CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP017927	Bordetella pertussis strain J295, complete genome	5 crisprs	csa3,cas3,DinG,DEDDh	0	0	31	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP017927_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP017927_1

250555-250639

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP017927_1

>merge|CP017927|1|250555-250639|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP017927|1|1|250555-250639|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP017927.1\|AUK91555.1\|253581_254202_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP017927.1\|AUK88371.1\|238740_239496_+\|gamma-hydroxybutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|185358
CP017927.1\|AUK88380.1\|250649_251591_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP017927.1\|AUK88375.1\|246001_246493_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP017927.1\|AUK88384.1\|256348_257740_+\|fumarate-hydratase,-class-II	unknown	unknown	gnl\|CDD\|234779
CP017927.1\|AUK88372.1\|239512_240256_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP017927.1\|AUK88388.1\|260926_262681_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP017927.1\|AUK88382.1\|254344_255730_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP017927.1\|AUK88377.1\|247845_248544_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319796
CP017927.1\|AUK88373.1\|240299_241343_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP017927.1\|AUK88381.1\|251587_253477_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP017927.1\|AUK88383.1\|255660_256197_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP017927.1\|AUK91554.1\|242356_243616_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP017927.1\|AUK88385.1\|257756_258737_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223751
CP017927.1\|AUK88376.1\|246489_247845_-\|poly(A)-polymerase	unknown	unknown	gnl\|CDD\|130997
CP017927.1\|AUK88386.1\|258872_259856_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270295
CP017927.1\|AUK88379.1\|249494_250544_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP017927.1\|AUK88378.1\|248540_249242_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP017927.1\|AUK88374.1\|245026_245983_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
CP017927.1\|AUK88387.1\|259920_260820_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107

Protein	Function_ID	Function_description	E-value
CP017927.1\|AUK91555.1\|253581_254202_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	8.25718e-70
CP017927.1\|AUK88371.1\|238740_239496_+\|gamma-hydroxybutyrate-dehydrogenase	gnl\|CDD\|185358	PRK15461, PRK15461, sulfolactaldehyde 3-reductase.	1.19571e-122
CP017927.1\|AUK88380.1\|250649_251591_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP017927.1\|AUK88375.1\|246001_246493_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP017927.1\|AUK88384.1\|256348_257740_+\|fumarate-hydratase,-class-II	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP017927.1\|AUK88372.1\|239512_240256_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP017927.1\|AUK88388.1\|260926_262681_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP017927.1\|AUK88382.1\|254344_255730_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	1.25625e-84
CP017927.1\|AUK88377.1\|247845_248544_-\|hypothetical-protein	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP017927.1\|AUK88373.1\|240299_241343_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP017927.1\|AUK88381.1\|251587_253477_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP017927.1\|AUK88383.1\|255660_256197_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP017927.1\|AUK91554.1\|242356_243616_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.48771e-95
CP017927.1\|AUK88385.1\|257756_258737_-\|hypothetical-protein	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP017927.1\|AUK88376.1\|246489_247845_-\|poly(A)-polymerase	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP017927.1\|AUK88386.1\|258872_259856_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP017927.1\|AUK88379.1\|249494_250544_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP017927.1\|AUK88378.1\|248540_249242_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP017927.1\|AUK88374.1\|245026_245983_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP017927.1\|AUK88387.1\|259920_260820_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38

>CP017927.1|AUK88379.1|249494_250544_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP017927.1|AUK88378.1|248540_249242_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP017927.1|AUK88377.1|247845_248544_-|hypothetical-protein
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP017927.1|AUK88376.1|246489_247845_-|poly(A)-polymerase
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP017927.1|AUK88375.1|246001_246493_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP017927.1|AUK88374.1|245026_245983_+|hypothetical-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP017927.1|AUK91554.1|242356_243616_+|hypothetical-protein
MMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP017927.1|AUK88373.1|240299_241343_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP017927.1|AUK88372.1|239512_240256_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP017927.1|AUK88371.1|238740_239496_+|gamma-hydroxybutyrate-dehydrogenase
MLPTATHIQAALEGADGALQGMGPGALFINMSTILPQETDLIAQRLAERGMRMLDSPVGRSAMEAQRGTLLILASGSAQDKARARDALLCMGNQVIDCGEVGGGSRVKVVNNFMGISLNALTAEALTLAEASGLSVELALEVMRGTIAGLGHMNITYPNKVLRGDLSAGFQVDLAHKDLGLALELAARSRACVPMGSAAFQSYTAARAQGRGGQDYSAIYPVMRSLSGLPEALPYQVDTPVEADPFGAAAR
>CP017927.1|AUK88380.1|250649_251591_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP017927.1|AUK88381.1|251587_253477_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP017927.1|AUK91555.1|253581_254202_+|hypothetical-protein
MVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP017927.1|AUK88382.1|254344_255730_-|N-acetylmuramoyl-L-alanine-amidase
MVERDCPPAHGALSPRAAARRRLISVAATLLVLPVVPRLAHAATILAVRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP017927.1|AUK88383.1|255660_256197_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP017927.1|AUK88384.1|256348_257740_+|fumarate-hydratase,-class-II
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP017927.1|AUK88385.1|257756_258737_-|hypothetical-protein
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP017927.1|AUK88386.1|258872_259856_+|ABC-transporter-substrate-binding-protein
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP017927.1|AUK88387.1|259920_260820_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP017927.1|AUK88388.1|260926_262681_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP017927_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP017927_2

431998-432091

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP017927_2

>merge|CP017927|2|431998-432091|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP017927|2|2|431998-432091|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP017927.1\|AUK88549.1\|436998_437754_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223930
CP017927.1\|AUK88537.1\|420525_421020_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP017927.1\|AUK88544.1\|431368_431767_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP017927.1\|AUK88540.1\|423487_424999_+\|TRAP-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP017927.1\|AUK88542.1\|427107_427842_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP017927.1\|AUK88545.1\|432177_432648_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP017927.1\|AUK88546.1\|432736_433081_-\|TIGR01244-family-protein	unknown	unknown	gnl\|CDD\|225984
CP017927.1\|AUK88550.1\|437949_439182_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP017927.1\|AUK88552.1\|440026_440998_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP017927.1\|AUK88541.1\|426518_426698_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP017927.1\|AUK91563.1\|425014_426328_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
CP017927.1\|AUK88548.1\|436369_436888_-\|methyltransferase	unknown	unknown	gnl\|CDD\|224204
CP017927.1\|AUK88547.1\|433180_434581_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224089
CP017927.1\|AUK88539.1\|422285_423491_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP017927.1\|AUK88536.1\|419337_420396_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP017927.1\|AUK88551.1\|439174_439960_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP017927.1\|AUK88543.1\|430334_431237_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP017927.1\|AUK88553.1\|441008_441986_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP017927.1\|AUK88554.1\|442111_443284_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP017927.1\|AUK88538.1\|421112_422090_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
CP017927.1\|AUK88549.1\|436998_437754_+\|hypothetical-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP017927.1\|AUK88537.1\|420525_421020_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP017927.1\|AUK88544.1\|431368_431767_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP017927.1\|AUK88540.1\|423487_424999_+\|TRAP-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP017927.1\|AUK88542.1\|427107_427842_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP017927.1\|AUK88545.1\|432177_432648_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP017927.1\|AUK88546.1\|432736_433081_-\|TIGR01244-family-protein	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP017927.1\|AUK88550.1\|437949_439182_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP017927.1\|AUK88552.1\|440026_440998_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP017927.1\|AUK88541.1\|426518_426698_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP017927.1\|AUK91563.1\|425014_426328_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP017927.1\|AUK88548.1\|436369_436888_-\|methyltransferase	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP017927.1\|AUK88547.1\|433180_434581_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP017927.1\|AUK88539.1\|422285_423491_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP017927.1\|AUK88536.1\|419337_420396_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP017927.1\|AUK88551.1\|439174_439960_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP017927.1\|AUK88543.1\|430334_431237_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.3673e-23
CP017927.1\|AUK88553.1\|441008_441986_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP017927.1\|AUK88554.1\|442111_443284_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP017927.1\|AUK88538.1\|421112_422090_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23

>CP017927.1|AUK88544.1|431368_431767_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP017927.1|AUK88543.1|430334_431237_+|IS481-family-transposase
MVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP017927.1|AUK88542.1|427107_427842_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP017927.1|AUK88541.1|426518_426698_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP017927.1|AUK91563.1|425014_426328_-|short-chain-fatty-acid-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP017927.1|AUK88540.1|423487_424999_+|TRAP-ABC-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP017927.1|AUK88539.1|422285_423491_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP017927.1|AUK88538.1|421112_422090_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP017927.1|AUK88537.1|420525_421020_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP017927.1|AUK88536.1|419337_420396_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP017927.1|AUK88545.1|432177_432648_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP017927.1|AUK88546.1|432736_433081_-|TIGR01244-family-protein
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP017927.1|AUK88547.1|433180_434581_-|GntR-family-transcriptional-regulator
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP017927.1|AUK88548.1|436369_436888_-|methyltransferase
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP017927.1|AUK88549.1|436998_437754_+|hypothetical-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP017927.1|AUK88550.1|437949_439182_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP017927.1|AUK88551.1|439174_439960_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP017927.1|AUK88552.1|440026_440998_+|ABC-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP017927.1|AUK88553.1|441008_441986_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP017927.1|AUK88554.1|442111_443284_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP017927_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP017927_3

995268-995362

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP017927_3

>merge|CP017927|3|995268-995362|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP017927|3|3|995268-995362|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP017927.1\|AUK89020.1\|985972_986647_+\|sulfate-ABC-transporter-permease-subunit-CysT	unknown	unknown	gnl\|CDD\|131194
CP017927.1\|AUK89030.1\|1000999_1001572_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP017927.1\|AUK89031.1\|1001631_1002363_+\|pseudouridylate-synthase	unknown	unknown	gnl\|CDD\|224108
CP017927.1\|AUK89025.1\|993642_994515_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP017927.1\|AUK89024.1\|993254_993635_+\|hypothetical-protein	unknown	unknown	unknown
CP017927.1\|AUK91595.1\|998474_999491_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
CP017927.1\|AUK91594.1\|989430_990339_+\|sulfate-adenylyltransferase-small-subunit	unknown	unknown	gnl\|CDD\|235375
CP017927.1\|AUK89029.1\|997287_998337_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP017927.1\|AUK89033.1\|1007315_1008698_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|273830
CP017927.1\|AUK89022.1\|987568_988633_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
CP017927.1\|AUK89018.1\|984697_985732_+\|sulfate-transporter-subunit	unknown	unknown	gnl\|CDD\|224529
CP017927.1\|AUK89023.1\|991826_993101_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP017927.1\|AUK89021.1\|986761_987544_+\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
CP017927.1\|AUK89032.1\|1004139_1007319_+\|multidrug-efflux-RND-transporter-permease	unknown	unknown	gnl\|CDD\|273335
CP017927.1\|AUK89026.1\|994820_995201_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP017927.1\|AUK89019.1\|985747_985951_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131194
CP017927.1\|AUK89028.1\|996232_997183_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP017927.1\|AUK89034.1\|1008767_1009019_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225170
CP017927.1\|AUK89027.1\|995450_996137_+\|coenzyme-A-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP017927.1\|AUK91596.1\|1002414_1003332_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114

Protein	Function_ID	Function_description	E-value
CP017927.1\|AUK89020.1\|985972_986647_+\|sulfate-ABC-transporter-permease-subunit-CysT	gnl\|CDD\|131194	TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT. This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions].	5.60551e-119
CP017927.1\|AUK89030.1\|1000999_1001572_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP017927.1\|AUK89031.1\|1001631_1002363_+\|pseudouridylate-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP017927.1\|AUK89025.1\|993642_994515_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP017927.1\|AUK91595.1\|998474_999491_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
CP017927.1\|AUK91594.1\|989430_990339_+\|sulfate-adenylyltransferase-small-subunit	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP017927.1\|AUK89029.1\|997287_998337_+\|aldo/keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP017927.1\|AUK89033.1\|1007315_1008698_+\|multidrug-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
CP017927.1\|AUK89022.1\|987568_988633_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP017927.1\|AUK89018.1\|984697_985732_+\|sulfate-transporter-subunit	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP017927.1\|AUK89023.1\|991826_993101_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP017927.1\|AUK89021.1\|986761_987544_+\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	8.42883e-141
CP017927.1\|AUK89032.1\|1004139_1007319_+\|multidrug-efflux-RND-transporter-permease	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP017927.1\|AUK89026.1\|994820_995201_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP017927.1\|AUK89019.1\|985747_985951_+\|hypothetical-protein	gnl\|CDD\|131194	TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT. This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions].	4.38349e-06
CP017927.1\|AUK89028.1\|996232_997183_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP017927.1\|AUK89034.1\|1008767_1009019_-\|hypothetical-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP017927.1\|AUK89027.1\|995450_996137_+\|coenzyme-A-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	2.60589e-72
CP017927.1\|AUK91596.1\|1002414_1003332_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67

>CP017927.1|AUK89026.1|994820_995201_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP017927.1|AUK89025.1|993642_994515_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP017927.1|AUK89024.1|993254_993635_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP017927.1|AUK89023.1|991826_993101_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP017927.1|AUK91594.1|989430_990339_+|sulfate-adenylyltransferase-small-subunit
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP017927.1|AUK89022.1|987568_988633_+|sulfate-ABC-transporter-ATP-binding-protein
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP017927.1|AUK89021.1|986761_987544_+|sulfate-ABC-transporter-permease-subunit-CysW
MFTEALRKGWQLYLAAIVEPDAWSAIRLTLLVAAIALPVNLVFGVAAAWAVTKFQFRGKQLLITLIDLPFSVSPVVAGMVFVLLFGSQGWFGPWLQDHDWKIVYAVPGVILATLFVTFPFIARELIPLMQAQGSEEEQAALTLGASGWQIFWRVTLPNIKWGLLYGAILCNARAMGEFGAVSVVSGQVRGLTNTMTLHVEILYNEYQFAAAFAVASLLALLALVTLAAKQVVEWRNQRLSPRQAEAPVHAGALAVRPAAA
>CP017927.1|AUK89020.1|985972_986647_+|sulfate-ABC-transporter-permease-subunit-CysT
MVASYRLTFGASLLAALVNLVFGTIVAWVLVRYRFPGKKIVDVLVDLPFALPTAVAGIALTALYSANGWLGAPLQRWFDLKVAFTPLGIVVALIFIGVPFVVRTVQPVLEDVERELEEAAASLGAGRWQTIRRVLLPALLPALLTGFALAFARAIGEYGSVVFIAGNMPMISEITPLLIISKLEQYDYAGAAAIATVMLALSFALLLVINLLQGWQTRRGGRQP
>CP017927.1|AUK89019.1|985747_985951_+|hypothetical-protein
MSLAIPSGPAPTAARRQRPGVLPGFGISMGYAVLYLSLLVLVLVLVLVLVPLAALPIKSLELGWAGF
>CP017927.1|AUK89018.1|984697_985732_+|sulfate-transporter-subunit
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP017927.1|AUK89027.1|995450_996137_+|coenzyme-A-pyrophosphatase
MRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP017927.1|AUK89028.1|996232_997183_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP017927.1|AUK89029.1|997287_998337_+|aldo/keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP017927.1|AUK91595.1|998474_999491_-|IS110-family-transposase
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP017927.1|AUK89030.1|1000999_1001572_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP017927.1|AUK89031.1|1001631_1002363_+|pseudouridylate-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP017927.1|AUK91596.1|1002414_1003332_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP017927.1|AUK89032.1|1004139_1007319_+|multidrug-efflux-RND-transporter-permease
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP017927.1|AUK89033.1|1007315_1008698_+|multidrug-transporter
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>CP017927.1|AUK89034.1|1008767_1009019_-|hypothetical-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP017927_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP017927_4

1818722-1818849

Orphan

Consensus_repeat	Method
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP017927_4

>merge|CP017927|4|1818722-1818849|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCGTGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGCAAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

>CP017927|4|4|1818722-1818849|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	TGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGC
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP017927.1\|AUK89662.1\|1809362_1810622_-\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	unknown	unknown	gnl\|CDD\|236882
CP017927.1\|AUK89661.1\|1808743_1809382_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372868
CP017927.1\|AUK89667.1\|1816364_1817315_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP017927.1\|AUK89676.1\|1825706_1826117_+\|Fe-S-cluster-assembly-scaffold-IscU	unknown	unknown	gnl\|CDD\|183087
CP017927.1\|AUK89673.1\|1823220_1823712_+\|protein-tyrosine-phosphatase	unknown	unknown	gnl\|CDD\|319971
CP017927.1\|AUK89675.1\|1824457_1825669_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|184450
CP017927.1\|AUK89668.1\|1817311_1817671_-\|hypothetical-protein	unknown	unknown	unknown
CP017927.1\|AUK89670.1\|1818872_1819523_-\|repressor-LexA	unknown	unknown	gnl\|CDD\|234688
CP017927.1\|AUK89666.1\|1815511_1815997_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
CP017927.1\|AUK89674.1\|1823927_1824440_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	unknown	unknown	gnl\|CDD\|273927
CP017927.1\|AUK89664.1\|1812736_1814722_-\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	unknown	unknown	gnl\|CDD\|274868
CP017927.1\|AUK89678.1\|1826444_1826957_+\|Fe-S-protein-assembly-co-chaperone-HscB	unknown	unknown	gnl\|CDD\|235133
CP017927.1\|AUK89671.1\|1819651_1820854_-\|aromatic-amino-acid-aminotransferase	unknown	unknown	gnl\|CDD\|181731
CP017927.1\|AUK89677.1\|1826118_1826442_+\|iron-sulfur-cluster-assembly-protein-IscA	unknown	unknown	gnl\|CDD\|213674
CP017927.1\|AUK89679.1\|1827086_1828949_+\|Fe-S-protein-assembly-chaperone-HscA	unknown	unknown	gnl\|CDD\|235360
CP017927.1\|AUK89672.1\|1820931_1822968_+\|excinuclease-ABC-subunit-B	unknown	unknown	gnl\|CDD\|235395
CP017927.1\|AUK89663.1\|1810625_1812731_-\|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB	unknown	unknown	gnl\|CDD\|274867
CP017927.1\|AUK89665.1\|1814930_1815167_+\|hypothetical-protein	unknown	unknown	unknown
CP017927.1\|AUK89660.1\|1807626_1808739_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
CP017927.1\|AUK89669.1\|1817716_1818646_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|273608

Protein	Function_ID	Function_description	E-value
CP017927.1\|AUK89662.1\|1809362_1810622_-\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	gnl\|CDD\|236882	PRK11204, PRK11204, N-glycosyltransferase; Provisional.	0
CP017927.1\|AUK89661.1\|1808743_1809382_-\|hypothetical-protein	gnl\|CDD\|372868	pfam13994, PgaD, PgaD-like protein. This family includes the PgaD protein from E. coli. The homopolymer poly-beta-1,6-N-acetyl-D-glucosamine (beta-1,6-GlcNAc; PGA) serves as an adhesin for the maintenance of biofilm structural stability in eubacteria. The pgaABCD operon is required for its synthesis and export. It has been shown that PgaD is essential for this process.	0.00341018
CP017927.1\|AUK89667.1\|1816364_1817315_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP017927.1\|AUK89676.1\|1825706_1826117_+\|Fe-S-cluster-assembly-scaffold-IscU	gnl\|CDD\|183087	PRK11325, PRK11325, scaffold protein; Provisional.	5.84746e-99
CP017927.1\|AUK89673.1\|1823220_1823712_+\|protein-tyrosine-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	1.04407e-74
CP017927.1\|AUK89675.1\|1824457_1825669_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|184450	PRK14012, PRK14012, IscS subfamily cysteine desulfurase.	0
CP017927.1\|AUK89670.1\|1818872_1819523_-\|repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.25833e-105
CP017927.1\|AUK89666.1\|1815511_1815997_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	7.77331e-19
CP017927.1\|AUK89674.1\|1823927_1824440_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	gnl\|CDD\|273927	TIGR02010, Putative_HTH-type_transcriptional_regulator, iron-sulfur cluster assembly transcription factor IscR. This model describes IscR, an iron-sulfur binding transcription factor of the ISC iron-sulfur cluster assembly system. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions].	1.00126e-77
CP017927.1\|AUK89664.1\|1812736_1814722_-\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	gnl\|CDD\|274868	TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA. Members of this protein family are the poly-beta-1,6 N-acetyl-D-glucosamine (PGA) export porin PgaA of Gram-negative bacteria. There is no counterpart in the poly-beta-1,6 N-acetyl-D-glucosamine biosynthesis systems of Gram-positive bacteria such as Staphylococcus epidermidis. The PGA polysaccharide adhesin is a critical determinant of biofilm formation. The conserved C-terminal domain of this outer membrane protein is preceded by a variable number of TPR repeats.	1.10027e-119
CP017927.1\|AUK89678.1\|1826444_1826957_+\|Fe-S-protein-assembly-co-chaperone-HscB	gnl\|CDD\|235133	PRK03578, hscB, Fe-S protein assembly co-chaperone HscB.	2.55481e-79
CP017927.1\|AUK89671.1\|1819651_1820854_-\|aromatic-amino-acid-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
CP017927.1\|AUK89677.1\|1826118_1826442_+\|iron-sulfur-cluster-assembly-protein-IscA	gnl\|CDD\|213674	TIGR02011, Protein_yfhF., iron-sulfur cluster assembly protein IscA. This model represents the IscA component of the ISC system for iron-sulfur cluster assembly. The ISC system consists of IscRASU, HscAB and an Isc-specific ferredoxin. IscA previously was believed to act as a scaffold and now is seen as an iron donor protein. This clade is limited to the proteobacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	4.04388e-54
CP017927.1\|AUK89672.1\|1820931_1822968_+\|excinuclease-ABC-subunit-B	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
CP017927.1\|AUK89663.1\|1810625_1812731_-\|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB	gnl\|CDD\|274867	TIGR03938, hypothetical_protein_Pcar_2791, poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
CP017927.1\|AUK89679.1\|1827086_1828949_+\|Fe-S-protein-assembly-chaperone-HscA	gnl\|CDD\|235360	PRK05183, hscA, chaperone protein HscA; Provisional.	0
CP017927.1\|AUK89660.1\|1807626_1808739_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	0
CP017927.1\|AUK89669.1\|1817716_1818646_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	gnl\|CDD\|273608	TIGR01414, Contains:_AIDA-I_translocator, outer membrane autotransporter barrel domain. A number of Gram-negative bacterial proteins, mostly found in pathogens and associated with virulence, contain a conserved C-terminal domain that integrates into the outer membrane and enables the N-terminal region to be delivered across the membrane. This C-terminal autotransporter domain is about 400 amino acids in length and includes the aromatic amino acid-rich OMP signal, typically ending with a Phe or Trp residue, at the extreme C-terminus. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	4.98806e-78

>CP017927.1|AUK89669.1|1817716_1818646_+|autotransporter-outer-membrane-beta-barrel-domain-containing-protein
MPRSGILTAPVLAVLGTASAPQGIWQAEMNALSKRMGELRLTPAAGGVWARSFAQRQRLDNQVVDRFTQTVGGIEIGADTALPAAEGRWHVGAVAGYSRARRKLAHSARGNSDSLHVGAYATYIGDGGFYLDGIVRVNRYEHDFRADGQRGARVTGKYRANGIGLSLETGRRFTWAGDWFVEPQVEVALFRSGGADYTASNGVRVDVASTKSLLGRAGLQVGRKLDLGNGKLVQPYAKLSWLQEFDGVGKVRTNDIGHDVKLRGGRAELDLGVAAALGRHSSLFASYEYSKGSRLTIPWSFHVGYRYAW
>CP017927.1|AUK89668.1|1817311_1817671_-|hypothetical-protein
MRLVLRPGSRLGARLPLRTRFRLRSGFHPRPGFHLSSGLCIGLGIGIGRGQALRPLLGRVGPRLRRLFGRRRQPAVLAIDGSAVQLGTRNIDVGPAIVDGRAIEIYRCPAVFIVDGPAI
>CP017927.1|AUK89667.1|1816364_1817315_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP017927.1|AUK89666.1|1815511_1815997_+|MarR-family-transcriptional-regulator
MPASQDKPDVPPGPYHFSEQVGHLLRRAYQRHVAIFQQTIPDSKLTAAQFVVLCALRDQGACSLVDVVKATAIDQATVRGVIERLKARKLLAVSHDPADRRKVLVTLTPDGRALVEEMVPFAEQITQSTFGGLNPAERVAIVYLLRKMSDADDLVGRQSES
>CP017927.1|AUK89665.1|1814930_1815167_+|hypothetical-protein
MRRAAKWWGPAATWTLAALLVLLVGHGVVPEAARVSDAPLLHAMAGHAYLLNWAAGLMALIGWGDSLVLYRRTRRRAV
>CP017927.1|AUK89664.1|1812736_1814722_-|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA
MNNDQTRRTRPASVRGLRRTRLLVAGLAFVGAAAAAAPSVRDQVQEASRSGAANLALDLATEHRALFTPLEYAQLQHAAIAQRLRWSRAETWNLTGPERFATLDAALADGWQLLDSLPLAPEYASLRTAVISDMIYGLGLRGRYADAIKLYEGLRATNTPVHPYVLVSAGNAYAYEERYDEAIVCYEEALAKAGPGDIDRVPTQESLFFAYMDRGRYEDAEQLLQRIEKTSPQYVENAPVAERPNEDYATAQRLRAQYLMYSGETEAGTLAIDALQHDAPFSSGLRNAAASARLGDARPREAKAAFTTALAERPDDIQAMTGLARASMALREYPEAEAIVTTLSERFPESSSVRNLQRDYEVYQSPLLTMDFGGDIGHGGDNSNNDNSTIANREWSLNTMLYTSPISHNYRLFFHQFTGYADLGDGHKSRVRNGAGLEYRRGSIEASTELHQSTGPSGRFGASANVAWLPSDGWRLAANFDSDSNDLPWKAYRAGIHGWSSGVSARYQPTERTYYDVAYQLQHYSDSNTRQTIGATWFQNLWTVPRHSVSTWTSVAYSNNSKTDTECFSPDHDLTAQVTAMYEWRPWRDGQYAFRQRVYATGGVYNQAEHGNSALWQLRLEQVWDLPRQTSITYGVGYGRHSYDGDPENRTLFYLTLNIPF
>CP017927.1|AUK89663.1|1810625_1812731_-|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB
MTAMHRTLLKWFACCALGLLMLPARAYKVDMLPPPDPDDGLTFRVLCMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNLISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLKKFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSADLIREHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVSLTQIRRSLVDYEVNVATVARAMREPVSYHGQVRPIERIVQVDLDYIYDPDPEQQNRNLGQLIDRMKDLAPSAVYLQAFAYPKGDGDITEVYFPNRHLPMRADLFNRVAWQLKTRAGVMVYAWLPVLTFSVPPGNPAYGKVVQSTTRKPGERGLGSPTRLSPFHPDAHRVISEIYEDLAKAAHFDGLLFHDDAVLDDTEDSSPEALATYQGWGLPPDIAAIRADPKLAQQWSKGKIRYLIDFTMHLRHIVSGYQNDRDMVVARNLYAQPVLDPVSEAWYGQSLPEFLKSYDFVALMAMPNMEGAARPEQWMRQLVAAVARQKGLDRTIFELQARDWRVGKPIDTEILRKQMVQLRSLGAINYGYYPDDFIANHPDAEVLRDVMSLKSTLEKRRLTKAQELSRQTTLYGSASQAEPTQR
>CP017927.1|AUK89662.1|1809362_1810622_-|poly-beta-1,6-N-acetyl-D-glucosamine-synthase
MNDSVKSVLSSFVFYYPFFMSYFWIVGGLLHFFLFEQGRKHRATLLPRVPRVAIVVPCYNEGENVAEVIAHLDRMHYPNYRIIAVNDGSRDNTGALLNELAEQYPRLLVVHQSRNEGKAIGLNTAAQLSDAEFLLCIDGDSLPHPDSITYMLTHFLHAGHVGAVTGNPRIRNRSTVLGRMQVGEFSSIVGLIKRTQQLYGKLMTVSGVMTMFRKQALHQVGYWSPDMQTEDIDISWKLQLAGWTLRYEPRALTWILMPETFRGLFKQRYRWARGGIETALKYAPRMLNPRQILMWPIFLEFSLSVLWAYAMLFLICMAVLGQFVALPPAWQFEIFPRWHGTLLFLTCLAQLFAGCIVDRAYDYRIFRYFADAVWYPIAFWIIGMITTVFALPRVLFRRAQSRARWVSPDRGIKHESVDH
>CP017927.1|AUK89661.1|1808743_1809382_-|hypothetical-protein
MKALIIDISASPLREYVHQHGVADGLLYGCWYRIVRPLLVILTWVAFSLYIHHSLVTVGGTAAQIAELLVYITVVATMAAALTAWMIVCRFHGWIRARDNEEVGVGLDPEYALPPRWPLPEGANRLLVDHDEAGAIVQVSAWYVPAAIEPVVAAAMASAVMPEAAPLSEPAPVAAALPDEADELAAWSGPPMQRQPDGRIEPTLHDGRALTL
>CP017927.1|AUK89660.1|1807626_1808739_+|alkene-reductase
MSTLFQPLNAGKLRLANRIVMAPLTRNRSPNAVPPPLTATYYAQRASAGLIITEATAISHQGQGYADVPGLYAPEQLAGWRRVTDAVHAAGGTIVVQLWHVGRISHTTLQPGQGAPVAPSAIRAQARTYLVDAQGKGQFADTSEPRALALDELPGIVEDYRRAARAAIDHGFDGVELHAANGYLLDQFLRSGSNHRDDAYGGSIENRARLLLRALDAVCAEVGADRVGIRLSPVTPANDAHDDQPQPLFEYVLRELARRGLAYVHVIEGATGGDRAYQQGPAPFDYAALKAAYRAAGGAGAWMVNNGYDISLAEQKLSSGQADLVAFGKPFIANPDLVARLRQGAALNEGDRDTFYGGGERGYTDYPALA
>CP017927.1|AUK89670.1|1818872_1819523_-|repressor-LexA
MATKLTERQQEILDLIRQTVARTGFPPTRAEIAQALGFRSPNAAEDHLKALARKGAIELTAGASRGIRLKVPDSATPSAQLTHPLLAQLVLPLVGRVAAGSPILASEHVEREVGVDPGLFAQTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVARLGDEVTVKRLQRQNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRTQPLH
>CP017927.1|AUK89671.1|1819651_1820854_-|aromatic-amino-acid-aminotransferase
MSTLFASVELAPRDPILGLNEQYNADTRPGKVNLGVGVYYDDEGRIPLLQAVRKAEVARIEAAAARGYLPIEGIAGYNKGAQALLLGADSPLAAEGRVLTAQALGGTGALKIGADFLRQLLPQSKVLISDPSWENHRALFERAGFPVETYAYYDAATHGLNFEAMLAALQAAPEQTIVVLHACCHNPTGVDPTPQQWEQIAAVVKARNLVPFLDIAYQGFGEGLEQDAAVVRMFAELDLTMFISSSFSKSFSLYGERVGALTVVAGSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMRKELVEKIKTQGVAQDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALNSRNIDAVAAGIAAVLK
>CP017927.1|AUK89672.1|1820931_1822968_+|excinuclease-ABC-subunit-B
MTAPGFVEFPDSPFHLYQPYPPAGDQPGAIDALTEGVSDGLMFQTLLGVTGSGKTYTMANMIARLGRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYYDYYQPEAYVPTRDLFIEKDSSINEHIEQMRLSATKSLLERRDTVIVGTVSCIYGIGNPGDYHAMVLILRTGDRISRREVLARLVAMQYTRNDADFTRGVFRVRCETIDIFPAESPELALRLTLFDDEIESLELFDPLTGRVRQKLPRFTVYPGSHYVTPRETVLRAIETIKEELRERLAQLIADGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGAAPGEPPPTLIDYLPADALMFIDESHVTIGQLGGMYRGDRSRKETLVQYGFRLPSALDNRPLRLEEFEARMRQCVFVSATPAAYEQEHADNVVEQVVRPTGLVDPIVEVRPAHTQVDDLLGEIHKRAALQERVLVTTLTKRMAEDLTDFLSEHGVRVRYLHSDIDTVERVEIIRDLRLGVFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGRAILYADRITDSMRRAIDETERRRAKQIQHNTDHGITARGVSKAVRELIDGVVAPAGHDALESAVPAEVLTDEKAMAREIRRLEKLMMDHARNLEFEQAAAARDALNALKSRLLLDGVGWSG
>CP017927.1|AUK89673.1|1823220_1823712_+|protein-tyrosine-phosphatase
MMTKVLFVCMGNICRSPSAEGVFRYLVNDAGMGDVVRVDSAGTHAFHIGEAPDARAQAAARKRGYDLTHCAARQVTADDFREFDLILAMDWDNLAALQQQCPKAYQHKLMLLMRFANEFEEATVPDPYYGGPEGFGKVLDYLEDACQGVLELVRKRATQYQAA
>CP017927.1|AUK89674.1|1823927_1824440_+|Fe-S-cluster-assembly-transcriptional-regulator-IscR
MRLTTKGRFAVTAMIDLAMRQHSGPVTLAAISQRQNISLSYLEQLFGKLRRHELVDSVRGPGGGYSLARLARNVTVADIIFAVDEPLDATSCGGKRDCTSGNDGKPGKCMTHELWTTLNRKMVDYLDSVSLQDLVDQQRVRQLQEAANQAQGCSAVRVNRSTPVAANATA
>CP017927.1|AUK89675.1|1824457_1825669_+|IscS-subfamily-cysteine-desulfurase
MSNRPIYLDYSATTPVDPSVVEKMIPWLYESFGNPASRSHAFGWEAEDAVEKAREEVAKLVNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHKAVLDTCRELERQGFEVTYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIAALGEICREKGIIFHVDAAQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGFRSGTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLTQIEEVYVNGSMEHRVPHNLNISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTLGRFTTEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQWAAH
>CP017927.1|AUK89676.1|1825706_1826117_+|Fe-S-cluster-assembly-scaffold-IscU
MAYSSKVLDHYENPRNVGSFDKGDDSVGTGMVGAPACGDVMKLQIKVNEAGVIEDARFKTYGCGSAIASSSLVTEWVKGKTLDEAMNIRNTQIAEELALPPVKIHCSILAEDAIKAAVQDYKTKHGAETPEAVAAN
>CP017927.1|AUK89677.1|1826118_1826442_+|iron-sulfur-cluster-assembly-protein-IscA
MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV
>CP017927.1|AUK89678.1|1826444_1826957_+|Fe-S-protein-assembly-co-chaperone-HscB
MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARANEAYRQLRDPMLRARYLCEQAGVDLQTESNTAMDPAFLMQQMEWREMLDDARRDPAAFAALRAELEQARLRMQQTLSELIDERGDYQQAGTKVREWMFVEKLAQELSAAQPMQ
>CP017927.1|AUK89679.1|1827086_1828949_+|Fe-S-protein-assembly-chaperone-HscA
MALLQISEPGDSPAPHQRKLAVGIDLGTTNSLVAAVRSSVPEVLADAQGQVLLPSAVRYLDGGAVRIGREALLEQARDPLNTIVSVKRFMGRSAADAAASGAPYEFVDAPGMVRLRTVQGDLSPVEVSAQILAVLRQRAEDVLGDDLVGAVITVPAYFDDAQRQATRDAARLAGLNVLRLLNEPTAAAIAYGLDQAAEGIYAVYDLGGGTFDISILRLTQGVFEVIATGGDTALGGDDFDSAIVAHACAGEDVAALPVADRRALLVAARAAREALTDQAQAPFEVTLRDGRAIQATLTRAQFEQLAEPLVGRTLDSARRALRDAGLAVGDVRGVVMVGGATRMPVVRQQVGALFGTEPLTNLDPDQVVALGAALQANLLAGNRALGEDWLLLDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDCRSLARFELRGIPPMVAGAARIRVTFQVDADGLLSVTAREQSTGVEAAVAVKPSYGLSDDEIARMLADSVTQADSDARARMLREQQVEARQLVESVGAALAADGDLLDPAERATVDQRLQAAAQAQSLDDVEAVRAAVQALSDATEEFAARRMDRSIRSALAGRKLDELA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP017927_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP017927_5

3430343-3430452

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP017927_5

>merge|CP017927|5|3430343-3430452|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP017927|5|5|3430343-3430452|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP017927.1\|AUK90962.1\|3428304_3429090_+\|enoyl-[acyl-carrier-protein]-reductase	unknown	unknown	gnl\|CDD\|180789
CP017927.1\|AUK90956.1\|3422139_3423660_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235866
CP017927.1\|AUK90957.1\|3423741_3424692_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP017927.1\|AUK90970.1\|3439841_3441605_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP017927.1\|AUK90967.1\|3435190_3435892_+\|two-component-system-response-regulator-OmpR	unknown	unknown	gnl\|CDD\|181883
CP017927.1\|AUK90964.1\|3430983_3431664_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP017927.1\|AUK90954.1\|3420914_3421793_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP017927.1\|AUK90972.1\|3442707_3443523_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP017927.1\|AUK90968.1\|3435891_3437316_+\|ATPase	unknown	unknown	gnl\|CDD\|236531
CP017927.1\|AUK90963.1\|3430453_3430846_-\|osmotically-inducible-protein-OsmC	unknown	unknown	gnl\|CDD\|224679
CP017927.1\|AUK90961.1\|3426800_3428210_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP017927.1\|AUK90953.1\|3417009_3419988_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP017927.1\|AUK90958.1\|3424688_3425156_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP017927.1\|AUK90955.1\|3421828_3422161_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235866
CP017927.1\|AUK90959.1\|3425198_3425969_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP017927.1\|AUK90965.1\|3431668_3432640_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP017927.1\|AUK90960.1\|3425989_3426790_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP017927.1\|AUK90969.1\|3438385_3439726_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP017927.1\|AUK90971.1\|3441716_3442595_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP017927.1\|AUK90966.1\|3432735_3433638_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
CP017927.1\|AUK90962.1\|3428304_3429090_+\|enoyl-[acyl-carrier-protein]-reductase	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP017927.1\|AUK90956.1\|3422139_3423660_+\|hypothetical-protein	gnl\|CDD\|235866	PRK06816, PRK06816, StlD/DarB family beta-ketosynthase.	1.80369e-130
CP017927.1\|AUK90957.1\|3423741_3424692_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP017927.1\|AUK90970.1\|3439841_3441605_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP017927.1\|AUK90967.1\|3435190_3435892_+\|two-component-system-response-regulator-OmpR	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP017927.1\|AUK90964.1\|3430983_3431664_+\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP017927.1\|AUK90954.1\|3420914_3421793_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP017927.1\|AUK90972.1\|3442707_3443523_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP017927.1\|AUK90968.1\|3435891_3437316_+\|ATPase	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP017927.1\|AUK90963.1\|3430453_3430846_-\|osmotically-inducible-protein-OsmC	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP017927.1\|AUK90961.1\|3426800_3428210_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP017927.1\|AUK90953.1\|3417009_3419988_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP017927.1\|AUK90958.1\|3424688_3425156_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP017927.1\|AUK90955.1\|3421828_3422161_+\|hypothetical-protein	gnl\|CDD\|235866	PRK06816, PRK06816, StlD/DarB family beta-ketosynthase.	8.20524e-38
CP017927.1\|AUK90959.1\|3425198_3425969_-\|SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP017927.1\|AUK90965.1\|3431668_3432640_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.71001e-129
CP017927.1\|AUK90960.1\|3425989_3426790_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP017927.1\|AUK90969.1\|3438385_3439726_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP017927.1\|AUK90971.1\|3441716_3442595_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP017927.1\|AUK90966.1\|3432735_3433638_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	4.1334e-23

>CP017927.1|AUK90962.1|3428304_3429090_+|enoyl-[acyl-carrier-protein]-reductase
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP017927.1|AUK90961.1|3426800_3428210_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP017927.1|AUK90960.1|3425989_3426790_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP017927.1|AUK90959.1|3425198_3425969_-|SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP017927.1|AUK90958.1|3424688_3425156_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP017927.1|AUK90957.1|3423741_3424692_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP017927.1|AUK90956.1|3422139_3423660_+|hypothetical-protein
MPGFANMIQGELSAAPLETLSVHGICAAGVGAIQAAAQGIELGAHRRALAVASELPSRLFKRSRFAAPGYDAHFLRWMLSDGAGAMLLGDASQPLAGAANGVRLRLKWIHQRSFSGDYPVCMQLGQSAGGQAHLDYGSWSEAEAAGALLLRQDILLLPHLFDIGIHEYAKLVHDGWVDPRQVSHFLCHYSSEKFIPVVEDLMDKAGLAIARERWFSNLAWRGNTGAASILIMLAEFLQTRTVQPGEQIFCYIPESGRFMAAYMLLQAEGPDETAQPARARAVPAAAPAGEADFIAPPHDPAHAPQGLEPLLGELAAIITKGSIFFRAWTLSVRLPAREALRIAWTRGAGAGWTHGPRHLAGSWELRRGALGKGAMPDHNTAQRRTPNAASRRQIHVRHRRRYRHGVRLHHRGRRLGRLRAGQSPVGRSIRACAVAGSRRRRFLALDPHPGRLPVLHRQPAHRLVLSHPGRSGSERAQPGLSARPRAGRQLPHQRHNLHARLAVKIQ
>CP017927.1|AUK90955.1|3421828_3422161_+|hypothetical-protein
MPVAFDRVYLHSAGYFMPGEPVDNDAMDQYIAPLNRISGRIKNRILAENGIRQRYYAIDPEGRTRWSNAQLAAQAIQACLARGATSTCHRSRCWPAARRAAIRSCPGSPT
>CP017927.1|AUK90954.1|3420914_3421793_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP017927.1|AUK90953.1|3417009_3419988_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP017927.1|AUK90963.1|3430453_3430846_-|osmotically-inducible-protein-OsmC
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP017927.1|AUK90964.1|3430983_3431664_+|hypothetical-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP017927.1|AUK90965.1|3431668_3432640_-|ABC-transporter-substrate-binding-protein
MKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP017927.1|AUK90966.1|3432735_3433638_-|IS481-family-transposase
MVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP017927.1|AUK90967.1|3435190_3435892_+|two-component-system-response-regulator-OmpR
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP017927.1|AUK90968.1|3435891_3437316_+|ATPase
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP017927.1|AUK90969.1|3438385_3439726_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP017927.1|AUK90970.1|3439841_3441605_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP017927.1|AUK90971.1|3441716_3442595_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP017927.1|AUK90972.1|3442707_3443523_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 64055

Natrialba_phage(12.5%)

transposase,tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88171.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AUK88172.1\|1916_2609_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
AUK88173.1\|2605_3403_+	chromosome partitioning protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AUK88174.1\|3409_4171_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK88175.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AUK88176.1\|5124_5910_+	L-asparaginase	NA	NA	NA	NA
AUK88177.1\|5943_6126_+	hypothetical protein	NA	NA	NA	NA
AUK88178.1\|6721_7912_+	translation elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AUK88179.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AUK88180.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AUK88181.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AUK88182.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AUK88183.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AUK88184.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AUK88185.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AUK88186.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AUK91540.1\|20126_20531_-	hypothetical protein	NA	NA	NA	NA
AUK88187.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AUK88188.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AUK91541.1\|26575_27286_+	hypothetical protein	NA	NA	NA	NA
AUK88189.1\|27282_28185_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88190.1\|28314_28614_-	hypothetical protein	NA	NA	NA	NA
AUK88191.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AUK88192.1\|29141_30359_-	thiolase	NA	NA	NA	NA
AUK88193.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AUK88194.1\|31069_32005_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK91542.1\|32214_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK88195.1\|33048_34470_+	2-methylcitrate dehydratase	NA	NA	NA	NA
AUK88196.1\|34673_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88197.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AUK88198.1\|37012_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AUK88199.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AUK88200.1\|40060_40600_+	D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AUK88201.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AUK88202.1\|41318_42212_+	hypothetical protein	NA	NA	NA	NA
AUK88203.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AUK88204.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AUK88205.1\|43346_43526_-	hypothetical protein	NA	NA	NA	NA
AUK88206.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91543.1\|45224_45749_+	hypothetical protein	NA	NA	NA	NA
AUK88207.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AUK88208.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AUK88209.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AUK88210.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AUK88211.1\|50189_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88212.1\|51134_52391_+	muropeptide transporter AmpG	NA	NA	NA	NA
AUK88213.1\|53622_54357_-	glutamate racemase	NA	NA	NA	NA
AUK88214.1\|54362_54953_-	arginine transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AUK88215.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AUK88216.1\|55663_56425_-	glutamate ABC transporter permease	NA	NA	NA	NA
AUK88217.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88218.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88219.1\|59248_60475_-	serine kinase HipA	NA	NA	NA	NA
AUK88220.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AUK91544.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AUK88221.1\|62442_63417_-	hypothetical protein	NA	NA	NA	NA
AUK88222.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA

DBSCAN-SWA_2

69085 : 122073

Planktothrix_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88228.1\|69085_70036_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88229.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AUK88230.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AUK88231.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AUK88232.1\|74357_74939_-	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AUK88233.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AUK88234.1\|75280_76123_-	hypothetical protein	NA	NA	NA	NA
AUK88235.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AUK88236.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91545.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88237.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AUK88238.1\|82822_83527_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
AUK88239.1\|83523_84630_-	glycosyl transferase	NA	NA	NA	NA
AUK88240.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AUK88241.1\|85481_86669_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AUK88242.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AUK88243.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AUK88244.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AUK88245.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AUK88246.1\|90793_91846_-	oxidoreductase	NA	NA	NA	NA
AUK88247.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AUK88248.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AUK88249.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AUK88250.1\|94468_95272_-	pantothenate kinase	NA	NA	NA	NA
AUK88251.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AUK88252.1\|96209_97340_+	ABC transporter permease	NA	NA	NA	NA
AUK88253.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AUK88254.1\|98332_98800_-	hypothetical protein	NA	NA	NA	NA
AUK88255.1\|98889_99111_+	hypothetical protein	NA	NA	NA	NA
AUK88256.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AUK88257.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AUK91546.1\|100607_101786_+	peptidase	B6DZZ7	Stx2-converting_phage	5.8e-66	40.5
AUK88258.1\|101866_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AUK88259.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AUK88260.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AUK88261.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AUK88262.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AUK88263.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AUK88264.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AUK88265.1\|107427_108330_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88266.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AUK88267.1\|110552_111182_-	thiol:disulfide interchange protein	NA	NA	NA	NA
AUK88268.1\|111243_111927_-	cell division protein	NA	NA	NA	NA
AUK88269.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AUK91547.1\|113906_114254_+	hypothetical protein	NA	NA	NA	NA
AUK88270.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AUK91548.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK88271.1\|116036_116837_-	ABC transporter permease	NA	NA	NA	NA
AUK88272.1\|116833_117709_-	ABC transporter permease	NA	NA	NA	NA
AUK88273.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88274.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AUK88275.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AUK88276.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

164893 : 301467

118

Klosneuvirus(10.53%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88313.1\|164893_165844_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88314.1\|167287_168190_-	hypothetical protein	NA	NA	NA	NA
AUK88315.1\|168167_168797_-	hypothetical protein	NA	NA	NA	NA
AUK88316.1\|169079_170510_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-44	29.8
AUK88317.1\|170543_171173_+	threonine transporter RhtB	NA	NA	NA	NA
AUK88318.1\|171221_172829_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AUK88319.1\|172865_173537_+	hypothetical protein	NA	NA	NA	NA
AUK91550.1\|173618_174095_-	bacterioferritin	NA	NA	NA	NA
AUK88320.1\|174349_175252_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88321.1\|176367_176895_+	hypothetical protein	NA	NA	NA	NA
AUK88322.1\|176986_177802_+	hypothetical protein	NA	NA	NA	NA
AUK88323.1\|177862_178597_+	sulfurtransferase	NA	NA	NA	NA
AUK88324.1\|178634_180713_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AUK88325.1\|180962_181235_-	hypothetical protein	NA	NA	NA	NA
AUK88326.1\|181336_182422_+	ATP-binding protein	NA	NA	NA	NA
AUK88327.1\|182425_184330_+	hypothetical protein	NA	NA	NA	NA
AUK88328.1\|184326_187965_+	hypothetical protein	NA	NA	NA	NA
AUK88329.1\|188025_188589_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AUK88330.1\|188596_189019_-	glyoxalase	NA	NA	NA	NA
AUK88331.1\|189046_189466_-	glyoxalase	NA	NA	NA	NA
AUK88332.1\|189494_189842_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK91551.1\|190115_190565_+	hypothetical protein	NA	NA	NA	NA
AUK88333.1\|190719_192990_+	lysine decarboxylase	NA	NA	NA	NA
AUK88334.1\|193065_194271_+	hypothetical protein	NA	NA	NA	NA
AUK88335.1\|194417_195320_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88336.1\|195422_196058_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-83	73.8
AUK88337.1\|196054_196948_+	ZIP family metal transporter	NA	NA	NA	NA
AUK88338.1\|197342_198443_+	glycine cleavage system protein T	NA	NA	NA	NA
AUK88339.1\|198524_198899_+	glycine cleavage system protein H	NA	NA	NA	NA
AUK88340.1\|198958_201823_+	glycine dehydrogenase (aminomethyl-transferring)	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AUK88341.1\|201967_202708_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88342.1\|202777_203989_+	formyl-CoA transferase	NA	NA	NA	NA
AUK88343.1\|204017_204986_+	hypothetical protein	NA	NA	NA	NA
AUK88344.1\|205647_206550_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88345.1\|206706_207030_+	PsiF repeat family protein	NA	NA	NA	NA
AUK91552.1\|207134_208175_-	cyclase	NA	NA	NA	NA
AUK88346.1\|208180_208960_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AUK88347.1\|209005_209302_-	hypothetical protein	NA	NA	NA	NA
AUK88348.1\|209327_209603_-	muconolactone delta-isomerase	NA	NA	NA	NA
AUK88349.1\|209659_210304_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AUK88350.1\|210303_210990_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AUK91553.1\|211188_211971_+	IclR family transcriptional regulator	NA	NA	NA	NA
AUK88351.1\|212021_212747_-	short-chain dehydrogenase	NA	NA	NA	NA
AUK88352.1\|212778_214128_-	short-chain fatty acid transporter	NA	NA	NA	NA
AUK88353.1\|214239_215172_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AUK88354.1\|215629_218425_-	peptidase S8	NA	NA	NA	NA
AUK88355.1\|219018_221862_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AUK88356.1\|222032_222752_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AUK88357.1\|222790_223339_-	GNAT family N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AUK88358.1\|223493_224393_+	virginiamycin B lyase	NA	NA	NA	NA
AUK88359.1\|224417_225368_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88360.1\|225586_226282_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88361.1\|226298_227711_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
AUK88362.1\|227823_229254_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AUK88363.1\|229295_231209_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
AUK88364.1\|231527_232094_+	preprotein translocase subunit SecD	NA	NA	NA	NA
AUK88365.1\|232184_233186_+	restriction endonuclease	NA	NA	NA	NA
AUK88366.1\|233300_234251_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88367.1\|234337_235288_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88368.1\|235284_236235_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88369.1\|236333_237131_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AUK88370.1\|238080_238491_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AUK88371.1\|238740_239496_+	gamma-hydroxybutyrate dehydrogenase	D2K0C8	Staphylococcus_phage	4.6e-32	55.0
AUK88372.1\|239512_240256_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88373.1\|240299_241343_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91554.1\|242356_243616_+	hypothetical protein	NA	NA	NA	NA
AUK88374.1\|245026_245983_+	hypothetical protein	NA	NA	NA	NA
AUK88375.1\|246001_246493_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AUK88376.1\|246489_247845_-	poly(A) polymerase	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AUK88377.1\|247845_248544_-	hypothetical protein	NA	NA	NA	NA
AUK88378.1\|248540_249242_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AUK88379.1\|249494_250544_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AUK88380.1\|250649_251591_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AUK88381.1\|251587_253477_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AUK91555.1\|253581_254202_+	hypothetical protein	NA	NA	NA	NA
AUK88382.1\|254344_255730_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.3
AUK88383.1\|255660_256197_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AUK88384.1\|256348_257740_+	fumarate hydratase, class II	NA	NA	NA	NA
AUK88385.1\|257756_258737_-	hypothetical protein	NA	NA	NA	NA
AUK88386.1\|258872_259856_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88387.1\|259920_260820_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88388.1\|260926_262681_+	gamma-glutamyltransferase	NA	NA	NA	NA
AUK88389.1\|262688_263813_-	carnitine dehydratase	NA	NA	NA	NA
AUK88390.1\|263826_264807_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88391.1\|265537_266488_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88392.1\|266502_266874_+	hypothetical protein	NA	NA	NA	NA
AUK88393.1\|267047_267593_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AUK88394.1\|267718_269296_+	cytochrome d terminal oxidase subunit 1	NA	NA	NA	NA
AUK88395.1\|269311_270466_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AUK88396.1\|270479_270605_+	cyd operon protein YbgT	NA	NA	NA	NA
AUK88397.1\|270601_272353_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AUK88398.1\|272349_274029_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AUK88399.1\|274091_274640_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	43.1
AUK88400.1\|275782_276061_+	hypothetical protein	NA	NA	NA	NA
AUK88401.1\|277104_278055_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88402.1\|278332_278494_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AUK88403.1\|278501_278642_+	hypothetical protein	NA	NA	NA	NA
AUK88404.1\|279160_279610_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AUK88405.1\|279619_280231_-	glutathione S-transferase	NA	NA	NA	NA
AUK88406.1\|280389_281238_-	cytochrome c1	NA	NA	NA	NA
AUK88407.1\|281263_282646_-	cytochrome b	NA	NA	NA	NA
AUK88408.1\|282710_283352_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AUK88409.1\|283491_283950_+	large-conductance mechanosensitive channel protein	NA	NA	NA	NA
AUK88410.1\|283974_284751_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AUK91556.1\|284804_285941_+	2-alkenal reductase	W5SAB9	Pithovirus	1.2e-07	31.2
AUK88411.1\|285937_286888_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88412.1\|286986_287613_-	hypothetical protein	NA	NA	NA	NA
AUK88413.1\|287635_288562_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AUK88414.1\|288570_290157_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88415.1\|290153_291158_-	acetylesterase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
AUK88416.1\|291357_292218_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUK88417.1\|292249_293251_-	hypothetical protein	NA	NA	NA	NA
AUK88418.1\|293321_294131_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUK88419.1\|294208_296068_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AUK88420.1\|296196_297399_-	MFS transporter	NA	NA	NA	NA
AUK88421.1\|297512_298394_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88422.1\|299896_300457_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
AUK88423.1\|300516_301467_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

390821 : 448330

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88510.1\|390821_391772_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88511.1\|391914_392826_+	reductase	NA	NA	NA	NA
AUK88512.1\|392822_393071_+	NrdH-redoxin	NA	NA	NA	NA
AUK88513.1\|393067_394273_+	CoA transferase	NA	NA	NA	NA
AUK88514.1\|394345_395341_-	hypothetical protein	NA	NA	NA	NA
AUK88515.1\|395363_396584_-	acyl-CoA transferase	NA	NA	NA	NA
AUK88516.1\|396580_397225_-	hypothetical protein	NA	NA	NA	NA
AUK88517.1\|397221_397614_-	hypothetical protein	NA	NA	NA	NA
AUK88518.1\|397502_398855_-	hypothetical protein	NA	NA	NA	NA
AUK88519.1\|398955_399765_-	IclR family transcriptional regulator	NA	NA	NA	NA
AUK91562.1\|400069_401023_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.6e-59	42.5
AUK88520.1\|401121_402105_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88521.1\|402781_403552_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK88522.1\|403548_404727_-	carnitine dehydratase	NA	NA	NA	NA
AUK88523.1\|404894_406601_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AUK88524.1\|406597_407494_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88525.1\|407534_409124_-	sulfurtransferase	NA	NA	NA	NA
AUK88526.1\|409173_410166_-	hypothetical protein	NA	NA	NA	NA
AUK88527.1\|410234_410834_-	hypothetical protein	NA	NA	NA	NA
AUK88528.1\|411294_412275_-	hypothetical protein	NA	NA	NA	NA
AUK88529.1\|412350_413253_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88530.1\|413389_414304_+	EamA family transporter	NA	NA	NA	NA
AUK88531.1\|414300_414960_+	hypothetical protein	NA	NA	NA	NA
AUK88532.1\|415049_415973_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AUK88533.1\|415978_416434_-	hypothetical protein	NA	NA	NA	NA
AUK88534.1\|416430_417534_-	hypothetical protein	NA	NA	NA	NA
AUK88535.1\|417721_419341_-	dolichyl-phosphate-mannose--protein mannosyltransferase	NA	NA	NA	NA
AUK88536.1\|419337_420396_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AUK88537.1\|420525_421020_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK88538.1\|421112_422090_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88539.1\|422285_423491_+	sodium/glutamate symporter	NA	NA	NA	NA
AUK88540.1\|423487_424999_+	TRAP ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91563.1\|425014_426328_-	short-chain fatty acid transporter	NA	NA	NA	NA
AUK88541.1\|426518_426698_-	hypothetical protein	NA	NA	NA	NA
AUK88542.1\|427107_427842_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AUK88543.1\|430334_431237_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88544.1\|431368_431767_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AUK88545.1\|432177_432648_-	universal stress protein	NA	NA	NA	NA
AUK88546.1\|432736_433081_-	TIGR01244 family protein	NA	NA	NA	NA
AUK88547.1\|433180_434581_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88548.1\|436369_436888_-	methyltransferase	G3MA03	Bacillus_virus	2.1e-12	38.9
AUK88549.1\|436998_437754_+	hypothetical protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AUK88550.1\|437949_439182_+	CoA transferase	NA	NA	NA	NA
AUK88551.1\|439174_439960_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK88552.1\|440026_440998_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88553.1\|441008_441986_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88554.1\|442111_443284_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK88555.1\|443310_444339_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK88556.1\|444404_445598_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AUK88557.1\|447379_448330_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

635707 : 735820

107

uncultured_Caudovirales_phage(13.79%)

transposase,tRNA,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88721.1\|635707_636658_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88722.1\|636756_637557_-	hypothetical protein	NA	NA	NA	NA
AUK88723.1\|637618_638002_+	thiol reductase thioredoxin	NA	NA	NA	NA
AUK88724.1\|638013_639447_-	ATP-dependent RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AUK88725.1\|639653_639983_-	hypothetical protein	NA	NA	NA	NA
AUK88726.1\|639985_640735_-	hypothetical protein	NA	NA	NA	NA
AUK88727.1\|640917_641838_+	branched chain amino acid aminotransferase	NA	NA	NA	NA
AUK88728.1\|641884_642097_+	hypothetical protein	NA	NA	NA	NA
AUK88729.1\|642119_642542_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AUK88730.1\|642558_643659_+	alpha/beta hydrolase	NA	NA	NA	NA
AUK88731.1\|643755_645273_-	peptidase	NA	NA	NA	NA
AUK88732.1\|645348_646188_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AUK91572.1\|646209_647082_-	hypothetical protein	NA	NA	NA	NA
AUK88733.1\|647172_648267_-	porin	NA	NA	NA	NA
AUK88734.1\|648560_649463_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91573.1\|649585_650527_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88735.1\|650610_650970_-	hypothetical protein	NA	NA	NA	NA
AUK88736.1\|651351_652389_-	hypothetical protein	NA	NA	NA	NA
AUK88737.1\|652705_654046_+	Xaa-Pro aminopeptidase	NA	NA	NA	NA
AUK88738.1\|654055_654508_-	hypothetical protein	NA	NA	NA	NA
AUK88739.1\|654613_655786_+	monooxygenase	NA	NA	NA	NA
AUK88740.1\|655851_656877_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AUK88741.1\|656917_657157_+	Fis family transcriptional regulator	NA	NA	NA	NA
AUK88742.1\|657226_658816_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AUK88743.1\|658815_659364_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AUK88744.1\|659444_660017_+	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
AUK88745.1\|660035_660947_-	NAD-dependent dehydratase	NA	NA	NA	NA
AUK88746.1\|661020_661989_-	serine dehydratase	NA	NA	NA	NA
AUK88747.1\|662111_663185_+	Holliday junction DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AUK88748.1\|663189_665010_-	ATP-dependent DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AUK88749.1\|666124_666460_+	hypothetical protein	NA	NA	NA	NA
AUK88750.1\|666593_667244_+	carbonate dehydratase	NA	NA	NA	NA
AUK88751.1\|667265_668684_-	amidase	NA	NA	NA	NA
AUK88752.1\|668753_669509_-	hypothetical protein	NA	NA	NA	NA
AUK91574.1\|669477_670236_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUK88753.1\|670246_671128_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUK88754.1\|671144_671852_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AUK88755.1\|671854_672613_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AUK88756.1\|672822_674565_+	sulfite reductase	NA	NA	NA	NA
AUK88757.1\|674557_675082_+	hypothetical protein	NA	NA	NA	NA
AUK88758.1\|675121_675916_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88759.1\|676083_677157_+	hypothetical protein	NA	NA	NA	NA
AUK88760.1\|677255_678206_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88761.1\|678457_678664_-	hypothetical protein	NA	NA	NA	NA
AUK91575.1\|678735_679347_-	LexA family transcriptional repressor	NA	NA	NA	NA
AUK88762.1\|679826_680147_-	hypothetical protein	NA	NA	NA	NA
AUK88763.1\|680139_680838_-	hypothetical protein	NA	NA	NA	NA
AUK88764.1\|680852_681074_-	hypothetical protein	NA	NA	NA	NA
AUK88765.1\|681091_682042_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88766.1\|682682_683168_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	7.3e-39	61.5
AUK88767.1\|683154_684432_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AUK88768.1\|684434_685853_+	hypothetical protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AUK88769.1\|685824_686937_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.1e-102	49.7
AUK88770.1\|686942_687185_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AUK88771.1\|687307_687910_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AUK88772.1\|688338_689289_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88773.1\|689963_690215_+	hypothetical protein	NA	NA	NA	NA
AUK88774.1\|690277_690760_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AUK88775.1\|690761_690962_+	hypothetical protein	NA	NA	NA	NA
AUK88776.1\|690961_691357_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AUK88777.1\|691353_691752_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AUK88778.1\|691748_692171_+	hypothetical protein	NA	NA	NA	NA
AUK88779.1\|692178_692679_+	hypothetical protein	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AUK88780.1\|692933_693452_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AUK88781.1\|693461_693791_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AUK88782.1\|693808_694099_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AUK88783.1\|694124_696737_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AUK88784.1\|696746_697106_+	hypothetical protein	NA	NA	NA	NA
AUK88785.1\|697173_697707_+	hypothetical protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AUK88786.1\|697703_698093_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AUK88787.1\|698085_702042_+	hypothetical protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AUK88788.1\|702046_702463_+	hypothetical protein	NA	NA	NA	NA
AUK88789.1\|702681_702945_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AUK88790.1\|702944_703757_+	hypothetical protein	NA	NA	NA	NA
AUK88791.1\|703761_704004_+	hypothetical protein	NA	NA	NA	NA
AUK88792.1\|703982_704534_+	lysozyme	NA	NA	NA	NA
AUK88793.1\|704533_705049_+	hypothetical protein	NA	NA	NA	NA
AUK88794.1\|705045_705327_-	hypothetical protein	NA	NA	NA	NA
AUK88795.1\|705326_705548_-	hypothetical protein	NA	NA	NA	NA
AUK88796.1\|705876_706548_-	hypothetical protein	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AUK88797.1\|706475_706844_-	hypothetical protein	NA	NA	NA	NA
AUK88798.1\|706903_707590_-	DNA-binding response regulator	NA	NA	NA	NA
AUK88799.1\|707570_708143_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AUK88800.1\|708208_709939_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AUK88801.1\|709991_710420_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AUK88802.1\|710422_711103_+	protein TolQ	NA	NA	NA	NA
AUK88803.1\|711102_711561_+	protein TolR	NA	NA	NA	NA
AUK88804.1\|711597_712572_+	protein TolA	NA	NA	NA	NA
AUK88805.1\|712588_713905_+	Tol-Pal system beta propeller repeat protein TolB	NA	NA	NA	NA
AUK88806.1\|713936_714434_+	peptidoglycan-associated lipoprotein	NA	NA	NA	NA
AUK88807.1\|714520_715210_+	tol-pal system protein YbgF	NA	NA	NA	NA
AUK88808.1\|715209_716259_+	iron-siderophore ABC transporter permease	NA	NA	NA	NA
AUK88809.1\|716255_717050_+	iron ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AUK88810.1\|717218_717569_+	hypothetical protein	NA	NA	NA	NA
AUK88811.1\|717544_718102_+	hypothetical protein	NA	NA	NA	NA
AUK88812.1\|719231_720182_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88813.1\|722319_723549_+	hypothetical protein	NA	NA	NA	NA
AUK88814.1\|723551_724994_-	pyruvate kinase	NA	NA	NA	NA
AUK88815.1\|725098_726244_+	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
AUK88816.1\|726275_727073_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase	NA	NA	NA	NA
AUK88817.1\|727097_728657_-	molecular chaperone SurA	NA	NA	NA	NA
AUK88818.1\|728653_731020_-	LPS biosynthesis protein	NA	NA	NA	NA
AUK91576.1\|731198_732239_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AUK88819.1\|732238_732931_+	mannose-1-phosphate guanylyltransferase	NA	NA	NA	NA
AUK88820.1\|733074_733776_+	hypothetical protein	NA	NA	NA	NA
AUK88821.1\|733760_734138_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
AUK88822.1\|734869_735820_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

747107 : 820221

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88833.1\|747107_748058_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88834.1\|748712_749810_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AUK88835.1\|749843_751109_+	saccharopine dehydrogenase	NA	NA	NA	NA
AUK88836.1\|751314_752217_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88837.1\|752258_752414_+	hypothetical protein	NA	NA	NA	NA
AUK88838.1\|752460_753051_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AUK91577.1\|753066_755511_-	ligand-gated channel	NA	NA	NA	NA
AUK88839.1\|755630_756602_-	hypothetical protein	NA	NA	NA	NA
AUK88840.1\|756733_757258_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AUK88841.1\|757217_758168_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88842.1\|758389_760585_-	DNA methylase	NA	NA	NA	NA
AUK91578.1\|760657_761005_-	transcriptional regulator	NA	NA	NA	NA
AUK88843.1\|761187_762138_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88844.1\|762253_762676_-	transcriptional regulator	NA	NA	NA	NA
AUK88845.1\|762759_763554_+	transcriptional regulator	NA	NA	NA	NA
AUK88846.1\|763719_764856_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.8e-63	44.8
AUK88847.1\|764926_766060_-	GTPase ObgE	NA	NA	NA	NA
AUK88848.1\|766209_766470_-	50S ribosomal protein L27	NA	NA	NA	NA
AUK88849.1\|766503_766815_-	50S ribosomal protein L21	NA	NA	NA	NA
AUK88850.1\|767239_768388_+	fumarylacetoacetate hydrolase	NA	NA	NA	NA
AUK88851.1\|768502_769468_+	octaprenyl diphosphate synthase	NA	NA	NA	NA
AUK88852.1\|769736_770603_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88853.1\|770733_772782_+	hydantoinase	NA	NA	NA	NA
AUK88854.1\|772799_774797_+	hydantoin utilization protein B	NA	NA	NA	NA
AUK88855.1\|774831_776169_+	amino acid deaminase	NA	NA	NA	NA
AUK88856.1\|778339_779821_+	succinate-semialdehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
AUK88857.1\|779836_780394_-	cyclolysin-activating lysine-acyltransferase CyaC	NA	NA	NA	NA
AUK91579.1\|780506_780686_+	hypothetical protein	NA	NA	NA	NA
AUK88858.1\|780770_785993_+	hemolysin	NA	NA	NA	NA
AUK88859.1\|786070_788209_+	peptidase C39	W8CYL7	Bacillus_phage	2.7e-45	29.2
AUK88860.1\|788205_789528_+	hemolysin D	NA	NA	NA	NA
AUK88861.1\|789529_790954_+	CyaE	NA	NA	NA	NA
AUK88862.1\|791044_791953_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88863.1\|792017_792932_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88864.1\|793338_793572_-	hypothetical protein	NA	NA	NA	NA
AUK88865.1\|793769_794453_+	amino acid ABC transporter permease	NA	NA	NA	NA
AUK88866.1\|794484_795213_+	arginine transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	3.4e-32	42.4
AUK88867.1\|795242_796103_+	D-amino acid aminotransferase	NA	NA	NA	NA
AUK88868.1\|796110_796677_-	hypothetical protein	NA	NA	NA	NA
AUK88869.1\|796765_797722_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88870.1\|797766_798519_-	3-ketoacyl-ACP reductase	NA	NA	NA	NA
AUK88871.1\|798515_800261_-	acetolactate synthase catalytic subunit	NA	NA	NA	NA
AUK88872.1\|800345_801080_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88873.1\|801396_802419_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AUK91580.1\|802434_803070_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK88874.1\|803301_804309_-	zinc-binding dehydrogenase	NA	NA	NA	NA
AUK88875.1\|804349_805882_-	acetyl-CoA synthetase	NA	NA	NA	NA
AUK88876.1\|805878_806997_-	deacylase	NA	NA	NA	NA
AUK88877.1\|806993_807776_-	ABC transporter permease	NA	NA	NA	NA
AUK88878.1\|807787_808651_-	ABC transporter	G3M9Y6	Bacillus_virus	9.6e-34	38.9
AUK91581.1\|808669_809767_-	hypothetical protein	NA	NA	NA	NA
AUK88879.1\|809835_810762_-	hypothetical protein	NA	NA	NA	NA
AUK88880.1\|810796_812491_-	acetolactate synthase	NA	NA	NA	NA
AUK91582.1\|812690_813584_-	mechanosensitive ion channel protein	NA	NA	NA	NA
AUK88881.1\|813731_814682_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88882.1\|814780_815437_-	hypothetical protein	NA	NA	NA	NA
AUK88883.1\|815584_818293_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.8e-15	24.0
AUK88884.1\|818302_819322_+	fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-49	35.7
AUK88885.1\|819318_820221_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

858712 : 912843

Vibrio_phage(25.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88918.1\|858712_860671_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AUK88919.1\|860753_861704_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88920.1\|861924_862593_+	transcriptional regulator	NA	NA	NA	NA
AUK88921.1\|862716_863823_+	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AUK88922.1\|863835_866949_+	multidrug efflux protein	S5VTK5	Leptospira_phage	4.5e-57	21.5
AUK88923.1\|866945_868439_+	RND transporter	NA	NA	NA	NA
AUK88924.1\|868453_869125_+	MarR family transcriptional regulator	NA	NA	NA	NA
AUK91586.1\|869168_869621_-	azurin	NA	NA	NA	NA
AUK88925.1\|869803_870451_-	IclR family transcriptional regulator	NA	NA	NA	NA
AUK91587.1\|870554_872603_+	hydantoinase	NA	NA	NA	NA
AUK88926.1\|872599_874612_+	hydantoin utilization protein B	NA	NA	NA	NA
AUK88927.1\|874637_875972_+	hypothetical protein	NA	NA	NA	NA
AUK88928.1\|876080_877073_+	hypothetical protein	NA	NA	NA	NA
AUK88929.1\|877139_879224_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AUK88930.1\|879248_880220_-	hypothetical protein	NA	NA	NA	NA
AUK88931.1\|880348_881350_-	peptidase M14	NA	NA	NA	NA
AUK88932.1\|881383_882535_-	cystathionine beta-lyase	NA	NA	NA	NA
AUK88933.1\|882738_883629_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK88934.1\|883706_884531_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AUK91588.1\|884727_885744_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK88935.1\|885940_886924_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK88936.1\|886982_888110_-	argininosuccinate lyase	NA	NA	NA	NA
AUK88937.1\|888100_888475_-	hypothetical protein	NA	NA	NA	NA
AUK88938.1\|888522_889911_-	hypothetical protein	NA	NA	NA	NA
AUK88939.1\|889941_890931_-	hypothetical protein	NA	NA	NA	NA
AUK88940.1\|891041_892274_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AUK88941.1\|892555_893356_+	IclR family transcriptional regulator	NA	NA	NA	NA
AUK88942.1\|893378_895610_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AUK88943.1\|896397_896844_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AUK88944.1\|896865_897612_-	triose-phosphate isomerase	NA	NA	NA	NA
AUK88945.1\|897755_898733_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AUK88946.1\|899366_899978_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AUK88947.1\|899971_901189_-	threonine ammonia-lyase	NA	NA	NA	NA
AUK88948.1\|901329_902280_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88949.1\|902276_902996_-	hypothetical protein	NA	NA	NA	NA
AUK88950.1\|903116_905276_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
AUK88951.1\|905366_905636_-	30S ribosomal protein S15	NA	NA	NA	NA
AUK91589.1\|905929_906457_+	hypothetical protein	NA	NA	NA	NA
AUK88952.1\|906475_907255_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
AUK88953.1\|907422_908439_-	ketol-acid reductoisomerase	NA	NA	NA	NA
AUK88954.1\|908511_909003_-	acetolactate synthase small subunit	NA	NA	NA	NA
AUK88955.1\|909013_910729_-	acetolactate synthase, large subunit, biosynthetic type	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	3.1e-60	30.3
AUK88956.1\|911199_911811_+	hypothetical protein	NA	NA	NA	NA
AUK88957.1\|911892_912843_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

937342 : 999491

Bacillus_virus(15.38%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK88979.1\|937342_938245_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88980.1\|938241_938625_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
AUK88981.1\|938679_940494_-	metal ABC transporter permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AUK91590.1\|940643_941471_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AUK88982.1\|941516_942497_+	alcohol dehydrogenase	NA	NA	NA	NA
AUK88983.1\|942493_942706_-	hypothetical protein	NA	NA	NA	NA
AUK88984.1\|942702_943884_-	hypothetical protein	NA	NA	NA	NA
AUK88985.1\|944047_944782_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AUK88986.1\|944783_947396_-	penicillin-binding protein	NA	NA	NA	NA
AUK88987.1\|947531_949445_-	S9 family peptidase	NA	NA	NA	NA
AUK88988.1\|950060_950471_-	phenylacetic acid degradation protein	NA	NA	NA	NA
AUK88989.1\|950568_951654_+	DNA polymerase IV	NA	NA	NA	NA
AUK88990.1\|951752_952703_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88991.1\|952699_953674_-	hypothetical protein	NA	NA	NA	NA
AUK88992.1\|953819_954710_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-05	27.6
AUK91591.1\|954986_955379_-	hypothetical protein	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AUK88993.1\|955508_956459_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK88994.1\|956488_956671_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AUK88995.1\|957443_958625_-	MFS transporter	NA	NA	NA	NA
AUK88996.1\|958840_959518_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AUK88997.1\|959514_960240_-	bifunctional 3-demethylubiquinol 3-O-methyltransferase/2-polyprenyl-6-hydroxyphenol methylase	NA	NA	NA	NA
AUK88998.1\|960365_960947_-	hypothetical protein	NA	NA	NA	NA
AUK88999.1\|961317_963999_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AUK91592.1\|964001_965132_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	4.9e-78	44.0
AUK89000.1\|965124_966210_+	chorismate mutase	NA	NA	NA	NA
AUK89001.1\|966296_967196_+	prephenate dehydrogenase	NA	NA	NA	NA
AUK89002.1\|967192_968521_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AUK89003.1\|968535_969207_+	cytidylate kinase	NA	NA	NA	NA
AUK89004.1\|969394_971110_+	30S ribosomal protein S1	NA	NA	NA	NA
AUK89005.1\|971111_971471_+	integration host factor subunit beta	NA	NA	NA	NA
AUK89006.1\|971662_971977_+	hypothetical protein	NA	NA	NA	NA
AUK89007.1\|972019_973240_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AUK89008.1\|973236_974178_+	hypothetical protein	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AUK89009.1\|974174_975164_+	ADP-glyceromanno-heptose 6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AUK91593.1\|975453_975783_+	hypothetical protein	NA	NA	NA	NA
AUK89010.1\|975881_976832_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89011.1\|976912_977824_+	cysteine synthase B	A0A1X9I5K7	Streptococcus_phage	8.0e-47	38.8
AUK89012.1\|977884_979030_-	lytic murein transglycosylase B	NA	NA	NA	NA
AUK89013.1\|979049_979964_+	deacetylase	A0A2K9KZC4	Tupanvirus	9.8e-45	34.7
AUK89014.1\|980035_980785_+	electron transporter RnfB	NA	NA	NA	NA
AUK89015.1\|980784_981714_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
AUK89016.1\|981957_983784_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK89017.1\|983866_984508_+	peroxidase	NA	NA	NA	NA
AUK89018.1\|984697_985732_+	sulfate transporter subunit	NA	NA	NA	NA
AUK89019.1\|985747_985951_+	hypothetical protein	NA	NA	NA	NA
AUK89020.1\|985972_986647_+	sulfate ABC transporter permease subunit CysT	NA	NA	NA	NA
AUK89021.1\|986761_987544_+	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
AUK89022.1\|987568_988633_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-24	30.3
AUK91594.1\|989430_990339_+	sulfate adenylyltransferase small subunit	NA	NA	NA	NA
AUK89023.1\|991826_993101_+	radical SAM protein	NA	NA	NA	NA
AUK89024.1\|993254_993635_+	hypothetical protein	NA	NA	NA	NA
AUK89025.1\|993642_994515_-	multidrug DMT transporter permease	NA	NA	NA	NA
AUK89026.1\|994820_995201_+	50S ribosomal protein L19	NA	NA	NA	NA
AUK89027.1\|995450_996137_+	coenzyme A pyrophosphatase	NA	NA	NA	NA
AUK89028.1\|996232_997183_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89029.1\|997287_998337_+	aldo/keto reductase	NA	NA	NA	NA
AUK91595.1\|998474_999491_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1023295 : 1081380

uncultured_Mediterranean_phage(37.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89044.1\|1023295_1024198_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89045.1\|1024344_1025085_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AUK89046.1\|1025279_1027316_+	transketolase	NA	NA	NA	NA
AUK89047.1\|1027333_1028344_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AUK89048.1\|1028461_1029655_+	phosphoglycerate kinase	NA	NA	NA	NA
AUK89049.1\|1029684_1030458_-	enoyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AUK89050.1\|1030454_1031645_-	acetate kinase	NA	NA	NA	NA
AUK89051.1\|1031670_1032609_-	phosphate acetyltransferase	NA	NA	NA	NA
AUK91597.1\|1032605_1034954_-	3-hydroxyalkanoate synthetase	NA	NA	NA	NA
AUK89052.1\|1035108_1035750_-	glutathione S-transferase	NA	NA	NA	NA
AUK89053.1\|1037263_1037812_-	damage-inducible protein DinB	NA	NA	NA	NA
AUK89054.1\|1037830_1038316_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK89055.1\|1038493_1039432_+	cytochrome C biogenesis protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AUK89056.1\|1039434_1039752_+	MerR family transcriptional regulator	NA	NA	NA	NA
AUK89057.1\|1039797_1040742_+	hypothetical protein	NA	NA	NA	NA
AUK89058.1\|1042422_1043073_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AUK89059.1\|1043126_1043462_+	hypothetical protein	NA	NA	NA	NA
AUK91598.1\|1043476_1044319_+	peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AUK89060.1\|1044335_1044617_-	hypothetical protein	NA	NA	NA	NA
AUK89061.1\|1044690_1044954_-	translation initiation factor IF-1	NA	NA	NA	NA
AUK89062.1\|1045197_1046148_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89063.1\|1046446_1047184_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AUK89064.1\|1047619_1047943_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AUK89065.1\|1047977_1048538_+	transcriptional regulator FlhC	NA	NA	NA	NA
AUK89066.1\|1048658_1049534_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AUK89067.1\|1049546_1050494_+	flagellar motor protein MotB	NA	NA	NA	NA
AUK89068.1\|1050595_1050889_+	two-component system response regulator	NA	NA	NA	NA
AUK89069.1\|1050915_1052973_+	chemotaxis protein CheA	NA	NA	NA	NA
AUK89070.1\|1052987_1053488_+	chemotaxis protein CheW	NA	NA	NA	NA
AUK89071.1\|1053561_1055268_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AUK89072.1\|1056131_1057184_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AUK89073.1\|1057236_1057626_+	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AUK89074.1\|1057634_1058267_+	protein phosphatase CheZ	NA	NA	NA	NA
AUK91599.1\|1058366_1059383_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK91600.1\|1060213_1061221_+	aldo/keto reductase	NA	NA	NA	NA
AUK89075.1\|1061217_1062861_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AUK89076.1\|1062857_1063745_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AUK89077.1\|1063885_1064359_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
AUK89078.1\|1064348_1065371_-	phosphate starvation-inducible protein PhoH	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AUK89079.1\|1065367_1066795_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AUK91601.1\|1067732_1068749_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK89080.1\|1069081_1070017_-	protein-export membrane protein SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AUK89081.1\|1070066_1071947_-	protein-export membrane protein SecD	NA	NA	NA	NA
AUK89082.1\|1072013_1072358_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AUK89083.1\|1072502_1073639_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AUK89084.1\|1073635_1074709_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AUK89085.1\|1074866_1076303_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AUK91602.1\|1076393_1077035_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AUK91603.1\|1077370_1078387_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK91604.1\|1080429_1081380_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1156496 : 1218667

Erysipelothrix_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89139.1\|1156496_1157399_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89140.1\|1157545_1158169_-	fimbrial protein	NA	NA	NA	NA
AUK89141.1\|1158342_1160625_-	NADP-dependent malic enzyme	NA	NA	NA	NA
AUK89142.1\|1160779_1163476_-	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AUK89143.1\|1163601_1164090_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AUK89144.1\|1164125_1165988_+	oligopeptide transporter, OPT family	NA	NA	NA	NA
AUK89145.1\|1165966_1166176_+	hypothetical protein	NA	NA	NA	NA
AUK89146.1\|1166500_1169371_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
AUK89147.1\|1169416_1170631_+	dihydrolipoamide succinyltransferase	NA	NA	NA	NA
AUK89148.1\|1170860_1172288_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-41	28.1
AUK89149.1\|1172385_1173477_+	cell division protein ZapE	NA	NA	NA	NA
AUK89150.1\|1173489_1174248_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AUK89151.1\|1174335_1175238_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89152.1\|1175234_1176185_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89153.1\|1176314_1177298_-	LacI family transcriptional regulator	NA	NA	NA	NA
AUK89154.1\|1177352_1178075_-	short-chain dehydrogenase	NA	NA	NA	NA
AUK89155.1\|1179553_1180909_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AUK89156.1\|1180989_1183365_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
AUK89157.1\|1183529_1185605_+	helicase	A0A127AW80	Bacillus_phage	2.4e-75	30.0
AUK91610.1\|1185666_1186461_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
AUK89158.1\|1186568_1187531_+	RNA pseudouridine synthase	NA	NA	NA	NA
AUK89159.1\|1187518_1188274_+	hypothetical protein	NA	NA	NA	NA
AUK89160.1\|1188381_1190019_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
AUK89161.1\|1190086_1190824_+	beta-ketoacyl-ACP reductase	NA	NA	NA	NA
AUK89162.1\|1190926_1191502_+	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
AUK89163.1\|1191674_1192211_+	hypothetical protein	NA	NA	NA	NA
AUK91611.1\|1192243_1192558_+	periplasmic lipoprotein involved in iron transport	NA	NA	NA	NA
AUK89164.1\|1192573_1193419_+	FTR1 family iron permease	NA	NA	NA	NA
AUK89165.1\|1193457_1194837_+	hypothetical protein	NA	NA	NA	NA
AUK89166.1\|1194914_1195796_+	phenazine biosynthesis protein PhzC/PhzF	NA	NA	NA	NA
AUK89167.1\|1195942_1196845_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89168.1\|1196841_1197252_-	lactoylglutathione lyase	NA	NA	NA	NA
AUK89169.1\|1197359_1198214_-	2-pyrone-4,6-dicarboxylate hydrolase	NA	NA	NA	NA
AUK89170.1\|1198206_1199169_-	hypothetical protein	NA	NA	NA	NA
AUK89171.1\|1199214_1200339_-	racemase	Q6A202	Oenococcus_phage	1.5e-31	28.3
AUK89172.1\|1200444_1201323_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89173.1\|1201447_1202227_+	short-chain dehydrogenase	NA	NA	NA	NA
AUK89174.1\|1202380_1203802_+	MFS transporter	NA	NA	NA	NA
AUK89175.1\|1204236_1205934_+	sodium:proline symporter	NA	NA	NA	NA
AUK89176.1\|1205962_1206085_+	hypothetical protein	NA	NA	NA	NA
AUK91612.1\|1206160_1207102_-	LD-carboxypeptidase	NA	NA	NA	NA
AUK89177.1\|1207428_1208175_+	hypothetical protein	NA	NA	NA	NA
AUK89178.1\|1208182_1209109_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89179.1\|1209230_1210148_+	oxidoreductase	NA	NA	NA	NA
AUK89180.1\|1210187_1211141_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89181.1\|1211165_1211744_+	hypothetical protein	NA	NA	NA	NA
AUK89182.1\|1213417_1214026_+	hypothetical protein	NA	NA	NA	NA
AUK89183.1\|1214103_1214457_-	hypothetical protein	NA	NA	NA	NA
AUK91613.1\|1214540_1215473_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AUK89184.1\|1215780_1216683_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89185.1\|1216769_1217720_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89186.1\|1217716_1218667_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1291630 : 1328396

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89238.1\|1291630_1292581_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89239.1\|1292560_1293142_-	hypothetical protein	NA	NA	NA	NA
AUK89240.1\|1293202_1294930_-	sodium-independent anion transporter	NA	NA	NA	NA
AUK89241.1\|1295041_1296400_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AUK89242.1\|1296692_1297643_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89243.1\|1297683_1298754_+	hypothetical protein	NA	NA	NA	NA
AUK89244.1\|1298776_1299655_-	hypothetical protein	NA	NA	NA	NA
AUK89245.1\|1299826_1300798_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUK89246.1\|1300960_1301803_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89247.1\|1301964_1302645_+	anti-sigma factor	NA	NA	NA	NA
AUK89248.1\|1302638_1303808_+	amine oxidase	NA	NA	NA	NA
AUK89249.1\|1303804_1304836_+	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AUK89250.1\|1304903_1306121_+	MFS transporter	NA	NA	NA	NA
AUK89251.1\|1306155_1307688_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK89252.1\|1307768_1308392_+	transcriptional regulator	NA	NA	NA	NA
AUK89253.1\|1308422_1309034_+	RhtB family transporter	NA	NA	NA	NA
AUK89254.1\|1309069_1309540_+	histidine kinase	NA	NA	NA	NA
AUK89255.1\|1309971_1310976_+	peptidase M20	NA	NA	NA	NA
AUK89256.1\|1311012_1312527_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89257.1\|1312530_1313490_+	ABC transporter	NA	NA	NA	NA
AUK89258.1\|1313518_1314322_+	peptide ABC transporter permease	NA	NA	NA	NA
AUK89259.1\|1314323_1315958_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AUK89260.1\|1316041_1317103_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUK89261.1\|1317574_1318099_+	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AUK89262.1\|1318562_1319465_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89263.1\|1319461_1320496_-	hydrolase	NA	NA	NA	NA
AUK89264.1\|1320604_1321243_+	hypothetical protein	NA	NA	NA	NA
AUK89265.1\|1321537_1321765_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK89266.1\|1321887_1322601_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AUK89267.1\|1322845_1323796_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89268.1\|1323935_1324181_+	hypothetical protein	NA	NA	NA	NA
AUK89269.1\|1324295_1325744_-	2-aminoadipate aminotransferase	NA	NA	NA	NA
AUK89270.1\|1325854_1326805_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89271.1\|1326801_1327251_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AUK89272.1\|1327493_1328396_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1417038 : 1469191

Salmonella_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89352.1\|1417038_1417989_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89353.1\|1418155_1418509_+	cytochrome C	NA	NA	NA	NA
AUK89354.1\|1418521_1418884_+	cytochrome	NA	NA	NA	NA
AUK89355.1\|1418925_1419351_-	hypothetical protein	NA	NA	NA	NA
AUK89356.1\|1419553_1420810_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.2e-11	64.8
AUK89357.1\|1421008_1421989_+	hypothetical protein	NA	NA	NA	NA
AUK89358.1\|1422138_1423380_+	hypothetical protein	NA	NA	NA	NA
AUK89359.1\|1423478_1424429_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89360.1\|1424437_1425133_-	two-component system response regulator KdpE	NA	NA	NA	NA
AUK89361.1\|1425174_1427889_-	two-component sensor histidine kinase	NA	NA	NA	NA
AUK89362.1\|1427954_1428554_-	potassium-transporting ATPase subunit C	NA	NA	NA	NA
AUK89363.1\|1428564_1430730_-	potassium-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.1
AUK89364.1\|1430753_1432538_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
AUK89365.1\|1432537_1432627_-	potassium-transporting ATPase subunit F	NA	NA	NA	NA
AUK89366.1\|1433321_1433594_+	hypothetical protein	NA	NA	NA	NA
AUK89367.1\|1433593_1435660_+	cation acetate symporter	NA	NA	NA	NA
AUK89368.1\|1435656_1436559_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89369.1\|1436705_1437608_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89370.1\|1437771_1438104_-	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AUK89371.1\|1438100_1438787_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
AUK89372.1\|1438773_1439733_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.1e-57	40.2
AUK89373.1\|1439765_1442135_+	cell division protein FtsK	S5VNE3	Mycobacterium_phage	7.6e-81	48.0
AUK89374.1\|1442134_1442767_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AUK89375.1\|1442868_1444209_+	recombination factor protein RarA	G3MBE0	Bacillus_virus	1.6e-75	38.9
AUK89376.1\|1444255_1445611_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-83	47.5
AUK89377.1\|1445901_1446138_+	hypothetical protein	NA	NA	NA	NA
AUK89378.1\|1446325_1446643_-	virulence factor	NA	NA	NA	NA
AUK89379.1\|1446915_1447431_-	hypothetical protein	T1SAR8	Salmonella_phage	5.1e-06	44.6
AUK89380.1\|1447524_1447686_+	hypothetical protein	NA	NA	NA	NA
AUK89381.1\|1447701_1448457_-	GGDEF domain-containing protein	NA	NA	NA	NA
AUK89382.1\|1448795_1449002_+	hypothetical protein	NA	NA	NA	NA
AUK89383.1\|1449009_1449669_-	antibiotic resistance protein	NA	NA	NA	NA
AUK89384.1\|1449963_1452168_-	porin	NA	NA	NA	NA
AUK89385.1\|1452278_1453502_-	multidrug transporter	S4TR35	Salmonella_phage	9.8e-24	29.4
AUK89386.1\|1453624_1454599_-	AraC family transcriptional regulator	NA	NA	NA	NA
AUK89387.1\|1454666_1455860_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
AUK89388.1\|1455874_1456675_-	siderophore ferric iron reductase	NA	NA	NA	NA
AUK89389.1\|1456671_1458528_-	IucA/IucC family protein	NA	NA	NA	NA
AUK89390.1\|1458524_1459130_-	siderophore biosynthesis protein	NA	NA	NA	NA
AUK89391.1\|1459148_1460534_-	alcaligin biosynthesis protein	NA	NA	NA	NA
AUK89392.1\|1461259_1462486_+	transporter	NA	NA	NA	NA
AUK89393.1\|1462574_1463357_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AUK89394.1\|1463503_1464406_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89395.1\|1464432_1465206_+	peroxide stress protein YaaA	NA	NA	NA	NA
AUK89396.1\|1465217_1466459_+	hypothetical protein	NA	NA	NA	NA
AUK89397.1\|1468288_1469191_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1571028 : 1642134

Ectocarpus_siliculosus_virus(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89490.1\|1571028_1571979_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89491.1\|1572000_1573221_+	YggW family oxidoreductase	NA	NA	NA	NA
AUK89492.1\|1573406_1574819_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AUK89493.1\|1574882_1575950_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AUK89494.1\|1575949_1577437_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AUK91631.1\|1577446_1578391_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89495.1\|1578550_1579249_+	quercetin 2,3-dioxygenase	NA	NA	NA	NA
AUK89496.1\|1579326_1580232_+	hypothetical protein	NA	NA	NA	NA
AUK89497.1\|1580251_1581154_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89498.1\|1581300_1582095_-	ABC transporter	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AUK89499.1\|1582099_1583770_-	iron ABC transporter permease	NA	NA	NA	NA
AUK89500.1\|1583893_1584943_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89501.1\|1585264_1586041_+	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AUK89502.1\|1586105_1587008_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89503.1\|1588301_1589105_+	2,5-didehydrogluconate reductase B	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AUK89504.1\|1591798_1592185_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AUK89505.1\|1592200_1594291_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
AUK89506.1\|1594342_1595296_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AUK91632.1\|1595310_1596198_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89507.1\|1596335_1597862_+	methylmalonate-semialdehyde dehydrogenase (acylating)	NA	NA	NA	NA
AUK89508.1\|1597960_1598461_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AUK89509.1\|1598784_1600740_-	capsular biosynthesis protein	NA	NA	NA	NA
AUK89510.1\|1600907_1602992_-	hypothetical protein	NA	NA	NA	NA
AUK91633.1\|1603018_1603444_-	hypothetical protein	NA	NA	NA	NA
AUK89511.1\|1604659_1605430_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AUK89512.1\|1605429_1606170_+	sugar ABC transporter ATP-binding protein	NA	NA	NA	NA
AUK89513.1\|1606211_1607381_+	capsule biosynthesis protein	NA	NA	NA	NA
AUK89514.1\|1607412_1609497_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AUK89515.1\|1609493_1610384_+	capsular biosynthesis protein	NA	NA	NA	NA
AUK89516.1\|1610380_1611478_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AUK89517.1\|1611500_1612790_+	Vi polysaccharide biosynthesis protein VipA/TviB	NA	NA	NA	NA
AUK89518.1\|1612801_1613827_+	LPS biosynthesis protein WbpP	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AUK89519.1\|1613823_1615881_+	beta-3-deoxy-D-manno-oct-2-ulosonic acid transferase	NA	NA	NA	NA
AUK89520.1\|1615894_1617070_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AUK89521.1\|1617151_1618102_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89522.1\|1618160_1618934_+	short-chain dehydrogenase	NA	NA	NA	NA
AUK89523.1\|1618926_1620483_+	capsular biosynthesis protein	NA	NA	NA	NA
AUK89524.1\|1620479_1621430_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89525.1\|1622756_1623359_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUK89526.1\|1623598_1624300_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AUK89527.1\|1624293_1625076_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AUK89528.1\|1625260_1626211_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89529.1\|1626309_1627047_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AUK89530.1\|1627236_1627995_-	short-chain dehydrogenase	NA	NA	NA	NA
AUK89531.1\|1628041_1629043_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89532.1\|1629208_1630177_-	phenol degradation protein meta	NA	NA	NA	NA
AUK89533.1\|1631716_1632685_+	AAA family ATPase	NA	NA	NA	NA
AUK89534.1\|1632693_1633635_+	MoxR protein	NA	NA	NA	NA
AUK91634.1\|1634108_1635119_+	hypothetical protein	NA	NA	NA	NA
AUK91636.1\|1635109_1636624_+	hypothetical protein	NA	NA	NA	NA
AUK89535.1\|1636620_1637967_+	hypothetical protein	NA	NA	NA	NA
AUK91635.1\|1637969_1639004_+	haloacid dehalogenase	NA	NA	NA	NA
AUK89536.1\|1639053_1640679_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AUK89537.1\|1640772_1641252_+	hypothetical protein	NA	NA	NA	NA
AUK89538.1\|1641231_1642134_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1662973 : 1724321

uncultured_Caudovirales_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89555.1\|1662973_1663924_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89556.1\|1664032_1664221_+	hypothetical protein	NA	NA	NA	NA
AUK91639.1\|1664217_1664940_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AUK89557.1\|1665378_1666566_-	hypothetical protein	NA	NA	NA	NA
AUK91640.1\|1666569_1666920_-	transcriptional regulator	NA	NA	NA	NA
AUK89558.1\|1667153_1668566_-	hypothetical protein	NA	NA	NA	NA
AUK89559.1\|1668669_1669641_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89560.1\|1669654_1670368_+	3-oxoacyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AUK89561.1\|1670372_1671290_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89562.1\|1671396_1671693_+	hypothetical protein	NA	NA	NA	NA
AUK89563.1\|1671839_1672742_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89564.1\|1673900_1676834_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AUK89565.1\|1676833_1677178_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AUK89566.1\|1677174_1678803_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AUK89567.1\|1678802_1679279_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AUK89568.1\|1679278_1679560_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
AUK89569.1\|1679556_1679883_+	cation:proton antiporter	NA	NA	NA	NA
AUK89570.1\|1680038_1680989_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89571.1\|1681032_1681575_+	hypothetical protein	NA	NA	NA	NA
AUK89572.1\|1681672_1682521_+	hydrolase	NA	NA	NA	NA
AUK91641.1\|1682570_1683020_+\|tRNA	tRNA-specific adenosine deaminase	S4VYT2	Pandoravirus	2.0e-06	38.2
AUK89573.1\|1683016_1684018_+	LD-carboxypeptidase	NA	NA	NA	NA
AUK89574.1\|1684030_1684825_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK89575.1\|1684873_1686775_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AUK89576.1\|1686771_1687395_-	hypothetical protein	NA	NA	NA	NA
AUK89577.1\|1687521_1688646_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AUK89578.1\|1689026_1690631_+	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.2e-53	28.9
AUK89579.1\|1690786_1691563_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AUK89580.1\|1691647_1692646_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89581.1\|1692642_1693416_+	ABC transporter permease	NA	NA	NA	NA
AUK89582.1\|1694400_1695351_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89583.1\|1695374_1695839_-\|tRNA	glutamyl-tRNA amidotransferase	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AUK89584.1\|1695985_1697194_+	nitric oxide dioxygenase	NA	NA	NA	NA
AUK89585.1\|1697237_1697675_+	BadM/Rrf2 family transcriptional regulator	NA	NA	NA	NA
AUK89586.1\|1697793_1699083_+	D-amino acid dehydrogenase small subunit	NA	NA	NA	NA
AUK89587.1\|1701823_1702726_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89588.1\|1702872_1703889_-	folate-binding protein YgfZ	NA	NA	NA	NA
AUK89589.1\|1704067_1705102_+	aminodeoxychorismate lyase	NA	NA	NA	NA
AUK89590.1\|1705098_1705725_+	dTMP kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AUK89591.1\|1705721_1706774_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
AUK89592.1\|1706823_1707594_+	DNAase	NA	NA	NA	NA
AUK89593.1\|1707644_1708481_+	hypothetical protein	NA	NA	NA	NA
AUK89594.1\|1708676_1709417_+	IclR family transcriptional regulator	NA	NA	NA	NA
AUK89595.1\|1709491_1710235_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89596.1\|1710896_1711670_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AUK89597.1\|1712807_1714097_+	glutamate dehydrogenase	NA	NA	NA	NA
AUK89598.1\|1715707_1716955_-	Zn-dependent hydrolase	NA	NA	NA	NA
AUK89599.1\|1716964_1718674_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AUK89600.1\|1718670_1719609_-	CoA ester lyase	NA	NA	NA	NA
AUK89601.1\|1719605_1720889_-	C4-dicarboxylate ABC transporter permease	NA	NA	NA	NA
AUK89602.1\|1720892_1721375_-	TRAP transporter small permease protein	NA	NA	NA	NA
AUK89603.1\|1721375_1722362_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89604.1\|1722534_1723254_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK89605.1\|1723370_1724321_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1830508 : 1902018

Klosneuvirus(22.22%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89683.1\|1830508_1831459_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89684.1\|1831583_1832393_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK89685.1\|1832641_1833544_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89686.1\|1834817_1836035_+	hypothetical protein	NA	NA	NA	NA
AUK89687.1\|1836031_1837087_+	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
AUK89688.1\|1837091_1837994_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK89689.1\|1838070_1838943_+	MOSC domain-containing protein	NA	NA	NA	NA
AUK89690.1\|1839073_1839442_+	aspartate 1-decarboxylase	NA	NA	NA	NA
AUK89691.1\|1839499_1840546_+	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
AUK89692.1\|1840741_1841998_+	amino acid dehydrogenase	NA	NA	NA	NA
AUK89693.1\|1842002_1843340_+	glycerol-3-phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89694.1\|1843489_1844446_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89695.1\|1845903_1846269_+	hypothetical protein	NA	NA	NA	NA
AUK89696.1\|1846316_1847891_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89697.1\|1847943_1848888_+	peptide ABC transporter	NA	NA	NA	NA
AUK91649.1\|1848815_1849736_+	peptide ABC transporter permease	NA	NA	NA	NA
AUK89698.1\|1849728_1851363_+	microcin ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.2e-18	32.7
AUK89699.1\|1851359_1852715_+	amidase	NA	NA	NA	NA
AUK89700.1\|1853621_1855199_+	hypothetical protein	NA	NA	NA	NA
AUK89701.1\|1855202_1856477_+	hypothetical protein	NA	NA	NA	NA
AUK91650.1\|1856574_1856949_+	hypothetical protein	NA	NA	NA	NA
AUK89702.1\|1858664_1859798_+	general secretion pathway protein	NA	NA	NA	NA
AUK89703.1\|1859835_1860441_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
AUK89704.1\|1860437_1861256_+	hypothetical protein	NA	NA	NA	NA
AUK89705.1\|1861327_1863952_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4
AUK89706.1\|1863938_1864193_+	hypothetical protein	NA	NA	NA	NA
AUK89707.1\|1864259_1864841_-	hypothetical protein	NA	NA	NA	NA
AUK89708.1\|1865144_1865405_+	30S ribosomal protein S16	NA	NA	NA	NA
AUK89709.1\|1865570_1866194_+	ribosome maturation factor RimM	NA	NA	NA	NA
AUK89710.1\|1866193_1866967_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AUK89711.1\|1866963_1868172_-	class V aminotransferase	NA	NA	NA	NA
AUK89712.1\|1868197_1868671_-	hypothetical protein	NA	NA	NA	NA
AUK89713.1\|1868744_1869695_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89714.1\|1869793_1870696_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89715.1\|1870842_1872192_-	two-component sensor histidine kinase	NA	NA	NA	NA
AUK89716.1\|1872957_1873713_+	hypothetical protein	NA	NA	NA	NA
AUK89717.1\|1873805_1876688_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
AUK89718.1\|1877010_1877436_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
AUK89719.1\|1877463_1878612_+	23S rRNA (adenine(2503)-C(2))-methyltransferase	NA	NA	NA	NA
AUK89720.1\|1878608_1879115_+	transcriptional regulator	NA	NA	NA	NA
AUK89721.1\|1879130_1880417_+	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase	NA	NA	NA	NA
AUK89722.1\|1880466_1881762_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AUK89723.1\|1881763_1882402_+	hypothetical protein	NA	NA	NA	NA
AUK91651.1\|1882407_1883565_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
AUK89724.1\|1883591_1884947_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
AUK89725.1\|1884950_1886021_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
AUK89726.1\|1886159_1886396_+	RNA chaperone Hfq	NA	NA	NA	NA
AUK89727.1\|1886483_1887590_+	GTPase HflX	NA	NA	NA	NA
AUK89728.1\|1887555_1888860_+	HflK protein	NA	NA	NA	NA
AUK89729.1\|1888878_1889778_+	HflC protein	NA	NA	NA	NA
AUK89730.1\|1889961_1891119_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
AUK89731.1\|1891195_1892491_+	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	3.0e-63	33.5
AUK89732.1\|1892604_1893144_+	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
AUK89733.1\|1893421_1893634_+	30S ribosomal protein S21	NA	NA	NA	NA
AUK89734.1\|1893653_1895684_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-65	41.9
AUK89735.1\|1896369_1898652_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.2e-36	30.1
AUK89736.1\|1899061_1899361_-	hypothetical protein	NA	NA	NA	NA
AUK89737.1\|1899645_1900059_+	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.8e-36	59.0
AUK89738.1\|1900018_1900969_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89739.1\|1901067_1902018_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1913222 : 1961681

Klosneuvirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89750.1\|1913222_1914173_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89751.1\|1914169_1915444_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-14	28.9
AUK89752.1\|1915547_1916741_+	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
AUK89753.1\|1916737_1917391_+	alpha/beta hydrolase	NA	NA	NA	NA
AUK89754.1\|1917387_1918824_+	dethiobiotin synthase	NA	NA	NA	NA
AUK89755.1\|1918811_1919171_+	CidA/LrgA family protein	NA	NA	NA	NA
AUK89756.1\|1919256_1919907_+	hypothetical protein	NA	NA	NA	NA
AUK89757.1\|1920191_1921094_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89758.1\|1921192_1922056_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89759.1\|1922139_1924005_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AUK91655.1\|1924262_1925783_+	aldehyde dehydrogenase	NA	NA	NA	NA
AUK89760.1\|1925870_1926521_-	NAD(P)H dehydrogenase	NA	NA	NA	NA
AUK89761.1\|1927469_1928765_+	hypothetical protein	NA	NA	NA	NA
AUK89762.1\|1928786_1929671_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK91656.1\|1929769_1930645_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AUK89763.1\|1930634_1930991_-	RNA signal recognition particle	NA	NA	NA	NA
AUK89764.1\|1931121_1932096_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUK89765.1\|1932225_1932405_-	DUF3008 domain-containing protein	NA	NA	NA	NA
AUK89766.1\|1932547_1933027_+	hypothetical protein	NA	NA	NA	NA
AUK89767.1\|1933037_1933874_-	alpha/beta hydrolase	NA	NA	NA	NA
AUK89768.1\|1933986_1934358_+	transcriptional regulator	NA	NA	NA	NA
AUK89769.1\|1934354_1934906_+	ATPase	NA	NA	NA	NA
AUK89770.1\|1934921_1936613_-	sodium-independent anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
AUK89771.1\|1936661_1937342_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK89772.1\|1937589_1938054_-	hypothetical protein	NA	NA	NA	NA
AUK89773.1\|1938223_1939153_+	hypothetical protein	NA	NA	NA	NA
AUK91657.1\|1939165_1939759_-	hypothetical protein	NA	NA	NA	NA
AUK89774.1\|1939886_1941704_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
AUK89775.1\|1941787_1942738_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91658.1\|1942836_1943316_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK89776.1\|1943438_1944341_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89777.1\|1944359_1944707_-	aldehyde-activating protein	NA	NA	NA	NA
AUK89778.1\|1944735_1946175_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	7.4e-55	37.4
AUK89779.1\|1946193_1946589_-	hypothetical protein	NA	NA	NA	NA
AUK89780.1\|1946763_1947372_+	peptidase S16	NA	NA	NA	NA
AUK89781.1\|1947384_1948203_+	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	28.8
AUK89782.1\|1948154_1949129_-	AraC family transcriptional regulator	NA	NA	NA	NA
AUK89783.1\|1949157_1950219_-	hypothetical protein	NA	NA	NA	NA
AUK89784.1\|1950215_1952432_-	aldehyde oxidase	NA	NA	NA	NA
AUK89785.1\|1952445_1952904_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
AUK89786.1\|1953061_1953406_-	hypothetical protein	NA	NA	NA	NA
AUK89787.1\|1953562_1954468_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK91659.1\|1954554_1955568_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AUK91660.1\|1957547_1958564_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK89788.1\|1958706_1960059_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
AUK89789.1\|1960233_1960530_+	hypothetical protein	NA	NA	NA	NA
AUK89790.1\|1960676_1961681_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1974114 : 2038435

Vibrio_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89804.1\|1974114_1975065_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89805.1\|1975286_1976237_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89806.1\|1976335_1977301_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89807.1\|1977438_1978338_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK89808.1\|1978865_1980692_+	DUF3604 domain-containing protein	NA	NA	NA	NA
AUK89809.1\|1981049_1982420_+	hypothetical protein	NA	NA	NA	NA
AUK89810.1\|1982430_1983627_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AUK89811.1\|1983699_1985019_+	acyl--CoA ligase	NA	NA	NA	NA
AUK89812.1\|1985015_1985891_+	esterase	NA	NA	NA	NA
AUK89813.1\|1985921_1987070_-	carnitine dehydratase	NA	NA	NA	NA
AUK89814.1\|1987087_1987402_-	2Fe-2S ferredoxin	NA	NA	NA	NA
AUK89815.1\|1987423_1988146_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AUK89816.1\|1988145_1988964_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK89817.1\|1988968_1989496_-	ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
AUK89818.1\|1989501_1990758_-	ring-hydroxylating oxygenase subunit alpha	NA	NA	NA	NA
AUK89819.1\|1991116_1992256_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89820.1\|1992333_1993206_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUK89821.1\|1994124_1995027_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89822.1\|1994986_1995622_-	hypothetical protein	NA	NA	NA	NA
AUK89823.1\|1995981_1997304_-	isocitrate lyase	NA	NA	NA	NA
AUK89824.1\|1997622_1998444_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	4.1e-42	37.6
AUK89825.1\|1998379_1998721_-	hypothetical protein	NA	NA	NA	NA
AUK89826.1\|1998730_1999699_-	MFS transporter	NA	NA	NA	NA
AUK89827.1\|1999868_2000441_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AUK89828.1\|2000480_2002310_-	excinuclease ABC subunit C	NA	NA	NA	NA
AUK89829.1\|2002272_2003331_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
AUK89830.1\|2003368_2003830_-	holo-ACP synthase	NA	NA	NA	NA
AUK89831.1\|2003914_2004661_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
AUK89832.1\|2006151_2009382_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AUK89833.1\|2009448_2010780_-	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AUK89834.1\|2011032_2011407_-	DNA-binding protein	NA	NA	NA	NA
AUK89835.1\|2011509_2012688_-	hypothetical protein	NA	NA	NA	NA
AUK89836.1\|2012698_2013289_-	hypothetical protein	NA	NA	NA	NA
AUK91662.1\|2013399_2014206_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AUK89837.1\|2014231_2015026_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.1e-05	25.7
AUK89838.1\|2016026_2017001_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89839.1\|2017159_2017672_-	superoxide dismutase	Q9MC02	Salmonella_phage	1.8e-43	52.3
AUK89840.1\|2017828_2018800_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89841.1\|2020544_2021351_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK89842.1\|2021347_2022649_-	malonyl-CoA decarboxylase	NA	NA	NA	NA
AUK89843.1\|2022599_2023364_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK89844.1\|2023477_2024248_-	spermidine synthase	NA	NA	NA	NA
AUK89845.1\|2024332_2025520_-	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AUK89846.1\|2025592_2025967_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AUK89847.1\|2026067_2027330_-	glycine/betaine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-28	36.6
AUK89848.1\|2027326_2028184_-	ABC transporter permease	NA	NA	NA	NA
AUK89849.1\|2028356_2029358_-	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK89850.1\|2029809_2030712_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91663.1\|2032323_2033475_+	Bcr/CflA family drug resistance efflux transporter	NA	NA	NA	NA
AUK89851.1\|2033843_2034080_+	50S ribosomal protein L28	NA	NA	NA	NA
AUK89852.1\|2034143_2034311_+	50S ribosomal protein L33	NA	NA	NA	NA
AUK89853.1\|2034424_2036230_-	sulfate transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.2e-19	27.5
AUK89854.1\|2036483_2037386_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89855.1\|2037532_2038435_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2147857 : 2197778

Lake_Baikal_phage(22.22%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK89935.1\|2147857_2149162_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AUK89936.1\|2149266_2149920_-	ATP-dependent Clp endopeptidase, proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AUK89937.1\|2149922_2151233_-	trigger factor	NA	NA	NA	NA
AUK89938.1\|2151429_2151990_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AUK89939.1\|2152101_2152302_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AUK89940.1\|2152647_2153214_-	hypothetical protein	NA	NA	NA	NA
AUK89941.1\|2153297_2153501_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AUK89942.1\|2153807_2154128_-	hypothetical protein	NA	NA	NA	NA
AUK89943.1\|2154169_2154451_-	hypothetical protein	NA	NA	NA	NA
AUK89944.1\|2154525_2155782_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AUK89945.1\|2156164_2156494_+	hypothetical protein	NA	NA	NA	NA
AUK89946.1\|2158064_2158886_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AUK89947.1\|2158885_2160025_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AUK89948.1\|2160031_2160928_+	ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AUK89949.1\|2160942_2162850_+	ABC transporter	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AUK89950.1\|2163209_2165822_+	TonB-dependent receptor	NA	NA	NA	NA
AUK89951.1\|2165874_2168175_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AUK89952.1\|2168171_2169380_-	acyl-CoA desaturase	NA	NA	NA	NA
AUK89953.1\|2169641_2170016_+	hypothetical protein	NA	NA	NA	NA
AUK89954.1\|2170012_2170963_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91672.1\|2171061_2172459_-	rRNA methyltransferase	NA	NA	NA	NA
AUK89955.1\|2173115_2174081_+	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
AUK89956.1\|2174070_2176932_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
AUK89957.1\|2176934_2177441_+	signal peptidase II	NA	NA	NA	NA
AUK89958.1\|2177545_2178754_+	phosphopantothenate synthase	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
AUK89959.1\|2178755_2179694_-	hypothetical protein	NA	NA	NA	NA
AUK89960.1\|2179855_2180329_+	AsnC family transcriptional regulator	NA	NA	NA	NA
AUK89961.1\|2180325_2181276_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89962.1\|2181374_2182325_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89963.1\|2182423_2183374_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK89964.1\|2183484_2183925_-	hypothetical protein	NA	NA	NA	NA
AUK89965.1\|2184053_2185283_-	lytic transglycosylase	NA	NA	NA	NA
AUK89966.1\|2185321_2186143_-	hypothetical protein	NA	NA	NA	NA
AUK89967.1\|2186196_2187348_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUK89968.1\|2187439_2187910_-	hypothetical protein	NA	NA	NA	NA
AUK89969.1\|2190478_2193028_+	cyanophycin synthetase	NA	NA	NA	NA
AUK89970.1\|2193098_2195672_+	cyanophycin synthetase	NA	NA	NA	NA
AUK89971.1\|2195937_2196138_+	general stress protein CsbD	NA	NA	NA	NA
AUK89972.1\|2196169_2196331_+	DUF1328 domain-containing protein	NA	NA	NA	NA
AUK89973.1\|2196388_2196727_+	phospholipid-binding protein	NA	NA	NA	NA
AUK89974.1\|2196875_2197778_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2477019 : 2535263

Planktothrix_phage(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90199.1\|2477019_2477922_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90200.1\|2478449_2479106_-	N-(5'-phosphoribosyl)anthranilate isomerase	NA	NA	NA	NA
AUK90201.1\|2479120_2480788_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AUK90202.1\|2480790_2481420_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90203.1\|2481631_2482726_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90204.1\|2482870_2483683_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AUK90205.1\|2483686_2485270_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
AUK90206.1\|2485440_2486571_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AUK90207.1\|2486757_2487834_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AUK91697.1\|2487915_2488566_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AUK90208.1\|2488580_2489984_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AUK90209.1\|2490267_2491086_-	tungsten ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90210.1\|2491082_2491787_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-13	30.0
AUK90211.1\|2492686_2493802_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90212.1\|2493835_2494210_-	hypothetical protein	NA	NA	NA	NA
AUK90213.1\|2494232_2495390_-	formate dehydrogenase subunit gamma	NA	NA	NA	NA
AUK90214.1\|2495402_2495636_-	hypothetical protein	NA	NA	NA	NA
AUK90215.1\|2496270_2499240_-	formate dehydrogenase	NA	NA	NA	NA
AUK90216.1\|2499254_2499464_-	formate dehydrogenase	NA	NA	NA	NA
AUK90217.1\|2499615_2500245_-	hypothetical protein	NA	NA	NA	NA
AUK91698.1\|2500241_2502299_-	4Fe-4S ferredoxin	NA	NA	NA	NA
AUK90218.1\|2502355_2503036_-	hypothetical protein	NA	NA	NA	NA
AUK90219.1\|2503032_2503593_-	hypothetical protein	NA	NA	NA	NA
AUK90220.1\|2503599_2504697_-	MRP family ATP-binding protein	NA	NA	NA	NA
AUK90221.1\|2504849_2505443_+	molybdenum cofactor guanylyltransferase MobA	NA	NA	NA	NA
AUK90222.1\|2505439_2506732_+	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AUK90223.1\|2506745_2507288_+	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
AUK90224.1\|2507297_2508134_-	peptidase M48	NA	NA	NA	NA
AUK90225.1\|2508167_2509229_-	chorismate synthase	A0A291AU41	Pandoravirus	2.9e-80	42.8
AUK90226.1\|2509270_2510323_-	diguanylate cyclase	NA	NA	NA	NA
AUK90227.1\|2510338_2510641_-	hypothetical protein	NA	NA	NA	NA
AUK90228.1\|2510782_2511733_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90229.1\|2511911_2513606_+	ABC transporter permease	NA	NA	NA	NA
AUK90230.1\|2513602_2514688_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-27	37.7
AUK90231.1\|2514735_2515635_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90232.1\|2515645_2516290_+	histidine phosphatase family protein	NA	NA	NA	NA
AUK90233.1\|2517311_2520554_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
AUK90234.1\|2520564_2521719_-	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	3.3e-53	35.4
AUK90235.1\|2521945_2522908_+	transaldolase	H6WFR1	Cyanophage	7.5e-11	29.2
AUK90236.1\|2523054_2523957_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90237.1\|2524103_2525006_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90238.1\|2525015_2525705_-	hypothetical protein	NA	NA	NA	NA
AUK90239.1\|2525764_2526202_-	thioesterase	NA	NA	NA	NA
AUK90240.1\|2526247_2527141_-	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AUK90241.1\|2527188_2528361_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK90242.1\|2528357_2529512_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK90243.1\|2529708_2530059_-	RnfH family protein	NA	NA	NA	NA
AUK90244.1\|2530048_2530483_-	ubiquinone-binding protein	NA	NA	NA	NA
AUK90245.1\|2530499_2531402_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90246.1\|2531597_2532065_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AUK90247.1\|2532045_2533203_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AUK90248.1\|2533268_2534195_-	paraslipin	NA	NA	NA	NA
AUK90249.1\|2534360_2535263_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2577589 : 2644040

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90287.1\|2577589_2578492_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90288.1\|2578507_2578720_+	hypothetical protein	NA	NA	NA	NA
AUK90289.1\|2578861_2579434_+	flagellar basal body protein FliL	NA	NA	NA	NA
AUK90290.1\|2579436_2580447_+	flagellar motor switch protein FliM	NA	NA	NA	NA
AUK90291.1\|2580439_2580940_+	flagellar motor switch protein FliN	NA	NA	NA	NA
AUK90292.1\|2580950_2581292_+	flagellar biosynthetic protein FliO	NA	NA	NA	NA
AUK91702.1\|2581360_2582095_+	flagellar biosynthetic protein FliP	NA	NA	NA	NA
AUK90293.1\|2582111_2582381_+	EscS/YscS/HrcS family type III secretion system export apparatus protein	NA	NA	NA	NA
AUK90294.1\|2582403_2583192_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
AUK91703.1\|2583238_2584255_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90295.1\|2584471_2585914_-	chemotaxis protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
AUK90296.1\|2586092_2587712_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
AUK90297.1\|2587832_2589653_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
AUK90298.1\|2589731_2591264_-	flagellar hook-associated protein 3	NA	NA	NA	NA
AUK90299.1\|2591297_2592944_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
AUK90300.1\|2593013_2594036_-	flagellar rod assembly protein/muramidase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
AUK90301.1\|2594053_2595187_-	flagellar biosynthesis protein FlgI	NA	NA	NA	NA
AUK90302.1\|2595189_2595879_-	flagellar basal body L-ring protein	NA	NA	NA	NA
AUK90303.1\|2595878_2596664_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
AUK90304.1\|2596707_2597472_-	flagellar biosynthesis protein FlgF	NA	NA	NA	NA
AUK90305.1\|2597510_2598932_-	flagellar hook protein FlgE	NA	NA	NA	NA
AUK90306.1\|2598997_2599702_-	flagellar basal body rod modification protein	NA	NA	NA	NA
AUK90307.1\|2599749_2600169_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
AUK90308.1\|2600181_2600589_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
AUK91704.1\|2600772_2601483_+	flagella basal body P-ring formation protein FlgA	NA	NA	NA	NA
AUK90309.1\|2601609_2601900_+	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
AUK90310.1\|2601917_2602400_+	flagellar protein FlgN	NA	NA	NA	NA
AUK90311.1\|2606905_2608060_-	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AUK91705.1\|2608365_2609382_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90312.1\|2609628_2610417_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90313.1\|2610483_2611164_+	cysteine ABC transporter permease	NA	NA	NA	NA
AUK90314.1\|2611160_2611931_+	ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
AUK90315.1\|2612028_2612979_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90316.1\|2613034_2613952_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AUK90317.1\|2613962_2615141_-	mandelate racemase	NA	NA	NA	NA
AUK90318.1\|2615160_2616156_-	hypothetical protein	NA	NA	NA	NA
AUK90319.1\|2617744_2618353_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AUK90320.1\|2618340_2619381_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUK90321.1\|2619398_2620361_-	hypothetical protein	NA	NA	NA	NA
AUK90322.1\|2620357_2621551_-	CoA transferase	NA	NA	NA	NA
AUK90323.1\|2621547_2622345_-	citryl-CoA lyase	NA	NA	NA	NA
AUK90324.1\|2622370_2623357_-	hypothetical protein	NA	NA	NA	NA
AUK90325.1\|2623375_2625415_-	acetyl-CoA synthetase	NA	NA	NA	NA
AUK91706.1\|2625616_2626297_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK90326.1\|2626310_2627222_-	CoA ester lyase	NA	NA	NA	NA
AUK90327.1\|2627218_2627797_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
AUK90328.1\|2627935_2628841_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90329.1\|2628848_2632268_+	nuclease	NA	NA	NA	NA
AUK90330.1\|2632255_2634856_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AUK90331.1\|2635811_2636444_-	PadR family transcriptional regulator	NA	NA	NA	NA
AUK90332.1\|2636837_2637596_+	hypothetical protein	NA	NA	NA	NA
AUK90333.1\|2637592_2638795_+	cardiolipin synthase B	NA	NA	NA	NA
AUK90334.1\|2638791_2638992_+	hypothetical protein	NA	NA	NA	NA
AUK90335.1\|2638982_2639933_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90336.1\|2640840_2641986_+	hypothetical protein	NA	NA	NA	NA
AUK90337.1\|2641972_2642728_+	alpha/beta hydrolase	NA	NA	NA	NA
AUK90338.1\|2642844_2643024_+	hypothetical protein	NA	NA	NA	NA
AUK90339.1\|2643089_2644040_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2807645 : 2870041

Diachasmimorpha_longicaudata_entomopoxvirus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90471.1\|2807645_2808548_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90472.1\|2808924_2809530_+	fimbrial protein	NA	NA	NA	NA
AUK90473.1\|2809583_2810897_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AUK90474.1\|2810971_2811442_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AUK90475.1\|2811441_2812230_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AUK90476.1\|2812240_2813893_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AUK90477.1\|2813980_2814883_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91723.1\|2816092_2816599_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AUK90478.1\|2816595_2817360_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AUK90479.1\|2817375_2817660_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AUK90480.1\|2817724_2818714_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AUK90481.1\|2818885_2819815_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AUK90482.1\|2819786_2820473_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AUK90483.1\|2820506_2821052_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AUK90484.1\|2821096_2822362_+	peptidase M48	NA	NA	NA	NA
AUK90485.1\|2822358_2823261_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
AUK90486.1\|2824442_2825387_-	peptide ABC transporter	NA	NA	NA	NA
AUK90487.1\|2825481_2826999_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90488.1\|2827040_2828669_-	gamma-glutamyltransferase	NA	NA	NA	NA
AUK90489.1\|2828776_2829658_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90490.1\|2829918_2830146_+	hypothetical protein	NA	NA	NA	NA
AUK90491.1\|2832770_2833145_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AUK90492.1\|2833169_2833508_-	transcriptional regulator	NA	NA	NA	NA
AUK90493.1\|2833551_2835186_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AUK90494.1\|2835224_2836571_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AUK91724.1\|2836678_2838100_+	argininosuccinate lyase	NA	NA	NA	NA
AUK90495.1\|2838169_2838754_-	nitroreductase	NA	NA	NA	NA
AUK90496.1\|2838856_2839807_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90497.1\|2839941_2841048_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90498.1\|2841058_2842156_+	cyclic pyranopterin phosphate synthase	NA	NA	NA	NA
AUK90499.1\|2842300_2843506_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AUK90500.1\|2843512_2844034_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AUK91725.1\|2844030_2844513_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AUK90501.1\|2844518_2844770_-	molybdopterin synthase sulfur carrier subunit	NA	NA	NA	NA
AUK90502.1\|2844750_2845236_-	molybdenum cofactor biosynthesis protein C	NA	NA	NA	NA
AUK90503.1\|2845371_2848833_+	hypothetical protein	NA	NA	NA	NA
AUK90504.1\|2848850_2849735_+	carboxymethylenebutenolidase	NA	NA	NA	NA
AUK90505.1\|2849744_2850176_-	hypothetical protein	NA	NA	NA	NA
AUK91726.1\|2850422_2850926_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AUK90506.1\|2851003_2852404_+	MFS transporter	NA	NA	NA	NA
AUK90507.1\|2852478_2853354_-	hypothetical protein	NA	NA	NA	NA
AUK91727.1\|2853350_2854358_-	biotin synthase BioB	NA	NA	NA	NA
AUK90508.1\|2854825_2855131_+	hypothetical protein	NA	NA	NA	NA
AUK90509.1\|2855221_2855812_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUK91728.1\|2856002_2857019_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90510.1\|2857210_2859547_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
AUK90511.1\|2859629_2860064_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AUK90512.1\|2860162_2861113_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90513.1\|2861109_2861904_-	N-formylglutamate deformylase	NA	NA	NA	NA
AUK90514.1\|2861935_2862640_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AUK90515.1\|2862714_2863515_-	hypothetical protein	NA	NA	NA	NA
AUK90516.1\|2863511_2863919_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AUK90517.1\|2863915_2864557_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AUK91729.1\|2864549_2866550_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AUK90518.1\|2867810_2869142_+	arabinose ABC transporter permease	NA	NA	NA	NA
AUK90519.1\|2869138_2870041_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2884565 : 2925924

uncultured_Mediterranean_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90530.1\|2884565_2885468_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90531.1\|2885846_2889668_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AUK90532.1\|2889824_2890493_-	hypothetical protein	NA	NA	NA	NA
AUK90533.1\|2890497_2892171_-	paraquat-inducible protein B	NA	NA	NA	NA
AUK90534.1\|2892189_2893509_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AUK90535.1\|2893513_2895829_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.1e-164	41.9
AUK91730.1\|2895884_2898053_-	penicillin-binding protein 1C	NA	NA	NA	NA
AUK91731.1\|2898049_2902615_-	alpha-2-macroglobulin	NA	NA	NA	NA
AUK90536.1\|2903328_2903643_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AUK90537.1\|2903870_2904116_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AUK90538.1\|2904237_2904729_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	4.8e-14	42.2
AUK90539.1\|2904828_2906034_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AUK90540.1\|2906149_2907547_-	chloride channel protein EriC	NA	NA	NA	NA
AUK90541.1\|2907663_2908242_-	superoxide dismutase	NA	NA	NA	NA
AUK90542.1\|2908314_2909706_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AUK90543.1\|2909873_2910824_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90544.1\|2911104_2911725_+	flagellar motor protein MotA	NA	NA	NA	NA
AUK90545.1\|2911721_2912135_+	biopolymer transporter ExbD	NA	NA	NA	NA
AUK90546.1\|2912131_2913175_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AUK90547.1\|2913230_2913419_+	hypothetical protein	NA	NA	NA	NA
AUK90548.1\|2913428_2914193_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AUK90549.1\|2914283_2914940_+	adenylate kinase	NA	NA	NA	NA
AUK90550.1\|2915031_2915790_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AUK90551.1\|2915815_2917417_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AUK90552.1\|2917617_2918622_+	iron dicitrate transport regulator FecR	NA	NA	NA	NA
AUK90553.1\|2918722_2918986_+	30S ribosomal protein S20	NA	NA	NA	NA
AUK90554.1\|2919103_2919880_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AUK90555.1\|2920470_2921421_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90556.1\|2923804_2924917_-	malate dehydrogenase	NA	NA	NA	NA
AUK90557.1\|2924973_2925924_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2948303 : 3010493

Staphylococcus_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90580.1\|2948303_2949167_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90581.1\|2949362_2950835_-	magnesium transporter	NA	NA	NA	NA
AUK90582.1\|2950845_2951256_-	acyl-CoA thioesterase	NA	NA	NA	NA
AUK90583.1\|2951319_2952366_-	hypothetical protein	NA	NA	NA	NA
AUK90584.1\|2952472_2953351_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90585.1\|2953364_2954561_-	amidohydrolase	NA	NA	NA	NA
AUK90586.1\|2954622_2956314_+	long-chain fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.4e-33	28.1
AUK90587.1\|2956310_2957213_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90588.1\|2957381_2958278_-	inositol monophosphatase	NA	NA	NA	NA
AUK90589.1\|2960555_2962781_+	glycosyl hydrolase	NA	NA	NA	NA
AUK90590.1\|2962945_2964034_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AUK90591.1\|2963990_2964644_+	DL-methionine transporter permease subunit	NA	NA	NA	NA
AUK90592.1\|2964691_2965489_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90593.1\|2966068_2966971_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90594.1\|2967051_2968200_+	alcohol dehydrogenase	NA	NA	NA	NA
AUK90595.1\|2968256_2969207_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90596.1\|2969305_2969611_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AUK90597.1\|2969639_2970074_-	hypothetical protein	NA	NA	NA	NA
AUK90598.1\|2970075_2971320_-	hypothetical protein	NA	NA	NA	NA
AUK90599.1\|2971316_2972027_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK91733.1\|2972041_2972953_-	hypothetical protein	NA	NA	NA	NA
AUK90600.1\|2973315_2973720_+	hypothetical protein	NA	NA	NA	NA
AUK90601.1\|2973716_2974175_+	hypothetical protein	NA	NA	NA	NA
AUK90602.1\|2974181_2975090_+	hypothetical protein	NA	NA	NA	NA
AUK91734.1\|2975086_2975953_+	ABC transporter permease	NA	NA	NA	NA
AUK90603.1\|2975939_2976767_+	sugar ABC transporter permease	NA	NA	NA	NA
AUK90604.1\|2976777_2977905_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AUK90605.1\|2980262_2981525_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90606.1\|2981531_2982284_+	DNA-binding protein	NA	NA	NA	NA
AUK90607.1\|2982335_2982521_-	hypothetical protein	NA	NA	NA	NA
AUK91735.1\|2982796_2983261_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AUK90608.1\|2983340_2983952_+	3-methyladenine DNA glycosylase	NA	NA	NA	NA
AUK90609.1\|2984096_2986205_+	hypothetical protein	NA	NA	NA	NA
AUK90610.1\|2986201_2987104_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90611.1\|2987255_2987876_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUK91736.1\|2987979_2988720_+	oxidoreductase	NA	NA	NA	NA
AUK90612.1\|2989854_2990979_-	hypothetical protein	NA	NA	NA	NA
AUK90613.1\|2991024_2991393_-	hypothetical protein	NA	NA	NA	NA
AUK90614.1\|2991634_2992537_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90615.1\|2993620_2994163_-	hypothetical protein	NA	NA	NA	NA
AUK90616.1\|2994596_2995499_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90617.1\|2995495_2996404_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90618.1\|2996530_2997367_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
AUK90619.1\|2997879_2998989_+	porin	NA	NA	NA	NA
AUK90620.1\|2999050_2999953_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90621.1\|3000193_3000976_-	short-chain dehydrogenase	NA	NA	NA	NA
AUK90622.1\|3000989_3001754_-	short-chain dehydrogenase	A0A0M4JSW6	Mollivirus	3.1e-12	26.5
AUK90623.1\|3001766_3003113_-	MFS transporter	NA	NA	NA	NA
AUK90624.1\|3003138_3004068_-	acetylxylan esterase	NA	NA	NA	NA
AUK90625.1\|3004183_3005089_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90626.1\|3005106_3006306_-	aromatic amino acid aminotransferase	NA	NA	NA	NA
AUK90627.1\|3006378_3007071_-	hydrolase	A0A1D6Y7U0	Golden_Marseillevirus	4.7e-07	29.9
AUK90628.1\|3007119_3009546_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-86	33.8
AUK90629.1\|3009590_3010493_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3233512 : 3281130

Erwinia_phage(10.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90807.1\|3233512_3234463_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90808.1\|3234907_3235219_-	cell division protein ZapA	NA	NA	NA	NA
AUK90809.1\|3235218_3235749_-	hypothetical protein	NA	NA	NA	NA
AUK90810.1\|3235911_3236862_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90811.1\|3237151_3237616_+	tricarboxylate transporter	NA	NA	NA	NA
AUK90812.1\|3237630_3239136_+	hypothetical protein	NA	NA	NA	NA
AUK90813.1\|3239392_3240997_+	gamma-glutamyltransferase	NA	NA	NA	NA
AUK90814.1\|3241052_3241958_+	oxidoreductase	NA	NA	NA	NA
AUK90815.1\|3242398_3243301_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90816.1\|3243447_3244350_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90817.1\|3244479_3245061_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AUK91748.1\|3245485_3245791_+	RND transporter	NA	NA	NA	NA
AUK90818.1\|3245804_3247139_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
AUK90819.1\|3247160_3247700_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AUK90820.1\|3247847_3248312_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AUK90821.1\|3248454_3249570_-	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
AUK90822.1\|3249846_3250350_-	transcriptional repressor	NA	NA	NA	NA
AUK90823.1\|3250487_3250688_+	hypothetical protein	NA	NA	NA	NA
AUK90824.1\|3250678_3251401_+	ABC transporter	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
AUK90825.1\|3251397_3252294_+	zinc ABC transporter permease	NA	NA	NA	NA
AUK90826.1\|3252290_3253226_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90827.1\|3253186_3253855_+	hypothetical protein	NA	NA	NA	NA
AUK90828.1\|3253845_3254814_+	nickel transporter	NA	NA	NA	NA
AUK90829.1\|3254862_3257004_+	TonB-dependent receptor	NA	NA	NA	NA
AUK90830.1\|3257016_3257997_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.3e-14	30.5
AUK90831.1\|3258011_3258704_-	hypothetical protein	NA	NA	NA	NA
AUK90832.1\|3258730_3259642_-	diaminopimelate epimerase	NA	NA	NA	NA
AUK90833.1\|3259684_3260575_-	acyltransferase	NA	NA	NA	NA
AUK90834.1\|3260571_3261426_-	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
AUK90835.1\|3261709_3262873_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.0e-126	60.8
AUK90836.1\|3262983_3263235_+	DUF1289 domain-containing protein	NA	NA	NA	NA
AUK90837.1\|3263314_3264355_+	alpha-mannosyltransferase	NA	NA	NA	NA
AUK90838.1\|3264634_3266053_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
AUK90839.1\|3266123_3266459_+	hypothetical protein	NA	NA	NA	NA
AUK90840.1\|3266458_3267301_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AUK90841.1\|3267447_3268350_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90842.1\|3268414_3269386_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90843.1\|3269449_3270469_-	acetylpolyamine amidohydrolase	A0A2K9L473	Tupanvirus	3.4e-22	31.7
AUK90844.1\|3270470_3271811_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK91749.1\|3272121_3272802_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AUK91750.1\|3272877_3274941_+	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	5.3e-14	36.6
AUK90845.1\|3274937_3276032_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AUK90846.1\|3276046_3277237_-	hypothetical protein	NA	NA	NA	NA
AUK90847.1\|3277325_3279014_-	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.6e-48	32.9
AUK90848.1\|3279288_3280041_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AUK90849.1\|3280179_3281130_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3291057 : 3331007

Klosneuvirus(33.33%)

transposase,tRNA,protease,integrase

attL 3313854:3313872|attR 3333742:3333760

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90859.1\|3291057_3292008_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90860.1\|3292535_3293309_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90861.1\|3293441_3294452_-	LacI family transcriptional regulator	NA	NA	NA	NA
AUK90862.1\|3294603_3296259_-	gamma-glutamyltransferase	NA	NA	NA	NA
AUK90863.1\|3296313_3296655_-	cupin	NA	NA	NA	NA
AUK90864.1\|3296668_3298108_-	amine oxidase	NA	NA	NA	NA
AUK90865.1\|3298240_3299056_-	MerR family transcriptional regulator	NA	NA	NA	NA
AUK90866.1\|3299297_3300200_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90867.1\|3301593_3302535_+	hypothetical protein	NA	NA	NA	NA
AUK90868.1\|3302761_3303502_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUK90869.1\|3303587_3304490_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90870.1\|3305979_3307551_-	transcriptional regulator	NA	NA	NA	NA
AUK90871.1\|3307883_3309737_+	hypothetical protein	NA	NA	NA	NA
AUK90872.1\|3309781_3312346_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
3313854:3313872	attL	NA	NA	NA	NA
AUK90873.1\|3314498_3314783_-	hypothetical protein	A0A1V0SIN4	Klosneuvirus	6.8e-05	34.1
AUK90874.1\|3314864_3315776_-	hypothetical protein	NA	NA	NA	NA
AUK90875.1\|3315845_3316091_+	hypothetical protein	NA	NA	NA	NA
AUK90876.1\|3316319_3316577_-	hypothetical protein	NA	NA	NA	NA
AUK90877.1\|3317091_3317994_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90878.1\|3318225_3319437_-	chromosome segregation protein SMC	NA	NA	NA	NA
AUK90879.1\|3319452_3322404_-	site-specific DNA-methyltransferase	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
AUK91753.1\|3322405_3325162_-	restriction endonuclease	NA	NA	NA	NA
AUK90880.1\|3325672_3326719_-	cell filamentation protein Fic	NA	NA	NA	NA
AUK90881.1\|3327060_3328188_-\|integrase	integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
AUK90882.1\|3328467_3329559_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AUK90883.1\|3329631_3330414_-\|protease	CAAX protease	NA	NA	NA	NA
AUK90884.1\|3330410_3331007_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
3333742:3333760	attR	NA	NA	NA	NA

DBSCAN-SWA_26

3379993 : 3433638

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90921.1\|3379993_3380896_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90922.1\|3381300_3381945_-	urease accessory protein UreG	NA	NA	NA	NA
AUK90923.1\|3381969_3382554_-	urease accessory protein UreF	NA	NA	NA	NA
AUK90924.1\|3382654_3383272_-	urease accessory protein UreE	NA	NA	NA	NA
AUK90925.1\|3383274_3384990_-	urease subunit alpha	NA	NA	NA	NA
AUK90926.1\|3384986_3385295_-	urease subunit beta	NA	NA	NA	NA
AUK91757.1\|3385311_3385929_-	urease accessory protein UreJ	NA	NA	NA	NA
AUK90927.1\|3385973_3386276_-	urease subunit gamma	NA	NA	NA	NA
AUK90928.1\|3386376_3387231_-	urease accessory protein	NA	NA	NA	NA
AUK90929.1\|3388502_3388910_-	aldehyde-activating protein	NA	NA	NA	NA
AUK90930.1\|3389279_3390074_-	GntR family transcriptional regulator	NA	NA	NA	NA
AUK90931.1\|3390174_3391410_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AUK90932.1\|3391478_3392495_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUK90933.1\|3392506_3393883_+	hypothetical protein	NA	NA	NA	NA
AUK90934.1\|3393879_3395076_+	hypothetical protein	NA	NA	NA	NA
AUK90935.1\|3395072_3396611_-	SpoVR family protein	NA	NA	NA	NA
AUK90936.1\|3396607_3397867_-	hypothetical protein	NA	NA	NA	NA
AUK90937.1\|3399807_3400710_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90938.1\|3401524_3402619_-	CoA transferase	NA	NA	NA	NA
AUK90939.1\|3402611_3403946_-	CoA ligase	NA	NA	NA	NA
AUK90940.1\|3403899_3404583_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUK90941.1\|3404608_3405772_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK90942.1\|3405768_3406770_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUK90943.1\|3406769_3407642_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUK90944.1\|3407638_3408388_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AUK90945.1\|3408384_3409176_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AUK90946.1\|3409172_3410312_-	ABC transporter	NA	NA	NA	NA
AUK90947.1\|3410587_3411373_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AUK90948.1\|3411406_3412189_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK90949.1\|3412192_3412582_+	DNA-binding protein	NA	NA	NA	NA
AUK90950.1\|3413721_3414585_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AUK90951.1\|3414620_3415709_+	hypothetical protein	NA	NA	NA	NA
AUK90952.1\|3415705_3416608_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90953.1\|3417009_3419988_+	hypothetical protein	NA	NA	NA	NA
AUK90954.1\|3420914_3421793_+	fatty acid desaturase	NA	NA	NA	NA
AUK90955.1\|3421828_3422161_+	hypothetical protein	NA	NA	NA	NA
AUK90956.1\|3422139_3423660_+	hypothetical protein	NA	NA	NA	NA
AUK90957.1\|3423741_3424692_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90958.1\|3424688_3425156_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AUK90959.1\|3425198_3425969_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AUK90960.1\|3425989_3426790_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AUK90961.1\|3426800_3428210_+	lytic transglycosylase	NA	NA	NA	NA
AUK90962.1\|3428304_3429090_+	enoyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AUK91758.1\|3429329_3430346_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90963.1\|3430453_3430846_-	osmotically inducible protein OsmC	NA	NA	NA	NA
AUK90964.1\|3430983_3431664_+	hypothetical protein	NA	NA	NA	NA
AUK90965.1\|3431668_3432640_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90966.1\|3432735_3433638_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3439841 : 3499091

Acinetobacter_phage(27.27%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK90970.1\|3439841_3441605_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AUK90971.1\|3441716_3442595_+	septum site-determining protein MinC	NA	NA	NA	NA
AUK90972.1\|3442707_3443523_+	septum site-determining protein MinD	NA	NA	NA	NA
AUK90973.1\|3443526_3443778_+	cell division topological specificity factor MinE	NA	NA	NA	NA
AUK91759.1\|3443862_3444879_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90974.1\|3445209_3445431_-	hypothetical protein	NA	NA	NA	NA
AUK91760.1\|3447791_3448658_-	EamA family transporter	NA	NA	NA	NA
AUK90975.1\|3449206_3450415_-	ABC transporter permease	NA	NA	NA	NA
AUK90976.1\|3450494_3452066_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90977.1\|3452183_3453119_-	glycosyl transferase	NA	NA	NA	NA
AUK90978.1\|3453307_3454252_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AUK90979.1\|3454320_3454491_-	hypothetical protein	NA	NA	NA	NA
AUK90980.1\|3454819_3460537_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AUK90981.1\|3460542_3461670_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AUK90982.1\|3461725_3462352_+	aminotransferase	NA	NA	NA	NA
AUK91761.1\|3462623_3463640_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUK90983.1\|3463735_3464446_-	short-chain dehydrogenase	NA	NA	NA	NA
AUK91762.1\|3464442_3465432_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK90984.1\|3465527_3467159_+	acyl-CoA synthetase	NA	NA	NA	NA
AUK90985.1\|3467161_3467899_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK90986.1\|3468054_3468927_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AUK90987.1\|3469276_3470416_+	MFS transporter	NA	NA	NA	NA
AUK90988.1\|3470412_3471072_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AUK90989.1\|3471143_3471776_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AUK90990.1\|3471805_3472324_+	flavin reductase	NA	NA	NA	NA
AUK90991.1\|3472334_3473444_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AUK90992.1\|3473490_3474345_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AUK90993.1\|3474346_3475249_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK90994.1\|3476471_3477422_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90995.1\|3477518_3478652_-	hypothetical protein	NA	NA	NA	NA
AUK90996.1\|3478688_3478937_-	hypothetical protein	NA	NA	NA	NA
AUK90997.1\|3479176_3480166_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK90998.1\|3480341_3481130_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AUK90999.1\|3481126_3482158_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AUK91000.1\|3482176_3482740_-	anthranilate/aminodeoxychorismate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AUK91001.1\|3482795_3484316_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AUK91002.1\|3484579_3485284_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AUK91003.1\|3485291_3486020_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AUK91004.1\|3486134_3486509_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AUK91005.1\|3486551_3487841_+	hypothetical protein	NA	NA	NA	NA
AUK91006.1\|3487837_3489007_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AUK91007.1\|3489033_3489843_+	disulfide bond formation protein DsbC	NA	NA	NA	NA
AUK91008.1\|3489902_3490838_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AUK91009.1\|3490850_3491801_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91010.1\|3491899_3492862_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AUK91011.1\|3492893_3493253_-	dihydroneopterin aldolase	NA	NA	NA	NA
AUK91012.1\|3493377_3494280_+	oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AUK91763.1\|3494281_3496048_-	peptidase M61	NA	NA	NA	NA
AUK91013.1\|3496088_3496865_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91014.1\|3498188_3499091_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

3514077 : 3572150

Catovirus(12.5%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK91027.1\|3514077_3515028_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91028.1\|3515156_3516290_-	peptidase	NA	NA	NA	NA
AUK91029.1\|3516333_3517239_-	alpha/beta hydrolase	NA	NA	NA	NA
AUK91030.1\|3518938_3519859_-	peptide ABC transporter permease	NA	NA	NA	NA
AUK91031.1\|3519866_3520844_-	ABC transporter permease	NA	NA	NA	NA
AUK91032.1\|3520902_3521862_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AUK91033.1\|3523911_3524148_-	hypothetical protein	NA	NA	NA	NA
AUK91034.1\|3524274_3525138_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AUK91035.1\|3525226_3526048_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91036.1\|3526127_3526865_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91037.1\|3526861_3527854_-	2-nitropropane dioxygenase	NA	NA	NA	NA
AUK91766.1\|3528006_3528630_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUK91038.1\|3528674_3529823_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUK91039.1\|3532194_3533097_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91040.1\|3533437_3534388_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91041.1\|3534534_3535437_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91042.1\|3535733_3536231_+	hypothetical protein	NA	NA	NA	NA
AUK91043.1\|3536273_3538049_+	hypothetical protein	NA	NA	NA	NA
AUK91044.1\|3538056_3538923_+	copper resistance protein	NA	NA	NA	NA
AUK91045.1\|3538929_3539655_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91046.1\|3539824_3540055_+	hypothetical protein	NA	NA	NA	NA
AUK91047.1\|3540092_3540314_+	hypothetical protein	NA	NA	NA	NA
AUK91048.1\|3540833_3541604_-	IclR family transcriptional regulator	NA	NA	NA	NA
AUK91049.1\|3541917_3542508_+	cysteine dioxygenase	NA	NA	NA	NA
AUK91050.1\|3542541_3543870_-	amidase	NA	NA	NA	NA
AUK91051.1\|3543944_3545090_-	transporter	NA	NA	NA	NA
AUK91052.1\|3545201_3546200_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91053.1\|3546162_3546597_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AUK91054.1\|3548113_3548998_+	EamA family transporter	NA	NA	NA	NA
AUK91055.1\|3548994_3550200_-	cardiolipin synthase B	NA	NA	NA	NA
AUK91056.1\|3550196_3551057_-	endonuclease	NA	NA	NA	NA
AUK91057.1\|3551169_3552960_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AUK91767.1\|3553000_3553645_-	hypothetical protein	A0A2I7S9X1	Vibrio_phage	8.5e-11	28.4
AUK91058.1\|3553666_3553975_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AUK91768.1\|3554140_3555427_-	hypothetical protein	NA	NA	NA	NA
AUK91059.1\|3555553_3556813_-\|holin	choline dehydrogenase	A0A2I2L3D3	Orpheovirus	6.1e-13	27.6
AUK91060.1\|3556860_3557811_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91061.1\|3559762_3560977_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AUK91062.1\|3561082_3562072_+	D-arabinose 5-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AUK91063.1\|3562068_3562677_+	phenylphosphate carboxylase subunit delta	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AUK91064.1\|3562689_3563319_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AUK91065.1\|3563315_3563936_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AUK91066.1\|3563967_3564759_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AUK91067.1\|3565112_3565334_+	ribosomal subunit interface protein	NA	NA	NA	NA
AUK91068.1\|3565610_3566066_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AUK91069.1\|3566084_3567011_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AUK91070.1\|3567064_3568351_-	alcohol dehydrogenase	NA	NA	NA	NA
AUK91071.1\|3569281_3570154_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AUK91072.1\|3570150_3571101_+	hypothetical protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AUK91073.1\|3571247_3572150_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_29

3704321 : 3747492

Streptococcus_phage(11.11%)

transposase,tRNA,integrase

attL 3742331:3742349|attR 3748115:3748133

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK91183.1\|3704321_3705224_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91184.1\|3705371_3706274_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91185.1\|3706270_3706906_-	lysine transporter LysE	NA	NA	NA	NA
AUK91186.1\|3707035_3707935_+	transcriptional regulator ArgP	NA	NA	NA	NA
AUK91187.1\|3708030_3708522_+	hypothetical protein	NA	NA	NA	NA
AUK91188.1\|3708568_3709534_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91189.1\|3710667_3711909_+	2-aminoadipate aminotransferase	A0A1X9I5H2	Streptococcus_phage	1.9e-14	24.9
AUK91190.1\|3712022_3713039_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	3.5e-75	43.8
AUK91191.1\|3713073_3713550_-	hypothetical protein	NA	NA	NA	NA
AUK91192.1\|3713692_3714601_-	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
AUK91193.1\|3714714_3715827_-	DNA protecting protein DprA	S6BFL3	Thermus_phage	1.9e-21	35.0
AUK91776.1\|3715927_3716413_-	AsnC family transcriptional regulator	NA	NA	NA	NA
AUK91194.1\|3716549_3717800_+	kynureninase	NA	NA	NA	NA
AUK91195.1\|3717901_3718414_+	peptide deformylase	E3SLL2	Synechococcus_phage	8.5e-22	43.3
AUK91196.1\|3718512_3719463_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91197.1\|3719528_3720467_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.4e-09	35.7
AUK91198.1\|3720489_3721116_-	flavin-nucleotide-binding protein	NA	NA	NA	NA
AUK91199.1\|3721112_3721769_-	HAD family hydrolase	NA	NA	NA	NA
AUK91200.1\|3721765_3722368_-	hypothetical protein	NA	NA	NA	NA
AUK91201.1\|3722374_3722962_-	Rossman fold protein, TIGR00730 family	A0A2I2L3F0	Orpheovirus	1.1e-07	23.3
AUK91202.1\|3723142_3723712_+	bacterioferritin	NA	NA	NA	NA
AUK91203.1\|3723782_3725102_-	ribosomal protein S12 methylthiotransferase	NA	NA	NA	NA
AUK91204.1\|3725208_3725400_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AUK91205.1\|3725651_3726941_+	glycine/D-amino acid oxidase	NA	NA	NA	NA
AUK91206.1\|3727095_3728091_+	hypothetical protein	NA	NA	NA	NA
AUK91207.1\|3728175_3728850_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUK91208.1\|3728846_3729749_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91209.1\|3729958_3731200_+	ornithine--oxo-acid transaminase	A0A1V0SKB7	Klosneuvirus	4.0e-25	25.2
AUK91210.1\|3731196_3732141_+	arginase	A0A0N9R043	Chrysochromulina_ericina_virus	9.5e-27	33.3
AUK91211.1\|3732307_3733210_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91212.1\|3733169_3734099_-	hypothetical protein	NA	NA	NA	NA
AUK91213.1\|3734152_3734488_-	alkylhydroperoxidase	NA	NA	NA	NA
AUK91214.1\|3734532_3735297_-	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91215.1\|3735320_3736061_-	transcriptional regulator	NA	NA	NA	NA
AUK91216.1\|3736068_3737622_-	long-chain fatty acid--CoA ligase	A0A2K9L3I8	Tupanvirus	1.5e-13	22.6
AUK91217.1\|3737656_3738634_-	hypothetical protein	NA	NA	NA	NA
AUK91218.1\|3738906_3739488_-	ureidoglycolate hydrolase	NA	NA	NA	NA
AUK91219.1\|3739539_3746673_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
3742331:3742349	attL	NA	NA	NA	NA
AUK91220.1\|3746888_3747020_-	entericidin	NA	NA	NA	NA
AUK91777.1\|3747051_3747177_-	hypothetical protein	NA	NA	NA	NA
AUK91221.1\|3747285_3747492_-\|integrase	integrase	NA	NA	NA	NA
3748115:3748133	attR	NA	NA	NA	NA

DBSCAN-SWA_30

3753427 : 3789102

Burkholderia_phage(11.11%)

transposase,integrase

attL 3749966:3749983|attR 3794606:3794623

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3749966:3749983	attL	NA	NA	NA	NA
AUK91228.1\|3753427_3754330_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91229.1\|3754340_3754982_+	hypothetical protein	NA	NA	NA	NA
AUK91230.1\|3755148_3755391_+	hypothetical protein	NA	NA	NA	NA
AUK91231.1\|3755537_3756440_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91232.1\|3756475_3756943_+	hypothetical protein	Q3HQX1	Burkholderia_phage	2.1e-43	71.3
AUK91233.1\|3757176_3757554_+	hypothetical protein	NA	NA	NA	NA
AUK91234.1\|3757550_3757733_+	hypothetical protein	NA	NA	NA	NA
AUK91235.1\|3757736_3758723_+	DNA recombinase	H9C0R8	Aeromonas_phage	2.0e-67	57.3
AUK91236.1\|3758719_3759367_+	exonuclease	A0A0U2BXF3	Paracoccus_phage	2.0e-31	41.4
AUK91237.1\|3759424_3759952_+	hypothetical protein	NA	NA	NA	NA
AUK91238.1\|3759988_3761173_+	hypothetical protein	A0A291L9X3	Bordetella_phage	1.5e-24	37.8
AUK91239.1\|3761183_3761525_+	hypothetical protein	A0A0H5ARN8	Pseudomonas_phage	1.0e-10	45.3
AUK91240.1\|3761517_3761637_+	hypothetical protein	NA	NA	NA	NA
AUK91241.1\|3761637_3761838_+	hypothetical protein	NA	NA	NA	NA
AUK91242.1\|3761834_3762824_-\|integrase	integrase	A0A1B1P9F9	Acinetobacter_phage	4.4e-75	44.4
AUK91243.1\|3764310_3766281_-	hypothetical protein	NA	NA	NA	NA
AUK91244.1\|3766522_3766921_+	hypothetical protein	NA	NA	NA	NA
AUK91245.1\|3766929_3767853_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUK91246.1\|3768358_3769261_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91247.1\|3769491_3771183_-	membrane protein insertase YidC	NA	NA	NA	NA
AUK91248.1\|3771231_3771504_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	7.0e-15	52.2
AUK91249.1\|3771500_3771872_-	ribonuclease P protein component	NA	NA	NA	NA
AUK91250.1\|3771967_3772102_-	50S ribosomal protein L34	NA	NA	NA	NA
AUK91251.1\|3772507_3773917_+	chromosomal replication initiation protein DnaA	NA	NA	NA	NA
AUK91252.1\|3773919_3775029_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.2e-41	32.6
AUK91253.1\|3775123_3777577_+	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	2.3e-112	34.8
AUK91254.1\|3777695_3778487_-	IclR family transcriptional regulator	NA	NA	NA	NA
AUK91255.1\|3778606_3780034_+	amidase	NA	NA	NA	NA
AUK91778.1\|3780072_3781044_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91256.1\|3781128_3781332_+	hypothetical protein	NA	NA	NA	NA
AUK91257.1\|3781462_3782626_+	alpha-hydroxy-acid oxidizing enzyme	NA	NA	NA	NA
AUK91258.1\|3782713_3783559_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUK91259.1\|3785163_3786066_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91260.1\|3786062_3786407_-	hypothetical protein	NA	NA	NA	NA
AUK91261.1\|3786620_3786995_-	MerR family transcriptional regulator	NA	NA	NA	NA
AUK91262.1\|3787069_3788128_+	Zn-dependent hydrolase	NA	NA	NA	NA
AUK91263.1\|3788151_3789102_-\|transposase	IS481 family transposase	NA	NA	NA	NA
3794606:3794623	attR	NA	NA	NA	NA

DBSCAN-SWA_31

4027463 : 4080847

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUK91480.1\|4027463_4028414_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91481.1\|4028583_4029810_+	bifunctional ornithine acetyltransferase/N-acetylglutamate synthase	NA	NA	NA	NA
AUK91482.1\|4030009_4030876_+	AAA family ATPase	NA	NA	NA	NA
AUK91483.1\|4030868_4031831_+	NUDIX hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
AUK91484.1\|4031931_4032882_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91485.1\|4033028_4033931_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91486.1\|4034077_4034980_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91487.1\|4034976_4036470_-	RND transporter	NA	NA	NA	NA
AUK91488.1\|4036466_4039574_-	multidrug transporter subunit MdtC	NA	NA	NA	NA
AUK91489.1\|4039570_4042639_-	multidrug transporter subunit MdtC	NA	NA	NA	NA
AUK91490.1\|4042635_4043886_-	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AUK91491.1\|4044066_4044819_-	cell division protein ZapD	NA	NA	NA	NA
AUK91793.1\|4044860_4045505_-	dephospho-CoA kinase	NA	NA	NA	NA
AUK91492.1\|4045513_4046353_-	prepilin peptidase	NA	NA	NA	NA
AUK91493.1\|4046593_4047337_+	hypothetical protein	NA	NA	NA	NA
AUK91494.1\|4047419_4047767_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AUK91495.1\|4047864_4048707_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
AUK91496.1\|4048751_4049639_-	segregation/condensation protein A	NA	NA	NA	NA
AUK91497.1\|4049665_4049854_-	DUF3460 domain-containing protein	NA	NA	NA	NA
AUK91498.1\|4049951_4051409_+	MFS transporter	NA	NA	NA	NA
AUK91499.1\|4051395_4052922_+	glycerol kinase	NA	NA	NA	NA
AUK91500.1\|4052940_4053408_-	hypothetical protein	NA	NA	NA	NA
AUK91501.1\|4053407_4054430_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91502.1\|4054550_4055291_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
AUK91503.1\|4055345_4056446_-	amino acid ABC transporter permease	NA	NA	NA	NA
AUK91504.1\|4056447_4057638_-	amino acid ABC transporter permease	NA	NA	NA	NA
AUK91505.1\|4057757_4058774_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
AUK91506.1\|4059092_4059764_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	9.5e-29	38.2
AUK91507.1\|4059760_4060669_+	permease	NA	NA	NA	NA
AUK91508.1\|4060880_4061528_+	chemotaxis protein CheD	NA	NA	NA	NA
AUK91794.1\|4065388_4066456_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
AUK91509.1\|4066466_4067276_-	transcriptional regulator	NA	NA	NA	NA
AUK91510.1\|4067365_4068139_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AUK91511.1\|4068369_4069272_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AUK91512.1\|4069283_4070183_+	hypothetical protein	NA	NA	NA	NA
AUK91513.1\|4070172_4071327_+	acyl-CoA transferase	NA	NA	NA	NA
AUK91514.1\|4071366_4072779_+	hypothetical protein	NA	NA	NA	NA
AUK91515.1\|4072801_4073770_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUK91516.1\|4073771_4074596_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91517.1\|4074592_4075354_+	nitrobenzoate reductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	2.0e-19	31.0
AUK91518.1\|4075434_4076121_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUK91519.1\|4076318_4077302_+	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
AUK91520.1\|4077298_4078078_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUK91795.1\|4078165_4079398_+	CoA transferase	NA	NA	NA	NA
AUK91521.1\|4079944_4080847_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP017927

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection