
AVZ87272.1\|60207_61107_-	hypothetical protein	J9Q7F4	Salmonella_phage	6.1e-124	82.6
AVZ87273.1\|61129_62719_-	hypothetical protein	J9Q7R1	Salmonella_phage	7.4e-274	88.4
AVZ87274.1\|62736_63993_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	9.4e-248	97.4
AVZ87275.1\|63995_64637_-	DNA-binding protein	J9Q6D4	Salmonella_phage	5.0e-96	88.2
AVZ87276.1\|64814_65081_-	hypothetical protein	J9Q757	Salmonella_phage	1.3e-37	90.9
AVZ87277.1\|65090_65990_-	hypothetical protein	J9Q7I6	Salmonella_phage	4.2e-165	97.0
AVZ87278.1\|65986_66241_-	hypothetical protein	J9Q7U0	Salmonella_phage	3.4e-40	95.2
AVZ87279.1\|66233_66872_-	adenylyl-sulfate kinase	J9Q807	Salmonella_phage	1.4e-109	97.6
AVZ87280.1\|66868_67537_-	chromosome partitioning protein ParB	J9Q6L1	Salmonella_phage	3.9e-107	92.3
AVZ87281.1\|67536_68217_-	chromosome partitioning protein ParB	J9Q756	Salmonella_phage	3.6e-108	89.7
AVZ87282.1\|68300_69860_+	ATP-dependent helicase	J9Q7I4	Salmonella_phage	1.3e-278	92.7
AVZ87283.1\|69862_70138_+	hypothetical protein	J9Q7T9	Salmonella_phage	4.0e-26	68.1
AVZ87284.1\|70188_70626_-	hypothetical protein	A0A1V0E7W1	Vibrio_phage	9.5e-14	36.4
AVZ87285.1\|70781_71312_+	transcriptional regulator	J9Q6L0	Salmonella_phage	1.3e-70	84.5
AVZ87330.1\|71444_71624_+	hypothetical protein	NA	NA	NA	NA
AVZ87286.1\|71945_72596_+	hypothetical protein	J9Q754	Salmonella_phage	8.4e-107	91.7
AVZ87287.1\|72646_72850_+	hypothetical protein	J9Q7I3	Salmonella_phage	4.1e-28	95.5
AVZ87288.1\|73442_73925_-	hypothetical protein	J9Q805	Salmonella_phage	2.7e-70	77.5
AVZ87289.1\|74130_74412_-	ABC transporter	J9Q753	Salmonella_phage	2.9e-40	82.8
AVZ87290.1\|74414_74789_-	hypothetical protein	NA	NA	NA	NA
AVZ87291.1\|74916_75324_-	hypothetical protein	NA	NA	NA	NA
AVZ87292.1\|75443_75755_-	hypothetical protein	J9Q7T7	Salmonella_phage	5.2e-30	68.0
AVZ87293.1\|75891_76104_-	hypothetical protein	J9Q804	Salmonella_phage	9.9e-25	74.3
AVZ87294.1\|76116_76335_-	hypothetical protein	J9Q6K7	Salmonella_phage	2.9e-27	81.9
AVZ87295.1\|77108_77411_+	hypothetical protein	J9Q7T6	Salmonella_phage	8.0e-12	66.7
AVZ87296.1\|78212_80078_+	DUF262 domain-containing protein	NA	NA	NA	NA
AVZ87297.1\|80281_81838_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.9e-104	42.7
AVZ87298.1\|81834_83019_+	restriction endonuclease subunit S	A0A240FAT6	Liberibacter_phage	1.3e-41	50.6
AVZ87299.1\|83140_86257_+	DEAD/DEAH box helicase	A0A220A398	Liberibacter_phage	1.0e-24	23.8
AVZ87300.1\|86318_86534_-	DNA modification methylase	J9Q747	Salmonella_phage	1.2e-14	69.8
AVZ87301.1\|86662_87241_-	hypothetical protein	J9Q7H6	Salmonella_phage	5.1e-55	57.0
AVZ87302.1\|87368_87524_-	DUF3927 domain-containing protein	H6WZJ7	Escherichia_phage	1.7e-05	61.2
AVZ87303.1\|87523_87949_-	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	9.8e-56	80.9
AVZ87304.1\|88051_88240_-	hypothetical protein	J9Q800	Salmonella_phage	3.3e-08	52.5
AVZ87305.1\|88236_88515_-	hypothetical protein	NA	NA	NA	NA
AVZ87306.1\|88885_89536_-	ribonuclease HI	J9Q745	Salmonella_phage	4.9e-91	80.1
AVZ87307.1\|90114_90342_-	hypothetical protein	J9Q7H5	Salmonella_phage	7.6e-31	84.0
AVZ87308.1\|90539_91133_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	1.7e-98	84.8
AVZ87309.1\|91317_92151_-	hypothetical protein	J9Q7Z9	Salmonella_phage	1.1e-63	56.4
AVZ87310.1\|92276_92825_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	3.2e-75	74.4
AVZ87331.1\|92821_93403_-	hypothetical protein	A0A1B0VMI8	Pseudomonas_phage	4.2e-33	50.4
AVZ87311.1\|93625_94045_-	hypothetical protein	J9Q743	Salmonella_phage	1.9e-51	73.4
AVZ87312.1\|94108_94753_-	hypothetical protein	J9Q7H4	Salmonella_phage	1.4e-93	77.1
AVZ87313.1\|94752_95229_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.3e-72	80.3
AVZ87314.1\|95225_95639_-	hypothetical protein	J9Q7Z8	Salmonella_phage	6.2e-55	77.4
AVZ87315.1\|95640_96744_-	thymidylate synthase	J9Q6J6	Salmonella_phage	2.5e-180	79.8
AVZ87316.1\|96937_97813_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	1.3e-139	84.4
AVZ87317.1\|97890_99033_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	4.4e-212	95.5
AVZ87318.1\|99163_101467_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	90.9
AVZ87319.1\|101542_102112_-	hypothetical protein	J9Q7Z7	Salmonella_phage	1.1e-94	89.9
AVZ87320.1\|102121_102868_-	hypothetical protein	J9Q6J5	Salmonella_phage	7.7e-80	62.1
AVZ87321.1\|102857_104774_-	exonuclease	J9Q741	Salmonella_phage	2.1e-299	84.5
AVZ87322.1\|104770_105004_-	hypothetical protein	J9Q7H1	Salmonella_phage	4.4e-18	66.1
AVZ87323.1\|105003_106089_-	exonuclease	J9Q7S9	Salmonella_phage	1.8e-183	84.8
AVZ87324.1\|106515_106728_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVZ87325.1\|106724_107591_+	hypothetical protein	A0A2I6UHT9	Bacillus_phage	1.1e-05	55.8
AVZ87326.1\|107621_109082_-	hypothetical protein	A0A2I6UHU5	Bacillus_phage	5.0e-59	33.3
AVZ87327.1\|109596_110241_-	hypothetical protein	J9Q739	Salmonella_phage	1.1e-98	80.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP028548

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP028548_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028548_1

4561004-4561098

Orphan

Consensus_repeat	Method
ACTATGGTTTTTATGGTTTTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028548_1

>merge|CP028548|1|4561004-4561098|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATGGTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATGACTGTGGTTTTTATGGTTTTTATT

>CP028548|1|1|4561004-4561098|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATG	GTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATG
ACTGTGGTTTTTATGGTTTTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP028548.1\|AVZ91676.1\|4563585_4564413_-\|co-chaperone-DjlA	unknown	unknown	gnl\|CDD\|236512
CP028548.1\|AVZ91682.1\|4570543_4571392_+\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	unknown	unknown	gnl\|CDD\|273208
CP028548.1\|AVZ92699.1\|4559333_4559522_+\|hypothetical-protein	unknown	unknown	unknown
CP028548.1\|AVZ91678.1\|4567059_4568346_+\|peptidylprolyl-isomerase-SurA	unknown	unknown	gnl\|CDD\|236758
CP028548.1\|AVZ91677.1\|4564656_4567005_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|235158
CP028548.1\|AVZ91667.1\|4550650_4551346_-\|L-ribulose-5-phosphate-4-epimerase	unknown	unknown	gnl\|CDD\|236181
CP028548.1\|AVZ91670.1\|4554814_4555519_-\|IS6-family-transposase-IS15DIV	unknown	unknown	gnl\|CDD\|225853
CP028548.1\|AVZ91666.1\|4548117_4550475_-\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
CP028548.1\|AVZ91675.1\|4562854_4563553_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
CP028548.1\|AVZ91681.1\|4570161_4570539_+\|Co2+/Mg2+-efflux-protein-ApaG	unknown	unknown	gnl\|CDD\|180098
CP028548.1\|AVZ91665.1\|4546761_4547466_+\|IS6-family-transposase-IS15DIV	unknown	unknown	gnl\|CDD\|225853
CP028548.1\|AVZ91669.1\|4552996_4554706_-\|ribulokinase	unknown	unknown	gnl\|CDD\|235221
CP028548.1\|AVZ91671.1\|4558097_4558757_+\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	unknown	unknown	gnl\|CDD\|236659
CP028548.1\|AVZ91668.1\|4551483_4552986_-\|L-arabinose-isomerase	unknown	unknown	gnl\|CDD\|179503
CP028548.1\|AVZ91674.1\|4561239_4562865_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
CP028548.1\|AVZ91672.1\|4558831_4559371_-\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	unknown	unknown	gnl\|CDD\|163145
CP028548.1\|AVZ91679.1\|4568351_4569341_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|234696
CP028548.1\|AVZ91683.1\|4571344_4571548_-\|hypothetical-protein	unknown	unknown	unknown
CP028548.1\|AVZ91680.1\|4569337_4570159_+\|ribosomal-RNA-small-subunit-methyltransferase-A	unknown	unknown	gnl\|CDD\|234708
CP028548.1\|AVZ91673.1\|4559550_4560915_-\|malate-permease	unknown	unknown	gnl\|CDD\|377030

Protein	Function_ID	Function_description	E-value
CP028548.1\|AVZ91676.1\|4563585_4564413_-\|co-chaperone-DjlA	gnl\|CDD\|236512	PRK09430, djlA, co-chaperone DjlA.	2.63694e-164
CP028548.1\|AVZ91682.1\|4570543_4571392_+\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	gnl\|CDD\|273208	TIGR00668, Bis5'-nucleosyl-tetraphosphatase_symmetrical, bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions. It is hydrolyzed to two ADP by this enzyme. Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase. [Cellular processes, Adaptations to atypical conditions].	0
CP028548.1\|AVZ91678.1\|4567059_4568346_+\|peptidylprolyl-isomerase-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	0
CP028548.1\|AVZ91677.1\|4564656_4567005_+\|LPS-assembly-protein-LptD	gnl\|CDD\|235158	PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional.	0
CP028548.1\|AVZ91667.1\|4550650_4551346_-\|L-ribulose-5-phosphate-4-epimerase	gnl\|CDD\|236181	PRK08193, araD, L-ribulose-5-phosphate 4-epimerase AraD.	0
CP028548.1\|AVZ91670.1\|4554814_4555519_-\|IS6-family-transposase-IS15DIV	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
CP028548.1\|AVZ91666.1\|4548117_4550475_-\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
CP028548.1\|AVZ91668.1\|4551483_4552986_-\|L-arabinose-isomerase	gnl\|CDD\|179503	PRK02929, PRK02929, L-arabinose isomerase; Provisional.	0
CP028548.1\|AVZ91681.1\|4570161_4570539_+\|Co2+/Mg2+-efflux-protein-ApaG	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	7.84855e-74
CP028548.1\|AVZ91665.1\|4546761_4547466_+\|IS6-family-transposase-IS15DIV	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
CP028548.1\|AVZ91669.1\|4552996_4554706_-\|ribulokinase	gnl\|CDD\|235221	PRK04123, PRK04123, ribulokinase; Provisional.	0
CP028548.1\|AVZ91671.1\|4558097_4558757_+\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	gnl\|CDD\|236659	PRK10158, PRK10158, bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA.	2.4454e-161
CP028548.1\|AVZ91675.1\|4562854_4563553_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	5.03078e-66
CP028548.1\|AVZ91674.1\|4561239_4562865_+\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	6.55037e-173
CP028548.1\|AVZ91672.1\|4558831_4559371_-\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	gnl\|CDD\|163145	TIGR03124, citrate_citX, holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair].	5.54697e-86
CP028548.1\|AVZ91679.1\|4568351_4569341_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|234696	PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed.	0
CP028548.1\|AVZ91680.1\|4569337_4570159_+\|ribosomal-RNA-small-subunit-methyltransferase-A	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	3.65731e-147
CP028548.1\|AVZ91673.1\|4559550_4560915_-\|malate-permease	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	4.87969e-169

>CP028548.1|AVZ91673.1|4559550_4560915_-|malate-permease
MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA
>CP028548.1|AVZ92699.1|4559333_4559522_+|hypothetical-protein
MLTPAWAGVSTDINSSPTYDKYDSAWTVMMMVAIADRALIVTLNAEHLGYRTQIFSAFCSGK
>CP028548.1|AVZ91672.1|4558831_4559371_-|citrate-lyase-holo-[acyl-carrier-protein]-synthase
MSVDTPAQAGVSIDALLAAKEQRAARQADWLAHYQQPVISLTLVTPGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKAMCSTLEQSHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDLVVARVEQMIDAWFARD
>CP028548.1|AVZ91671.1|4558097_4558757_+|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA
MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDSVMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHPQPAEGLVDLPLICDWPNRPKQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQLRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNAMTFRAPIDF
>CP028548.1|AVZ91670.1|4554814_4555519_-|IS6-family-transposase-IS15DIV
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>CP028548.1|AVZ91669.1|4552996_4554706_-|ribulokinase
MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDGANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLALREEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHVTREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASFFDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQSVAISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGDIYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYDDIPAAQQRMASQVETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSKAALTH
>CP028548.1|AVZ91668.1|4551483_4552986_-|L-arabinose-isomerase
MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHVVNSLNAEAKLPCKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFHTQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDISALVDEYESSYRLTPAAQVHGEKRQNVLDAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFDNGNDLVLGSHMLEVCPTIATVEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDLGDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALNLDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR
>CP028548.1|AVZ91667.1|4550650_4551346_-|L-ribulose-5-phosphate-4-epimerase
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSGVDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQAFPTLGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRKHGAKAYYGQ
>CP028548.1|AVZ91666.1|4548117_4550475_-|DNA-polymerase-II
MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVAFIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVTVYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSRHGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFIASRPLLLEKLNAWFAEHDPDVLIGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGIDALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCELVTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLIEGLAQPDDQHSIEGFLGARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRLASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAEIGRELVSHVNAWWAQELSKSQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPLAEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDHYLTKQLQPVAEGILPFVNDDFATIVTGQLGLF
>CP028548.1|AVZ91665.1|4546761_4547466_+|IS6-family-transposase-IS15DIV
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>CP028548.1|AVZ91674.1|4561239_4562865_+|sensor-histidine-kinase
MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWVGTRLVGGDNQAVLEGKSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASGDMLERDTHDELCRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEAHDAS
>CP028548.1|AVZ91675.1|4562854_4563553_+|response-regulator
MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLALVQGLFSDREAHCFSVDEVVSAAGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPRRLYRRAKVKS
>CP028548.1|AVZ91676.1|4563585_4564413_-|co-chaperone-DjlA
MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFANQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDGKADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGISRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDDAATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF
>CP028548.1|AVZ91677.1|4564656_4567005_+|LPS-assembly-protein-LptD
MKKRIPSLLATMIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQSSL
>CP028548.1|AVZ91678.1|4567059_4568346_+|peptidylprolyl-isomerase-SurA
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQIGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNISVTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN
>CP028548.1|AVZ91679.1|4568351_4569341_+|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPETRKVVITPGEPAGIGPDLVVQLAQRDWPVELVICADGALLTDRAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARACDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALVTTHLPLKAISEAITPELLREIITILDHDLRTKFGIAQPHVLVCGLNPHAGEGGHMGTEEIDTIIPVLEEMRAKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ
>CP028548.1|AVZ91680.1|4569337_4570159_+|ribosomal-RNA-small-subunit-methyltransferase-A
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES
>CP028548.1|AVZ91681.1|4570161_4570539_+|Co2+/Mg2+-efflux-protein-ApaG
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRETEVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAVPTLIH
>CP028548.1|AVZ91682.1|4570543_4571392_+|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)
MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVAS
>CP028548.1|AVZ91683.1|4571344_4571548_-|hypothetical-protein
MFPVAGFVFFLKRSPGRQIAHKRRSGKALAATRQNDAAGSPDKAQRAAIREESGRDGFAFVEAFLPV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

449876 : 519290

uncultured_Caudovirales_phage(61.11%)

portal,tail,terminase,capsid,head,tRNA,integrase,protease

attL 467484:467501|attR 483479:483496

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ87858.1\|449876_450824_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.2e-07	37.2
AVZ87859.1\|450838_451348_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.6e-18	40.3
AVZ87860.1\|451476_452601_+	DNA-protecting protein DprA	NA	NA	NA	NA
AVZ87861.1\|452572_453046_+	DUF494 domain-containing protein	NA	NA	NA	NA
AVZ87862.1\|453071_453614_+	hypothetical protein	NA	NA	NA	NA
AVZ87863.1\|453618_454191_+	L-threonylcarbamoyladenylate synthase type 1 TsaC	NA	NA	NA	NA
AVZ87864.1\|454194_455013_+	shikimate dehydrogenase	NA	NA	NA	NA
AVZ87865.1\|455009_455267_+	DUF1488 domain-containing protein	NA	NA	NA	NA
AVZ92535.1\|455242_455797_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
AVZ87866.1\|461592_461814_-	hypothetical protein	NA	NA	NA	NA
AVZ87867.1\|462107_465218_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AVZ87868.1\|465230_466370_-	MexX family efflux pump subunit	NA	NA	NA	NA
AVZ87869.1\|466748_467399_+	acrEF/envCD operon transcriptional regulator	NA	NA	NA	NA
467484:467501	attL	NA	NA	NA	NA
AVZ87870.1\|467674_468901_+\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.8e-150	62.2
AVZ87871.1\|468993_469935_+	hypothetical protein	NA	NA	NA	NA
AVZ87872.1\|470116_470401_+	transcriptional regulator	NA	NA	NA	NA
AVZ87873.1\|470411_471191_+	hypothetical protein	Q8HA02	Enterobacteria_phage	6.2e-40	51.5
AVZ87874.1\|471314_471509_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
AVZ92536.1\|471642_471912_+	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	2.4e-44	94.4
AVZ87875.1\|471904_472093_+	hypothetical protein	NA	NA	NA	NA
AVZ87876.1\|472085_472400_+	hypothetical protein	NA	NA	NA	NA
AVZ87877.1\|472396_472765_+	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	3.7e-51	81.1
AVZ87878.1\|472761_473127_+	hypothetical protein	NA	NA	NA	NA
AVZ87879.1\|473126_475262_+	DNA primase	A0A1W6JPG0	Morganella_phage	3.4e-205	62.4
AVZ87880.1\|475604_475940_+	hypothetical protein	NA	NA	NA	NA
AVZ87881.1\|475988_476501_-	hypothetical protein	NA	NA	NA	NA
AVZ87882.1\|476764_477931_+\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	9.8e-207	95.9
AVZ87883.1\|477982_478543_+\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	1.2e-98	95.7
AVZ87884.1\|478544_479786_+\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.0e-230	96.5
AVZ87885.1\|479782_480118_+\|head,tail	head-tail adaptor	A0A2H4JHK5	uncultured_Caudovirales_phage	3.7e-26	57.8
AVZ87886.1\|480114_480414_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	3.4e-39	80.8
AVZ87887.1\|480413_480857_+	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	2.8e-77	91.8
AVZ87888.1\|480983_481175_+\|terminase	terminase	NA	NA	NA	NA
AVZ87889.1\|481132_481489_+\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	5.5e-60	99.2
AVZ87890.1\|481472_483134_+\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	98.0
AVZ87891.1\|483136_483328_+	hypothetical protein	NA	NA	NA	NA
AVZ87892.1\|483481_483778_-	Fis family transcriptional regulator	NA	NA	NA	NA
483479:483496	attR	NA	NA	NA	NA
AVZ87893.1\|483802_484768_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AVZ87894.1\|484925_485120_-	hypothetical protein	NA	NA	NA	NA
AVZ87895.1\|485125_486007_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AVZ87896.1\|486018_487470_-	sodium/panthothenate symporter	NA	NA	NA	NA
AVZ87897.1\|487459_487702_-	hypothetical protein	NA	NA	NA	NA
AVZ87898.1\|487812_489162_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AVZ87899.1\|489172_489640_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AVZ87900.1\|489662_490115_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
AVZ87901.1\|490338_490947_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
AVZ87902.1\|490946_491948_-	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
AVZ87903.1\|492176_492368_+	hypothetical protein	NA	NA	NA	NA
AVZ87904.1\|492447_494388_+	RNase E specificity factor CsrD	NA	NA	NA	NA
AVZ87905.1\|494509_494716_-	hypothetical protein	NA	NA	NA	NA
AVZ87906.1\|494693_495737_+	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
AVZ87907.1\|495807_496800_+	rod shape-determining protein MreC	NA	NA	NA	NA
AVZ87908.1\|496799_497288_+	rod shape-determining protein MreD	NA	NA	NA	NA
AVZ87909.1\|497295_497877_+	septum formation inhibitor Maf	NA	NA	NA	NA
AVZ87910.1\|497879_499349_+	ribonuclease G	NA	NA	NA	NA
AVZ87911.1\|499386_503184_+	AsmA2 domain-containing protein	NA	NA	NA	NA
AVZ87912.1\|503272_504754_+\|protease	metalloprotease TldD	NA	NA	NA	NA
AVZ87913.1\|504789_505719_-	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
AVZ87914.1\|505850_506054_+	protein AaeX	NA	NA	NA	NA
AVZ87915.1\|506061_506994_+	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
AVZ87916.1\|506999_508967_+	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
AVZ87917.1\|509046_509322_+	hypothetical protein	NA	NA	NA	NA
AVZ87918.1\|509372_509639_-	DUF1471 domain-containing protein	NA	NA	NA	NA
AVZ87919.1\|509737_510001_-	DUF1471 domain-containing protein	NA	NA	NA	NA
AVZ87920.1\|510376_510847_-	arginine repressor	NA	NA	NA	NA
AVZ87921.1\|511261_512200_+	malate dehydrogenase	NA	NA	NA	NA
AVZ87922.1\|512336_513395_-\|protease	serine endoprotease DegS	NA	NA	NA	NA
AVZ87923.1\|513482_514850_-\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	6.0e-22	25.3
AVZ87924.1\|515023_515422_-	DUF1043 domain-containing protein	NA	NA	NA	NA
AVZ87925.1\|515612_516740_+	cell division protein ZapE	NA	NA	NA	NA
AVZ87926.1\|517005_517434_+	50S ribosomal protein L13	NA	NA	NA	NA
AVZ87927.1\|517449_517842_+	30S ribosomal protein S9	NA	NA	NA	NA
AVZ87928.1\|517951_518155_-	hypothetical protein	NA	NA	NA	NA
AVZ87929.1\|518153_518792_+	stringent starvation protein A	NA	NA	NA	NA
AVZ87930.1\|518795_519290_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.5e-26	54.8

DBSCAN-SWA_2

1199727 : 1276831

Salmonella_phage(76.09%)

portal,tail,capsid,head,tRNA,transposase,integrase,plate,lysis,coat

attL 1199581:1199640|attR 1262405:1263600

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1199581:1199640	attL	NA	NA	NA	NA
AVZ88598.1\|1199727_1200708_-\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ88599.1\|1201080_1201530_-	L-alanine exporter AlaE	NA	NA	NA	NA
AVZ92555.1\|1201648_1201834_-	hypothetical protein	NA	NA	NA	NA
AVZ92556.1\|1202258_1202660_+	DNA-binding protein StpA	NA	NA	NA	NA
AVZ88600.1\|1202732_1202912_-	hypothetical protein	NA	NA	NA	NA
AVZ88601.1\|1203117_1204020_+	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	2.6e-37	40.2
AVZ88602.1\|1204000_1204546_-	hypothetical protein	NA	NA	NA	NA
AVZ88603.1\|1204553_1204853_-	transcriptional regulator	NA	NA	NA	NA
AVZ88604.1\|1204928_1205534_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AVZ88605.1\|1205637_1206546_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ88606.1\|1206628_1208416_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AVZ88607.1\|1208679_1210200_+	aldehyde dehydrogenase	NA	NA	NA	NA
AVZ88608.1\|1210901_1211483_+	fimbrial protein	NA	NA	NA	NA
AVZ88609.1\|1211677_1212340_+	molecular chaperone	NA	NA	NA	NA
AVZ92557.1\|1212376_1214932_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AVZ88610.1\|1214939_1216034_+	fimbrial protein	NA	NA	NA	NA
AVZ88611.1\|1216046_1217075_-	fimbrial protein	NA	NA	NA	NA
AVZ88612.1\|1217077_1219615_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AVZ88613.1\|1219644_1220313_-	molecular chaperone	NA	NA	NA	NA
AVZ88614.1\|1220354_1220903_-	type 1 fimbrial protein	NA	NA	NA	NA
AVZ88615.1\|1221006_1221624_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AVZ92558.1\|1222063_1222825_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AVZ88616.1\|1222880_1223501_-	transporter	NA	NA	NA	NA
AVZ88617.1\|1223656_1224451_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AVZ88618.1\|1224511_1225444_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AVZ88619.1\|1225449_1226178_-	aldolase	NA	NA	NA	NA
AVZ88620.1\|1226178_1226430_-	hypothetical protein	NA	NA	NA	NA
AVZ88621.1\|1226487_1227468_-\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ88622.1\|1227513_1228512_-\|integrase	site-specific integrase	A0A1S6L016	Salmonella_phage	2.2e-183	94.5
AVZ88623.1\|1228514_1229144_-	phage repressor protein	A0A1S6KZZ7	Salmonella_phage	1.4e-61	54.5
AVZ88624.1\|1229266_1229509_+	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	4.0e-38	98.8
AVZ88625.1\|1229541_1230051_+	hypothetical protein	A0A1S6L008	Salmonella_phage	1.1e-77	85.8
AVZ88626.1\|1230058_1230259_+	DUF2724 domain-containing protein	A0A1S6L005	Salmonella_phage	4.5e-19	68.8
AVZ88627.1\|1230222_1230561_+	hypothetical protein	A0A218M4I7	Erwinia_phage	6.2e-29	58.0
AVZ88628.1\|1230628_1230862_+	DUF2732 domain-containing protein	A0A1S6L021	Salmonella_phage	6.0e-31	90.9
AVZ88629.1\|1230861_1231089_+	hypothetical protein	A0A1S6L007	Salmonella_phage	5.1e-35	92.0
AVZ88630.1\|1231085_1231937_+	DNA adenine methylase	A0A1S6L011	Salmonella_phage	2.2e-115	75.4
AVZ88631.1\|1231933_1234318_+	replication endonuclease	A0A1S6L028	Salmonella_phage	0.0e+00	87.9
AVZ88632.1\|1234547_1234799_+	hypothetical protein	NA	NA	NA	NA
AVZ88633.1\|1234798_1236283_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVZ88634.1\|1236390_1236579_+	hypothetical protein	A0A1S6L006	Salmonella_phage	2.2e-23	90.3
AVZ88635.1\|1236590_1236824_+	DinI family protein	A0A0M4S6H1	Salmonella_phage	2.0e-34	96.1
AVZ88636.1\|1236919_1237603_-	hypothetical protein	NA	NA	NA	NA
AVZ88637.1\|1237589_1238669_-	hypothetical protein	NA	NA	NA	NA
AVZ88638.1\|1238668_1239670_-	hypothetical protein	NA	NA	NA	NA
AVZ92559.1\|1240191_1240461_+	hypothetical protein	D2IZW1	Enterococcus_phage	1.4e-15	41.3
AVZ88639.1\|1240517_1241561_-\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	3.1e-172	85.6
AVZ88640.1\|1241560_1243324_-	oxidoreductase	A0A1S6KZW3	Salmonella_phage	0.0e+00	91.8
AVZ88641.1\|1243464_1244298_+\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	4.4e-100	77.6
AVZ88642.1\|1244314_1245367_+\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	6.8e-175	91.0
AVZ88643.1\|1245370_1246024_+	hypothetical protein	A0A1S6KZX1	Salmonella_phage	1.9e-90	80.0
AVZ88644.1\|1246119_1246584_+\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	1.5e-73	85.7
AVZ88645.1\|1246583_1246787_+\|tail	phage tail protein	E5G6M9	Salmonella_phage	9.8e-30	89.6
AVZ92560.1\|1246790_1247006_+	hypothetical protein	E5G6N0	Salmonella_phage	6.1e-30	88.7
AVZ88646.1\|1246986_1247496_+	lysozyme	E5G6N1	Salmonella_phage	1.6e-81	85.2
AVZ88647.1\|1247500_1247884_+	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	1.9e-18	45.4
AVZ88648.1\|1247880_1248309_+\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	7.1e-54	82.5
AVZ88649.1\|1248238_1248442_+	hypothetical protein	A0A1S6KZX6	Salmonella_phage	3.0e-23	77.6
AVZ88650.1\|1248404_1248827_+\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	8.2e-63	83.2
AVZ88651.1\|1248819_1249266_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.5e-54	72.3
AVZ88652.1\|1249288_1250155_-	hypothetical protein	NA	NA	NA	NA
AVZ88653.1\|1250249_1250822_+\|plate	phage baseplate assembly protein V	E5G6N6	Salmonella_phage	1.4e-76	70.8
AVZ88654.1\|1250818_1251181_+\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	8.4e-48	85.6
AVZ88655.1\|1252068_1252740_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	3.2e-61	58.9
AVZ88656.1\|1252741_1254691_+\|coat	spore coat protein CotH	Q6QI97	Burkholderia_phage	1.0e-06	38.9
AVZ88657.1\|1254700_1255819_+	hypothetical protein	A0A248XD67	Klebsiella_phage	4.4e-55	38.0
AVZ88658.1\|1255870_1256944_+\|tail	phage tail protein	A0A1S6KZZ8	Salmonella_phage	6.6e-40	53.6
AVZ88659.1\|1257092_1258265_+\|tail	phage tail protein	A0A1S6KZY7	Salmonella_phage	3.4e-207	91.5
AVZ88660.1\|1258274_1258790_+\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.4e-80	84.2
AVZ88661.1\|1258842_1259142_+\|tail	phage tail assembly protein	E5G6P9	Salmonella_phage	8.2e-33	78.0
AVZ88662.1\|1259156_1259276_+\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AVZ88663.1\|1261336_1262317_+\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ92561.1\|1262355_1262481_-	ABC transporter	NA	NA	NA	NA
AVZ88664.1\|1263095_1263581_+\|tail	phage tail protein	E5G6Q2	Salmonella_phage	5.2e-61	80.1
AVZ88665.1\|1263577_1264672_+	phage late control D family protein	E5G6Q3	Salmonella_phage	2.4e-170	83.6
1262405:1263600	attR	NA	NA	NA	NA
AVZ88666.1\|1264738_1264957_+	levansucrase regulator	Q53ZE7	Salmonella_virus	1.9e-26	72.2
AVZ88667.1\|1264984_1265362_-	hypothetical protein	NA	NA	NA	NA
AVZ88668.1\|1265965_1266448_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
AVZ88669.1\|1266558_1267035_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
AVZ88670.1\|1267024_1267315_+	RnfH family protein	NA	NA	NA	NA
AVZ88671.1\|1267381_1267723_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
AVZ88672.1\|1267870_1269532_-	DNA repair protein RecN	NA	NA	NA	NA
AVZ88673.1\|1269618_1270497_-	NAD(+) kinase	NA	NA	NA	NA
AVZ88674.1\|1270621_1271212_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
AVZ88675.1\|1271331_1272618_-	DUF21 domain-containing protein	NA	NA	NA	NA
AVZ88676.1\|1272637_1273429_-	inner membrane protein YpjD	NA	NA	NA	NA
AVZ88677.1\|1273592_1274957_+	signal recognition particle protein	NA	NA	NA	NA
AVZ88678.1\|1275216_1275465_+	30S ribosomal protein S16	NA	NA	NA	NA
AVZ88679.1\|1275483_1276032_+	ribosome maturation factor RimM	NA	NA	NA	NA
AVZ88680.1\|1276063_1276831_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA

DBSCAN-SWA_3

1381547 : 1434284

Salmonella_phage(40.38%)

terminase,holin,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ88769.1\|1381547_1383014_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-87	38.7
AVZ88770.1\|1383081_1384659_+	GMP synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
AVZ88771.1\|1384850_1386101_+	DUF4102 domain-containing protein	A0A1X9TCT6	Enterobacter_phage	5.8e-205	84.4
AVZ88772.1\|1386043_1386286_-	hypothetical protein	NA	NA	NA	NA
AVZ88773.1\|1386282_1386876_-	adenine methylase	T1SA14	Salmonella_phage	6.3e-109	91.9
AVZ88774.1\|1386872_1387535_-	hypothetical protein	A0A059VF56	Pseudomonas_phage	1.2e-47	46.6
AVZ88775.1\|1387531_1387690_-	DUF1317 domain-containing protein	T1SAR0	Salmonella_phage	1.1e-17	78.8
AVZ88776.1\|1387682_1387976_-	PerC family transcriptional regulator	T1S9J5	Salmonella_phage	4.0e-32	71.1
AVZ88777.1\|1388085_1388334_-	AlpA family phage regulatory protein	A0A0F6TJ45	Escherichia_coli_O157_typing_phage	4.9e-31	76.8
AVZ88778.1\|1388382_1389264_-	recombinase RecT	T1SBJ5	Salmonella_phage	8.9e-136	84.3
AVZ88779.1\|1389260_1390082_-	exodeoxyribonuclease VIII	A0A193GYK2	Enterobacter_phage	1.8e-130	80.2
AVZ88780.1\|1390078_1390378_-	hypothetical protein	A0A0F6R7M4	Escherichia_coli_O157_typing_phage	2.1e-20	54.5
AVZ88781.1\|1390744_1391326_-	XRE family transcriptional regulator	Q858D7	Salmonella_phage	7.1e-65	64.3
AVZ88782.1\|1391480_1391714_+	hypothetical protein	T1SAR5	Salmonella_phage	9.2e-24	66.2
AVZ88783.1\|1391860_1392070_+	hypothetical protein	A0A193GYW4	Enterobacter_phage	1.8e-26	78.3
AVZ88784.1\|1392069_1392837_+	primosomal protein	A0A193GZ86	Enterobacter_phage	8.9e-140	91.4
AVZ88785.1\|1392833_1393619_+	replication protein	A0A193GYX1	Enterobacter_phage	3.7e-133	87.7
AVZ88786.1\|1393738_1394086_+	DUF1064 domain-containing protein	A0A0F6R8N5	Escherichia_coli_O157_typing_phage	6.5e-50	82.6
AVZ88787.1\|1394278_1394689_+	hypothetical protein	A0A2P1MXC5	Escherichia_phage	4.3e-16	45.1
AVZ88788.1\|1394672_1394864_+	hypothetical protein	NA	NA	NA	NA
AVZ88789.1\|1394860_1395505_+	hypothetical protein	Q1MVG0	Enterobacteria_phage	8.0e-110	79.3
AVZ92564.1\|1395798_1396266_+	hypothetical protein	A0A2R2Z312	Escherichia_phage	1.3e-37	51.7
AVZ88790.1\|1396265_1396559_+	hypothetical protein	Q6UAT9	Klebsiella_phage	2.7e-44	86.6
AVZ88791.1\|1396555_1397176_+	hypothetical protein	Q1MVF7	Enterobacteria_phage	1.0e-29	40.7
AVZ92565.1\|1397175_1397379_+	hypothetical protein	NA	NA	NA	NA
AVZ88792.1\|1397371_1397710_+	hypothetical protein	A0A193GYX4	Enterobacter_phage	1.8e-44	80.0
AVZ88793.1\|1397806_1399291_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVZ88794.1\|1399290_1399542_-	hypothetical protein	NA	NA	NA	NA
AVZ88795.1\|1399694_1399952_+	lF-82	NA	NA	NA	NA
AVZ88796.1\|1400029_1400614_+\|terminase	terminase small subunit	T1SBI8	Salmonella_phage	2.2e-90	88.6
AVZ88797.1\|1400610_1402086_+\|terminase	terminase	Q858H3	Salmonella_phage	6.4e-280	93.1
AVZ88798.1\|1402129_1402501_-	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	3.7e-59	91.9
AVZ88799.1\|1402550_1402793_+	hypothetical protein	NA	NA	NA	NA
AVZ88800.1\|1403254_1403461_+	hypothetical protein	T1SA67	Salmonella_phage	4.8e-08	88.2
AVZ88801.1\|1403475_1405158_+\|tail	phage tail protein	A0A0F6TJD8	Escherichia_coli_O157_typing_phage	1.5e-264	84.4
AVZ88802.1\|1405154_1405451_+	hypothetical protein	T1SBI9	Salmonella_phage	1.2e-33	70.4
AVZ88803.1\|1405453_1406134_+	peptidase	G9L6C4	Escherichia_phage	6.1e-76	84.0
AVZ88804.1\|1406148_1407135_+	hypothetical protein	A0A193GZ49	Enterobacter_phage	2.5e-179	94.2
AVZ88805.1\|1407188_1407626_+	hypothetical protein	A0A193GYT9	Enterobacter_phage	1.3e-66	91.7
AVZ88806.1\|1407636_1407978_+	hypothetical protein	G9L6C7	Escherichia_phage	2.4e-36	70.8
AVZ88807.1\|1408028_1408352_+	hypothetical protein	G9L6C8	Escherichia_phage	5.3e-46	85.0
AVZ88808.1\|1408351_1408957_+	hypothetical protein	A0A0F6TJN5	Escherichia_coli_O157_typing_phage	4.0e-87	77.0
AVZ88809.1\|1408956_1411434_+	hypothetical protein	Q858G3	Salmonella_phage	0.0e+00	84.4
AVZ88810.1\|1411433_1411898_+	hypothetical protein	Q858G2	Salmonella_phage	1.5e-70	81.2
AVZ88811.1\|1411897_1412437_+	hypothetical protein	A0A0F6TJ56	Escherichia_coli_O157_typing_phage	8.0e-71	80.0
AVZ88812.1\|1412447_1414982_+	hypothetical protein	Q858G0	Salmonella_phage	0.0e+00	84.1
AVZ88813.1\|1414981_1416892_+	hypothetical protein	Q858F9	Salmonella_phage	5.4e-287	82.7
AVZ88814.1\|1416891_1419648_+	hypothetical protein	Q858F8	Salmonella_phage	0.0e+00	95.4
AVZ88815.1\|1419644_1419839_+	hypothetical protein	Q858F7	Salmonella_phage	6.5e-15	67.2
AVZ88816.1\|1419873_1420026_-	transmembrane anchored protein	G9L6D9	Escherichia_phage	2.5e-14	83.7
AVZ88817.1\|1420124_1420421_-	hypothetical protein	T1SA06	Salmonella_phage	6.9e-24	63.9
AVZ88818.1\|1423248_1423512_+	hypothetical protein	NA	NA	NA	NA
AVZ92566.1\|1424674_1424761_+	ABC transporter	NA	NA	NA	NA
AVZ88819.1\|1424799_1425780_-\|transposase	IS5 family transposase ISKpn26	A0A077SK28	Escherichia_phage	1.0e-185	99.4
AVZ88820.1\|1426648_1427911_-\|transposase	IS1380 family transposase ISEc9	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
AVZ88821.1\|1428801_1428942_-	ABC transporter	NA	NA	NA	NA
AVZ88822.1\|1429019_1430336_+	right-handed parallel beta-helix repeat-containing protein	A0A0K2FI18	Enterobacter_phage	2.3e-34	32.3
AVZ88823.1\|1430422_1430827_+	hypothetical protein	T1SA79	Salmonella_phage	8.7e-54	81.1
AVZ88824.1\|1430813_1431119_+\|holin	phage holin family protein	A0A193GYK3	Enterobacter_phage	2.7e-39	81.4
AVZ88825.1\|1431108_1431738_+	endolysin	Q858F0	Salmonella_phage	1.8e-90	76.9
AVZ88826.1\|1431734_1432235_+	DUF2514 domain-containing protein	Q858E9	Salmonella_phage	1.3e-59	76.9
AVZ88827.1\|1432421_1434284_-	phosphatase	A0A2P0VMN7	Tetraselmis_virus	2.6e-07	22.6

DBSCAN-SWA_4

1763867 : 1770773

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ92580.1\|1763867_1764731_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
AVZ89113.1\|1764741_1765515_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
AVZ92581.1\|1765756_1766650_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
AVZ89114.1\|1766895_1768257_-	U32 family peptidase	Q6DW11	Phage_TP	1.8e-207	94.8
AVZ89115.1\|1768575_1769298_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
AVZ89116.1\|1769294_1770773_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3

DBSCAN-SWA_5

1811508 : 1824154

Enterobacteria_phage(36.36%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ89143.1\|1811508_1812915_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.6e-38	28.7
AVZ89144.1\|1813138_1814203_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-105	54.7
AVZ89145.1\|1814216_1815086_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	3.4e-111	67.4
AVZ89146.1\|1815117_1816008_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-28	34.2
AVZ89147.1\|1816022_1816577_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.9e-51	57.6
AVZ89148.1\|1816756_1817923_+	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	7.0e-112	54.7
AVZ89149.1\|1818871_1819876_-	NAD-dependent epimerase	E3T4Y8	Cafeteria_roenbergensis_virus	4.0e-31	29.2
AVZ89150.1\|1819831_1820113_+	hypothetical protein	NA	NA	NA	NA
AVZ89151.1\|1820715_1821780_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.6e-105	55.0
AVZ89152.1\|1821793_1822663_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	5.7e-111	67.0
AVZ89153.1\|1822694_1823585_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-28	34.2
AVZ89154.1\|1823599_1824154_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.9e-51	57.6

DBSCAN-SWA_6

2815288 : 2826176

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ90080.1\|2815288_2818396_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6
AVZ90081.1\|2818450_2819716_+	MFS transporter	NA	NA	NA	NA
AVZ90082.1\|2819746_2820835_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AVZ90083.1\|2820921_2821182_-	hypothetical protein	A0A077SK33	Escherichia_phage	3.5e-40	97.7
AVZ90084.1\|2821479_2822340_+	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AVZ90085.1\|2822360_2823122_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AVZ90086.1\|2823112_2823346_+	hypothetical protein	NA	NA	NA	NA
AVZ90087.1\|2823383_2824286_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AVZ90088.1\|2824297_2825563_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.9e-232	99.3
AVZ90089.1\|2825555_2826176_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_7

3043111 : 3116450

Enterobacteria_phage(32.43%)

holin,transposase,integrase,plate,protease

attL 3045011:3045028|attR 3124890:3124907

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ92629.1\|3043111_3044452_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AVZ90289.1\|3044464_3046009_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
3045011:3045028	attL	NA	NA	NA	NA
AVZ90290.1\|3046051_3046543_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
AVZ90291.1\|3047012_3047993_+\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ90292.1\|3048031_3048205_-	ABC transporter	NA	NA	NA	NA
AVZ90293.1\|3048125_3049190_-	DUF4102 domain-containing protein	A0A0M4QX09	Salmonella_phage	1.4e-175	82.9
AVZ90294.1\|3049386_3049935_+\|protease	protease	NA	NA	NA	NA
AVZ90295.1\|3050133_3051666_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.1e-21	30.0
AVZ90296.1\|3051882_3052644_-	3-oxoacyl-ACP reductase	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-20	32.5
AVZ90297.1\|3052752_3053667_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ90298.1\|3053967_3054156_+	cold-shock protein	NA	NA	NA	NA
AVZ90299.1\|3054226_3054535_-	anti-sigma regulatory factor	NA	NA	NA	NA
AVZ90300.1\|3054540_3054678_+	glycosyl hydrolase family 2	NA	NA	NA	NA
AVZ90301.1\|3054702_3055572_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	5.7e-50	42.1
AVZ90302.1\|3055650_3056853_-	MFS transporter	NA	NA	NA	NA
AVZ90303.1\|3056925_3058062_-	alpha/beta hydrolase	NA	NA	NA	NA
AVZ90304.1\|3058234_3059119_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ90305.1\|3059243_3060077_-	hypothetical protein	NA	NA	NA	NA
AVZ90306.1\|3060307_3060694_+	glyoxalase	NA	NA	NA	NA
AVZ90307.1\|3060861_3062478_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AVZ90308.1\|3062663_3063371_+	murein tripeptide amidase MpaA	NA	NA	NA	NA
AVZ90309.1\|3063367_3064333_-	L-Ala-D/L-Glu epimerase	NA	NA	NA	NA
AVZ90310.1\|3064435_3064942_+	thiol peroxidase	NA	NA	NA	NA
AVZ92630.1\|3065012_3066035_-	AbrB family transcriptional regulator	NA	NA	NA	NA
AVZ90311.1\|3066166_3067708_-	transcriptional regulator TyrR	NA	NA	NA	NA
AVZ90312.1\|3067880_3069194_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AVZ90313.1\|3069325_3070207_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ90314.1\|3070296_3071358_-	TIGR01620 family protein	NA	NA	NA	NA
AVZ90315.1\|3071354_3072752_-	YcjX family protein	NA	NA	NA	NA
AVZ90316.1\|3072854_3073073_-	phage shock protein D	NA	NA	NA	NA
AVZ90317.1\|3073101_3073461_-	envelope stress response membrane protein PspC	NA	NA	NA	NA
AVZ90318.1\|3073460_3073685_-	envelope stress response membrane protein PspB	NA	NA	NA	NA
AVZ90319.1\|3073740_3074409_-	phage shock protein PspA	NA	NA	NA	NA
AVZ92631.1\|3074576_3075551_+	phage shock protein operon transcriptional activator	NA	NA	NA	NA
AVZ90320.1\|3075541_3076933_-	MFS transporter	NA	NA	NA	NA
AVZ90321.1\|3076958_3078128_-	amidohydrolase	NA	NA	NA	NA
AVZ90322.1\|3078299_3080609_+	AraC family transcriptional regulator	NA	NA	NA	NA
AVZ90323.1\|3080587_3081418_-	XRE family transcriptional regulator	NA	NA	NA	NA
AVZ90324.1\|3081528_3082434_+	NAD-dependent dehydratase	NA	NA	NA	NA
AVZ90325.1\|3082767_3084411_+	peptide ABC transporter substrate-binding protein SapA	NA	NA	NA	NA
AVZ90326.1\|3084407_3085373_+	peptide ABC transporter permease SapB	NA	NA	NA	NA
AVZ90327.1\|3085577_3086249_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.5e-79	59.6
AVZ92632.1\|3086435_3087263_+	FRG domain-containing protein	A0A1S6KZX9	Salmonella_phage	8.4e-19	30.2
AVZ90328.1\|3087338_3088604_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	9.6e-208	82.7
AVZ90329.1\|3088605_3089025_-	translesion error-prone DNA polymerase V subunit UmuD	A0A1W6JNS2	Morganella_phage	1.4e-35	57.5
AVZ90330.1\|3089104_3090589_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVZ90331.1\|3090588_3090840_-	hypothetical protein	NA	NA	NA	NA
AVZ90332.1\|3091486_3091909_-	hypothetical protein	K7P834	Enterobacteria_phage	3.6e-26	45.3
AVZ90333.1\|3092501_3093206_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ90334.1\|3093821_3094169_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AVZ92633.1\|3094332_3095124_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AVZ90335.1\|3095934_3096639_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ90336.1\|3096675_3096963_-	hypothetical protein	A0A286N2Q7	Klebsiella_phage	4.4e-36	95.4
AVZ90337.1\|3096959_3097499_-	hypothetical protein	A0A286N2Q6	Klebsiella_phage	3.3e-101	98.9
AVZ90338.1\|3097495_3097807_-\|holin	holin	A0A286N2Q5	Klebsiella_phage	3.8e-49	100.0
AVZ92634.1\|3098444_3099134_-	antiterminator	I6PDF8	Cronobacter_phage	2.1e-55	53.1
AVZ90339.1\|3099133_3099274_-	YlcG family protein	NA	NA	NA	NA
AVZ90340.1\|3099270_3099909_-	hypothetical protein	H6WRY9	Salmonella_phage	3.2e-74	69.8
AVZ90341.1\|3099901_3100570_-	serine/threonine protein phosphatase	K7P6H8	Enterobacteria_phage	1.4e-104	78.7
AVZ90342.1\|3100566_3100734_-	NinE family protein	K7P7K0	Enterobacteria_phage	4.6e-09	62.5
AVZ90343.1\|3100714_3101182_-	recombination protein NinB	Q8VNP6	Enterobacteria_phage	3.4e-33	45.8
AVZ90344.1\|3101702_3102731_+	hypothetical protein	NA	NA	NA	NA
AVZ90345.1\|3102938_3103184_-	hypothetical protein	NA	NA	NA	NA
AVZ90346.1\|3103239_3103542_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVZ90347.1\|3103538_3104387_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	5.1e-88	60.1
AVZ90348.1\|3104383_3105244_-	replication protein	K7PGT1	Enterobacteria_phage	1.0e-59	53.3
AVZ90349.1\|3105329_3105551_-	transcriptional regulator	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
AVZ90350.1\|3105591_3105819_-	transcriptional regulator	Q76H55	Enterobacteria_phage	1.4e-24	77.1
AVZ92635.1\|3105930_3106629_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	3.7e-108	84.1
AVZ92636.1\|3106651_3106771_+	hypothetical protein	NA	NA	NA	NA
AVZ90351.1\|3106916_3107993_+	ParA family protein	H2BD62	Pseudomonas_phage	9.1e-58	37.9
AVZ90352.1\|3108074_3108278_-	hypothetical protein	A0A192Y6Q5	Salmonella_phage	3.9e-18	71.6
AVZ90353.1\|3108706_3108901_+	hypothetical protein	NA	NA	NA	NA
AVZ90354.1\|3108989_3109274_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.1e-39	79.8
AVZ90355.1\|3109289_3110135_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	1.8e-69	59.2
AVZ90356.1\|3110420_3111101_+	exonuclease	A0A0M3ULE0	Salmonella_phage	8.2e-121	91.2
AVZ90357.1\|3111097_3111526_+	regulator	M9NYX4	Enterobacteria_phage	7.5e-64	80.3
AVZ90358.1\|3111522_3112185_+	DNA methyltransferase	G8C7S6	Escherichia_phage	2.7e-105	84.6
AVZ90359.1\|3112181_3112496_+	hypothetical protein	K7PM28	Enterobacteria_phage	1.6e-10	50.8
AVZ92637.1\|3112392_3113580_-\|integrase	site-specific integrase	K7PGY1	Enterobacteria_phage	1.1e-120	52.4
AVZ90360.1\|3113756_3114647_+	peptide ABC transporter permease SapC	NA	NA	NA	NA
AVZ90361.1\|3114646_3115639_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	3.0e-07	27.2
AVZ90362.1\|3115640_3116450_+	peptide ABC transporter ATP-binding protein SapF	A0A2H4PQG7	Staphylococcus_phage	2.1e-14	28.9
3124890:3124907	attR	NA	NA	NA	NA

DBSCAN-SWA_8

3244122 : 3333201

Klebsiella_phage(44.44%)

portal,holin,terminase,capsid,head,integrase,tRNA,transposase,tail

attL 3270925:3270939|attR 3331012:3331026

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ90483.1\|3244122_3244623_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
AVZ90484.1\|3244739_3245186_+	DUF441 domain-containing protein	NA	NA	NA	NA
AVZ92641.1\|3245169_3245961_-	AraC family transcriptional regulator	NA	NA	NA	NA
AVZ90485.1\|3246062_3247247_+	cyanate MFS transporter	NA	NA	NA	NA
AVZ90486.1\|3247278_3247971_-	hypothetical protein	NA	NA	NA	NA
AVZ90487.1\|3248116_3248626_+	DUF523 domain-containing protein	NA	NA	NA	NA
AVZ90488.1\|3248612_3248969_+	DUF488 domain-containing protein	NA	NA	NA	NA
AVZ90489.1\|3248958_3249198_-	DUF333 domain-containing protein	NA	NA	NA	NA
AVZ90490.1\|3249498_3250512_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-12	29.0
AVZ90491.1\|3250569_3250671_+	hypothetical protein	NA	NA	NA	NA
AVZ92642.1\|3250670_3250745_+	hypothetical protein	NA	NA	NA	NA
AVZ90492.1\|3250862_3250988_+	hypothetical protein	NA	NA	NA	NA
AVZ90493.1\|3251047_3251311_-	DUF2534 domain-containing protein	NA	NA	NA	NA
AVZ90494.1\|3251441_3252080_-	leucine efflux protein	NA	NA	NA	NA
AVZ90495.1\|3252169_3253084_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4
AVZ90496.1\|3253299_3253491_+	hypothetical protein	NA	NA	NA	NA
AVZ90497.1\|3253745_3254789_-	type II asparaginase	NA	NA	NA	NA
AVZ90498.1\|3255091_3256300_+	phosphodiesterase	NA	NA	NA	NA
AVZ90499.1\|3256373_3258158_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1
AVZ90500.1\|3258164_3259055_-	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ90501.1\|3259175_3260684_+	3,4-dihydroxybenzoate decarboxylase	NA	NA	NA	NA
AVZ90502.1\|3260994_3261681_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AVZ90503.1\|3262078_3262258_-	hypothetical protein	NA	NA	NA	NA
AVZ90504.1\|3262297_3262930_-	DNA-binding protein	NA	NA	NA	NA
AVZ90505.1\|3263496_3263694_+	hypothetical protein	NA	NA	NA	NA
AVZ90506.1\|3263809_3264820_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AVZ90507.1\|3264816_3266223_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AVZ90508.1\|3266278_3267166_-	manganese catalase family protein	NA	NA	NA	NA
AVZ90509.1\|3267182_3267689_-	ferritin-like domain-containing protein	NA	NA	NA	NA
AVZ90510.1\|3267715_3268210_-	ferritin-like domain-containing protein	NA	NA	NA	NA
AVZ90511.1\|3268300_3268486_-	stress-induced acidophilic repeat motif-containing protein	NA	NA	NA	NA
AVZ90512.1\|3269107_3270301_+	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
AVZ90513.1\|3270413_3270641_+	DUF1272 domain-containing protein	NA	NA	NA	NA
3270925:3270939	attL	NA	NA	NA	NA
AVZ90514.1\|3271077_3271401_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVZ90515.1\|3271393_3271786_+	amino acid-binding protein	NA	NA	NA	NA
AVZ90516.1\|3271782_3272496_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AVZ90517.1\|3272768_3272921_-	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
AVZ90518.1\|3273075_3274572_-\|tail	phage tail protein	A0A0P0IDN1	Klebsiella_phage	1.4e-125	63.7
AVZ90519.1\|3274640_3287345_-	DUF1983 domain-containing protein	Q6UAW1	Klebsiella_phage	0.0e+00	47.1
AVZ90520.1\|3287407_3288001_-\|tail	tail assembly protein	K7PHE5	Enterobacteria_phage	8.0e-80	76.6
AVZ90521.1\|3288027_3288450_-	hypothetical protein	J9Q806	Salmonella_phage	5.9e-29	50.0
AVZ90522.1\|3288491_3289202_-	peptidase P60	Q6UAW4	Klebsiella_phage	1.9e-136	90.3
AVZ90523.1\|3289203_3289959_-\|tail	phage minor tail protein L	Q6UAW5	Klebsiella_phage	4.6e-125	80.5
AVZ90524.1\|3289955_3290294_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-57	88.4
AVZ90525.1\|3290293_3293629_-\|tail	phage tail tape measure protein	Q6UAW7	Klebsiella_phage	0.0e+00	88.3
AVZ90526.1\|3293628_3293847_-	hypothetical protein	Q6UAW9	Klebsiella_phage	5.4e-34	90.5
AVZ90527.1\|3293861_3294227_-\|tail	phage tail protein	Q6UAW8	Klebsiella_phage	1.6e-51	89.3
AVZ90528.1\|3294284_3294746_-\|tail	phage tail protein	Q6UAX0	Klebsiella_phage	7.8e-67	83.7
AVZ90529.1\|3294777_3295179_-	hypothetical protein	Q6UAX1	Klebsiella_phage	2.3e-62	94.0
AVZ90530.1\|3295175_3295565_-	hypothetical protein	Q6UAX2	Klebsiella_phage	9.6e-58	86.0
AVZ90531.1\|3295545_3295884_-\|head,tail	head-tail adaptor protein	Q6UAX3	Klebsiella_phage	2.8e-53	90.2
AVZ90532.1\|3295880_3296198_-\|head,tail	phage gp6-like head-tail connector protein	Q6UAX4	Klebsiella_phage	1.5e-45	89.8
AVZ90533.1\|3296178_3296439_-	hypothetical protein	Q6UAX5	Klebsiella_phage	7.4e-22	60.5
AVZ90534.1\|3296497_3297784_-\|capsid	phage major capsid protein	Q6UAX6	Klebsiella_phage	9.8e-216	89.0
AVZ90535.1\|3297861_3298782_-	S49 family peptidase	Q6UAX7	Klebsiella_phage	9.6e-149	88.2
AVZ90536.1\|3298818_3300078_-\|portal	phage portal protein	Q6UAX8	Klebsiella_phage	1.8e-222	89.8
AVZ90537.1\|3300077_3300257_-	hypothetical protein	Q6UAX9	Klebsiella_phage	3.1e-11	57.6
AVZ90538.1\|3300250_3301972_-\|terminase	terminase large subunit	Q7Y413	Yersinia_phage	1.5e-190	57.4
AVZ90539.1\|3301971_3302406_-\|terminase	phage terminase small subunit P27 family	A0A1J0GV10	Halomonas_phage	9.4e-30	61.9
AVZ90540.1\|3302654_3303086_-	hypothetical protein	Q6UAS0	Klebsiella_phage	1.8e-41	61.6
AVZ90541.1\|3303082_3303406_-	hypothetical protein	NA	NA	NA	NA
AVZ90542.1\|3303357_3303720_-	HNH endonuclease	Q6UAS2	Klebsiella_phage	1.2e-57	83.3
AVZ90543.1\|3304046_3304271_+	hypothetical protein	NA	NA	NA	NA
AVZ90544.1\|3304309_3304747_-	hypothetical protein	NA	NA	NA	NA
AVZ90545.1\|3305696_3306047_-	hypothetical protein	R9TPM9	Aeromonas_phage	7.9e-11	38.1
AVZ90546.1\|3306043_3306541_-	lysozyme	A0A1V0E5Q7	Salmonella_phage	1.1e-77	84.6
AVZ90547.1\|3306540_3306756_-\|holin	holin	A5LH82	Enterobacteria_phage	2.7e-30	88.7
AVZ90548.1\|3307078_3308059_+\|transposase	IS5-like element ISKpn26 family transposase	Q38213	Escherichia_phage	8.9e-185	99.1
AVZ90549.1\|3308097_3308223_-	ABC transporter	NA	NA	NA	NA
AVZ90550.1\|3310207_3310810_-	hypothetical protein	H9C175	Pectobacterium_phage	1.1e-76	68.6
AVZ90551.1\|3310826_3311858_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	4.7e-96	49.6
AVZ90552.1\|3311857_3312061_-	hypothetical protein	NA	NA	NA	NA
AVZ90553.1\|3312057_3312450_-	DNA-binding protein	K7PHB4	Enterobacterial_phage	8.0e-12	36.6
AVZ90554.1\|3312490_3312781_-	hypothetical protein	H6WRY6	Salmonella_phage	8.0e-17	56.9
AVZ90555.1\|3312792_3313026_-	DinI family protein	K7PM44	Enterobacteria_phage	3.7e-25	71.1
AVZ90556.1\|3313104_3314589_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVZ90557.1\|3314588_3314840_-	hypothetical protein	NA	NA	NA	NA
AVZ90558.1\|3315429_3316791_-	dGTPase	NA	NA	NA	NA
AVZ90559.1\|3316964_3317678_-	hypothetical protein	NA	NA	NA	NA
AVZ92643.1\|3318029_3318899_+	hypothetical protein	NA	NA	NA	NA
AVZ90560.1\|3318987_3320379_+	hypothetical protein	NA	NA	NA	NA
AVZ90561.1\|3320727_3321168_-	hypothetical protein	NA	NA	NA	NA
AVZ90562.1\|3321181_3321646_-	replication protein	A0A0U2JGJ0	Escherichia_phage	4.1e-63	72.2
AVZ92644.1\|3321638_3322643_-	DNA-binding protein	A0A0U2RT81	Escherichia_phage	1.0e-31	40.0
AVZ90563.1\|3322702_3323257_-	hypothetical protein	NA	NA	NA	NA
AVZ90564.1\|3323259_3323484_-	Cro/Cl family transcriptional regulator	H6WRX5	Salmonella_phage	1.3e-19	62.5
AVZ90565.1\|3323572_3324010_+	helix-turn-helix domain-containing protein	H6WRX4	Salmonella_phage	1.3e-39	62.2
AVZ90566.1\|3324331_3324646_-	hypothetical protein	NA	NA	NA	NA
AVZ90567.1\|3324808_3325027_+	hypothetical protein	NA	NA	NA	NA
AVZ90568.1\|3325036_3325231_+	DUF1482 domain-containing protein	NA	NA	NA	NA
AVZ90569.1\|3325273_3325618_+	transcriptional regulator	NA	NA	NA	NA
AVZ90570.1\|3325759_3327898_+	exonuclease	S4TNL0	Salmonella_phage	5.6e-99	42.7
AVZ90571.1\|3327950_3328196_+	excisionase	NA	NA	NA	NA
AVZ90572.1\|3328176_3329304_+\|integrase	integrase	O21925	Phage_21	4.4e-119	58.4
AVZ90573.1\|3329421_3330672_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6
AVZ90574.1\|3330912_3331563_+	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
3331012:3331026	attR	NA	NA	NA	NA
AVZ90575.1\|3331579_3332038_+	NUDIX hydrolase	NA	NA	NA	NA
AVZ92645.1\|3332094_3333201_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA

DBSCAN-SWA_9

3549180 : 3642131

Salmonella_phage(56.9%)

portal,capsid,head,integrase,tRNA,tail,plate,lysis,protease

attL 3604706:3604724|attR 3642206:3642224

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ90770.1\|3549180_3550473_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.3e-94	44.7
AVZ90771.1\|3550563_3551907_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	7.3e-81	40.8
AVZ90772.1\|3551915_3552527_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AVZ90773.1\|3552649_3556903_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	5.2e-88	49.2
AVZ90774.1\|3557038_3557533_-	leucine-responsive regulatory protein	NA	NA	NA	NA
AVZ90775.1\|3558065_3559034_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.2e-62	44.0
AVZ90776.1\|3559148_3560915_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	2.3e-21	25.9
AVZ90777.1\|3560915_3562637_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
AVZ90778.1\|3562681_3563383_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AVZ90779.1\|3563736_3563955_+	translation initiation factor IF-1	NA	NA	NA	NA
AVZ90780.1\|3564075_3566355_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AVZ90781.1\|3566385_3566703_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AVZ90782.1\|3567028_3567250_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AVZ90783.1\|3567204_3567387_-	hypothetical protein	NA	NA	NA	NA
AVZ90784.1\|3567326_3569267_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
AVZ90785.1\|3569263_3570379_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
AVZ90786.1\|3570525_3572184_-	ATP-dependent endonuclease	NA	NA	NA	NA
AVZ90787.1\|3572603_3573299_+	aquaporin Z	NA	NA	NA	NA
AVZ90788.1\|3573414_3574314_+	lysine exporter LysO family protein	NA	NA	NA	NA
AVZ92654.1\|3574457_3576110_+	hydroxylamine reductase	NA	NA	NA	NA
AVZ90789.1\|3576120_3577089_+	NADH oxidoreductase	NA	NA	NA	NA
AVZ90790.1\|3577039_3577243_+	hypothetical protein	NA	NA	NA	NA
AVZ90791.1\|3577300_3577735_-	DoxX family protein	NA	NA	NA	NA
AVZ92655.1\|3577886_3579605_+	ubiquinone-dependent pyruvate dehydrogenase	NA	NA	NA	NA
AVZ90792.1\|3579643_3580645_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
AVZ90793.1\|3580655_3582098_+	DUF2867 domain-containing protein	NA	NA	NA	NA
AVZ90794.1\|3582185_3583199_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AVZ90795.1\|3583195_3584026_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0UZW5	Roseobacter_phage	4.1e-05	31.6
AVZ90796.1\|3584057_3585197_-	GGDEF domain-containing protein	NA	NA	NA	NA
AVZ90797.1\|3585249_3585429_+	hypothetical protein	NA	NA	NA	NA
AVZ90798.1\|3586074_3586590_+	lipoprotein	NA	NA	NA	NA
AVZ90799.1\|3586816_3587545_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.2e-29	37.1
AVZ92656.1\|3587565_3588297_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AVZ90800.1\|3588303_3589020_+	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
AVZ90801.1\|3589019_3589688_+	arginine ABC transporter permease ArtM	NA	NA	NA	NA
AVZ90802.1\|3589871_3590603_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AVZ90803.1\|3590645_3592118_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	7.9e-28	31.8
AVZ90804.1\|3592114_3592831_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.1e-34	36.9
AVZ90805.1\|3592909_3594037_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A2K5B251	Erysipelothrix_phage	1.3e-19	25.6
AVZ90806.1\|3594078_3594567_-	DUF2593 domain-containing protein	NA	NA	NA	NA
AVZ90807.1\|3594624_3595470_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AVZ90808.1\|3595466_3596420_-	putrescine ABC transporter permease	NA	NA	NA	NA
AVZ92657.1\|3596430_3597564_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-30	34.9
AVZ90809.1\|3597727_3598840_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AVZ90810.1\|3599188_3599668_-	YbjN domain-containing protein	NA	NA	NA	NA
AVZ90811.1\|3599756_3600659_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.0e-34	35.3
AVZ90812.1\|3601480_3601768_-	hypothetical protein	NA	NA	NA	NA
AVZ90813.1\|3601970_3602234_+	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.6e-27	73.1
AVZ90814.1\|3602240_3602624_-	hypothetical protein	NA	NA	NA	NA
AVZ92658.1\|3602890_3604576_+	transporter	NA	NA	NA	NA
3604706:3604724	attL	NA	NA	NA	NA
AVZ90815.1\|3604795_3605014_-	transcriptional regulator	Q53ZE7	Salmonella_virus	7.5e-20	69.0
AVZ90816.1\|3605105_3606206_-	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	4.9e-176	87.4
AVZ90817.1\|3606202_3606688_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	7.2e-63	75.6
AVZ90818.1\|3606684_3609312_-\|tail	phage tail tape measure protein	E5FFG5	Burkholderia_phage	5.6e-117	42.0
AVZ90819.1\|3609304_3609424_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AVZ90820.1\|3609438_3609738_-\|tail	phage tail assembly protein	E5G6P9	Salmonella_phage	3.7e-33	79.0
AVZ90821.1\|3609790_3610306_-\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.3e-81	85.4
AVZ90822.1\|3610315_3611488_-\|tail	phage tail protein	A0A1S6KZY7	Salmonella_phage	1.9e-210	93.3
AVZ90823.1\|3611626_3612703_-\|tail	phage tail protein	Q37842	Escherichia_phage	1.2e-25	44.8
AVZ90824.1\|3612732_3612936_-	hypothetical protein	NA	NA	NA	NA
AVZ90825.1\|3612932_3613664_-	hypothetical protein	NA	NA	NA	NA
AVZ90826.1\|3613667_3616619_-	hypothetical protein	A0A2H4N7A3	Pectobacterium_phage	1.2e-06	50.9
AVZ90827.1\|3616620_3617220_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.3e-58	60.5
AVZ90828.1\|3617212_3618121_-\|plate	baseplate assembly protein	E5G6N8	Salmonella_phage	7.6e-106	66.9
AVZ90829.1\|3618107_3618470_-\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	4.9e-48	83.9
AVZ90830.1\|3618466_3619039_-\|plate	phage baseplate assembly protein V	E5G6N6	Salmonella_phage	4.7e-77	72.3
AVZ90831.1\|3619133_3619826_+	hypothetical protein	NA	NA	NA	NA
AVZ90832.1\|3619822_3620269_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.2e-50	71.2
AVZ90833.1\|3620261_3620693_-\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	9.9e-64	82.5
AVZ90834.1\|3620788_3621217_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	9.6e-51	77.9
AVZ90835.1\|3621213_3621597_-	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	2.1e-17	42.0
AVZ90836.1\|3621601_3622111_-	lysozyme	E5G6N1	Salmonella_phage	2.1e-81	83.4
AVZ90837.1\|3622091_3622307_-	hypothetical protein	E5G6N0	Salmonella_phage	3.6e-30	90.1
AVZ90838.1\|3622310_3622514_-\|tail	phage tail protein	A0A1S6KZY4	Salmonella_phage	1.3e-29	88.1
AVZ90839.1\|3622513_3622978_-\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	8.4e-77	89.0
AVZ90840.1\|3623073_3623724_-	hypothetical protein	E5G6M7	Salmonella_phage	8.7e-112	96.3
AVZ90841.1\|3623727_3624786_-\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	1.1e-180	93.1
AVZ90842.1\|3624802_3625636_-\|capsid	capsid protein	A0A1S6KZW9	Salmonella_phage	6.3e-123	88.8
AVZ90843.1\|3625778_3627545_+	oxidoreductase	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.0
AVZ90844.1\|3627544_3628570_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	7.6e-171	86.7
AVZ90845.1\|3628631_3630374_-	hypothetical protein	NA	NA	NA	NA
AVZ90846.1\|3630649_3631327_-	hypothetical protein	NA	NA	NA	NA
AVZ90847.1\|3631441_3631747_-	DinI family protein	E5G6M1	Salmonella_phage	4.7e-36	100.0
AVZ92659.1\|3631685_3631874_-	hypothetical protein	E5G6M0	Salmonella_phage	5.5e-27	98.4
AVZ90848.1\|3632027_3634442_-	replication endonuclease	E5G6L9	Salmonella_phage	0.0e+00	97.5
AVZ90849.1\|3634438_3635296_-	DNA adenine methylase	E5G6L8	Salmonella_phage	2.0e-156	95.4
AVZ90850.1\|3635292_3635520_-	hypothetical protein	E5G6L7	Salmonella_phage	6.0e-36	98.7
AVZ90851.1\|3635519_3635753_-	DUF2732 domain-containing protein	E5G6L6	Salmonella_phage	4.1e-32	96.1
AVZ90852.1\|3635820_3636162_-	hypothetical protein	E5G6L5	Salmonella_phage	4.6e-56	99.1
AVZ90853.1\|3636125_3636326_-	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	1.6e-32	97.0
AVZ90854.1\|3636333_3636843_-	hypothetical protein	E5G6L3	Salmonella_phage	5.8e-87	98.8
AVZ90855.1\|3636875_3637097_-	regulator	NA	NA	NA	NA
AVZ90856.1\|3637242_3638121_+	Repressor protein CI	A0A1S6KZZ7	Salmonella_phage	1.7e-30	39.9
AVZ90857.1\|3638132_3639077_+	hypothetical protein	NA	NA	NA	NA
AVZ90858.1\|3639175_3640660_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVZ90859.1\|3640659_3640911_-	hypothetical protein	NA	NA	NA	NA
AVZ90860.1\|3641078_3642131_+\|integrase	integrase	A0A218M4I3	Erwinia_phage	1.0e-106	57.0
3642206:3642224	attR	NA	NA	NA	NA

DBSCAN-SWA_10

4294581 : 4306234

Enterobacteria_phage(70.0%)

integrase

attL 4295031:4295045|attR 4318087:4318101

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ91446.1\|4294581_4295685_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.8e-62	40.5
4295031:4295045	attL	NA	NA	NA	NA
AVZ91447.1\|4295695_4296949_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.9e-89	44.9
AVZ91448.1\|4297301_4298492_+\|integrase	integrase	Q7M297	Enterobacteria_phage	6.4e-145	62.7
AVZ91449.1\|4298479_4299430_+	cobyrinic acid a,c-diamide synthase	A0A1X9IGI7	Lactococcus_phage	1.2e-13	27.1
AVZ91450.1\|4299429_4299855_+	hypothetical protein	NA	NA	NA	NA
AVZ91451.1\|4300422_4300989_-	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	9.7e-59	63.8
AVZ91452.1\|4301006_4301252_-	hypothetical protein	Q7M294	Enterobacteria_phage	5.5e-19	56.8
AVZ91453.1\|4301248_4301986_-	glycoprotein 3	Q7M2A2	Enterobacteria_phage	1.9e-70	59.4
AVZ91454.1\|4302527_4302794_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	2.6e-30	71.6
AVZ91455.1\|4302790_4303348_+	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	1.8e-33	70.4
AVZ91456.1\|4303344_4303572_+	hypothetical protein	NA	NA	NA	NA
AVZ91457.1\|4303568_4303889_+	hypothetical protein	NA	NA	NA	NA
AVZ91458.1\|4303900_4306234_+	DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	82.2
4318087:4318101	attR	NA	NA	NA	NA

DBSCAN-SWA_11

4962197 : 5000253

Salmonella_phage(16.67%)

transposase,integrase

attL 4952389:4952404|attR 4981608:4981623

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4952389:4952404	attL	NA	NA	NA	NA
AVZ92050.1\|4962197_4965083_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-190	39.9
AVZ92051.1\|4965785_4966550_-\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AVZ92052.1\|4966637_4966751_+	NTP-binding protein	NA	NA	NA	NA
AVZ92053.1\|4967056_4967557_-	N-acetyltransferase	NA	NA	NA	NA
AVZ92054.1\|4967575_4967755_+	hypothetical protein	NA	NA	NA	NA
AVZ92055.1\|4967684_4968524_-	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
AVZ92056.1\|4968517_4968865_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AVZ92057.1\|4969028_4969820_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AVZ92720.1\|4969912_4971172_-	chloramphenicol efflux MFS transporter CmlA10	S4TR35	Salmonella_phage	1.1e-25	31.3
AVZ92058.1\|4971426_4971960_-	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
AVZ92059.1\|4972033_4972366_-	quaternary ammonium compound efflux SMR transporter QacL	E5E3Y9	Acinetobacter_phage	3.5e-08	34.3
AVZ92060.1\|4972616_4973576_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.7e-47	40.5
AVZ92061.1\|4973466_4974171_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ92062.1\|4974161_4974359_+	hypothetical protein	NA	NA	NA	NA
AVZ92063.1\|4974399_4975203_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
AVZ92064.1\|4975202_4976039_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AVZ92065.1\|4976162_4976528_-	DUF3742 domain-containing protein	NA	NA	NA	NA
AVZ92066.1\|4976612_4977245_-	hypothetical protein	NA	NA	NA	NA
AVZ92067.1\|4977257_4977884_-\|integrase	integrase	NA	NA	NA	NA
AVZ92068.1\|4978203_4980048_+	relaxase	NA	NA	NA	NA
AVZ92069.1\|4980128_4982780_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-155	33.9
4981608:4981623	attR	NA	NA	NA	NA
AVZ92070.1\|4982805_4984671_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	3.4e-52	37.1
AVZ92071.1\|4984731_4986045_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.3e-77	40.2
AVZ92072.1\|4986096_4987404_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AVZ92073.1\|4987422_4988253_-	S-formylglutathione hydrolase	NA	NA	NA	NA
AVZ92074.1\|4988311_4989646_-	DUF3422 domain-containing protein	NA	NA	NA	NA
AVZ92075.1\|4989828_4990227_-	VOC family protein	NA	NA	NA	NA
AVZ92076.1\|4990270_4991380_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.9e-35	30.4
AVZ92077.1\|4991439_4991715_-	regulator	NA	NA	NA	NA
AVZ92078.1\|4991997_4992888_-	nitrilase	NA	NA	NA	NA
AVZ92079.1\|4992884_4993493_-	GNAT family acetyltransferase	NA	NA	NA	NA
AVZ92080.1\|4993494_4993902_-	isopropylmalate/homocitrate/citramalate synthase	NA	NA	NA	NA
AVZ92081.1\|4994056_4994962_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ92082.1\|4995112_4997089_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
AVZ92083.1\|4997302_4997521_+	hypothetical protein	NA	NA	NA	NA
AVZ92721.1\|4997464_4997896_-	DUF488 domain-containing protein	NA	NA	NA	NA
AVZ92084.1\|4998303_4998642_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AVZ92085.1\|4998702_5000253_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.5e-90	42.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP028547

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP028543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP028544

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP028548

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection