CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025597	Mycobacterium tuberculosis strain GG-36-11 chromosome, complete genome	4 crisprs	csa3,c2c9_V-U4,cas3,DinG,WYL,cas4,DEDDh,cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6	9	38	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025597_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025597_9

3119155-3120509

TypeIII

II-B,III-A

Consensus_repeat	Method
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRT

18 spacers

cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of CP025597_9

>merge|CP025597|9|3119155-3120509|PILER-CR,CRISPRCasFinder,CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAAGTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGACTGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGACATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGACCCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACTTGCGCGCACAACGCATCCGCCATCCACGGGGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGGACTTGATCGACGCGAACCTGTCTGACGCGAACCTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGAGTTTCCGTCCCCTCTCGGGGTGAACCGCCCCGGTGA

>CP025597|9|1|3119155-3120364|PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGACTTGATCGACGCGAACCTGTCTGACGCGAACCT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP025597|9|7|3119155-3120438|CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGACTTGATCGACGCGAACCTGTCTGACGCGAACCT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP025597|9|3|3119155-3120509|CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGACTTGATCGACGCGAACCTGTCTGACGCGAACCT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGA
GTTTCCGTCCCCTCTCGGGGTGAACCGCCCCGGTGA

Protein	Signature genes	Signature genes Name	Protein_function
CP025597.1\|AUP68941.1\|3113627_3114782_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP025597.1\|AUP70304.1\|3123936_3124953_-\|CRISPR-associated-endonuclease-Cas1	cas1	COG1518_cas1_CAS-I:CAS-II:CAS-III	gnl\|CDD\|272998
CP025597.1\|AUP70302.1\|3112836_3113241_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68951.1\|3128222_3128933_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
CP025597.1\|AUP70303.1\|3111983_3112259_+\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
CP025597.1\|AUP68944.1\|3116108_3116717_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68952.1\|3128942_3129317_-\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
CP025597.1\|AUP68953.1\|3129313_3131743_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
CP025597.1\|AUP68949.1\|3126209_3127337_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	COG1332_csm5gr7_CAS-III-A	gnl\|CDD\|224251
CP025597.1\|AUP68954.1\|3131739_3132684_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838
CP025597.1\|AUP68943.1\|3115377_3115689_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68946.1\|3118193_3119006_+\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|225806
CP025597.1\|AUP68947.1\|3120535_3121797_-\|IS3-like-element-IS987-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP025597.1\|AUP68950.1\|3127333_3128242_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP025597.1\|AUP68948.1\|3123594_3123936_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG1343_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|224262
CP025597.1\|AUP68945.1\|3116787_3118197_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP025597.1\|AUP68940.1\|3113237_3113429_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68942.1\|3115015_3115273_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68939.1\|3112398_3112764_+\|histone-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
CP025597.1\|AUP70305.1\|3124965_3126114_-\|type-III-A-CRISPR-associated-protein-Csm6	csm6	cd09699_csm6_CAS-III-A	gnl\|CDD\|187830

Protein	Function_ID	Function_description	E-value
CP025597.1\|AUP68941.1\|3113627_3114782_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.81781e-16
CP025597.1\|AUP68939.1\|3112398_3112764_+\|histone-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	0.00179041
CP025597.1\|AUP68951.1\|3128222_3128933_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP025597.1\|AUP70303.1\|3111983_3112259_+\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	1.95042e-26
CP025597.1\|AUP68954.1\|3131739_3132684_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	4.02032e-78
CP025597.1\|AUP68953.1\|3129313_3131743_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
CP025597.1\|AUP68949.1\|3126209_3127337_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|224251	COG1332, COG1332, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.40728e-139
CP025597.1\|AUP68946.1\|3118193_3119006_+\|DUF2075-domain-containing-protein	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP025597.1\|AUP68947.1\|3120535_3121797_-\|IS3-like-element-IS987-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
CP025597.1\|AUP68950.1\|3127333_3128242_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.37381e-109
CP025597.1\|AUP68948.1\|3123594_3123936_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|224262	COG1343, COG1343, CRISPR-associated protein Cas2 [Defense mechanisms].	3.66595e-25
CP025597.1\|AUP68952.1\|3128942_3129317_-\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
CP025597.1\|AUP68945.1\|3116787_3118197_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28
CP025597.1\|AUP70304.1\|3123936_3124953_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|272998	TIGR00287, CRISPR-associated_endonuclease_Cas1, CRISPR-associated endonuclease Cas1. This model identifies CRISPR-associated protein Cas1, the most universal CRISPR system protein. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Cas1 is a metal-dependent DNA-specific endonuclease.	2.72742e-113
CP025597.1\|AUP70305.1\|3124965_3126114_-\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|187830	cd09699, Csm6_III-A, CRISPR/Cas system-associated protein Csm6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Protein of this family often fused to HTH domain; loosely associated with CRISPR/Cas systems.	0

>CP025597.1|AUP68946.1|3118193_3119006_+|DUF2075-domain-containing-protein
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP025597.1|AUP68945.1|3116787_3118197_+|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP025597.1|AUP68944.1|3116108_3116717_+|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP025597.1|AUP68943.1|3115377_3115689_+|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP025597.1|AUP68942.1|3115015_3115273_+|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP025597.1|AUP68941.1|3113627_3114782_+|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLEAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP025597.1|AUP68940.1|3113237_3113429_+|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>CP025597.1|AUP70302.1|3112836_3113241_+|hypothetical-protein
MGRGNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>CP025597.1|AUP68939.1|3112398_3112764_+|histone-acetyltransferase
MGALSRPAGSWVLRARHGEHRADPGAIAAGPGPTRPDPIPVLVLARLALDRQEQGTGLGGDLLLDALIRSVAGARHYGARALVVDAIDDRAAEFYGHHGFLPLEGRRLYRRISDIARALGV
>CP025597.1|AUP70303.1|3111983_3112259_+|DUF1778-domain-containing-protein
MPETLTGRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIELSEAAFRRFVAALDEPDEAAPELVRLARRKSRIPPH
>CP025597.1|AUP68947.1|3120535_3121797_-|IS3-like-element-IS987-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP025597.1|AUP68948.1|3123594_3123936_-|CRISPR-associated-endonuclease-Cas2
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF
>CP025597.1|AUP70304.1|3123936_3124953_-|CRISPR-associated-endonuclease-Cas1
MVQLYVSDSVSRISFADGRVIVWSEELGESQYPIETLDGITLFGRPTMTTPFIVEMLKRERDIQLFTTDGHYQGRISTPDVSYAPRLRQQVHRTDDPAFCLSLSKRIVSRKILNQQALIRAHTSGQDVAESIRTMKHSLAWVDRSGSLAELNGFEGNAAKAYFTALGHLVPQEFAFQGRSTRPPLDAFNSMVSLGYSLLYKNIIGAIERHSLNAYIGFLHQDSRGHATLASDLMEVWRAPIIDDTVLRLIADGVVDTRAFSKNSDTGAVFATREATRSIARAFGNRIARTATYIKGDPHRYTFQYALDLQLQSLVRVIEAGHPSRLVDIDITSEPSGA
>CP025597.1|AUP70305.1|3124965_3126114_-|type-III-A-CRISPR-associated-protein-Csm6
MLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSAEFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVSNLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPAITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDMAPLG
>CP025597.1|AUP68949.1|3126209_3127337_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE
>CP025597.1|AUP68950.1|3127333_3128242_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA
>CP025597.1|AUP68951.1|3128222_3128933_-|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>CP025597.1|AUP68952.1|3128942_3129317_-|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>CP025597.1|AUP68953.1|3129313_3131743_-|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE
>CP025597.1|AUP68954.1|3131739_3132684_-|CRISPR-associated-endoribonuclease-Cas6
MAARRGGIRRTDLLRRSGQPRGRHRASAAESGLTWISPTLILVGFSHRGDRRMTEHLSRLTLTLEVDAPLERARVATLGPHLHGVLMESIPADYVQTLHTVPVNPYSQYALARSTTSLEWKISTLTNEARQQIVGPINDAAFAGFRLRASGIATQVTSRSLEQNPLSQFARIFYARPETRKFRVEFLTPTAFKQSGEYVFWPDPRLVFQSLAQKYGAIVDGEEPDPGLIAEFGQSVRLSAFRVASAPFAVGAARVPGFTGSATFTVRGVDTFASYIAALLWFGEFSGCGIKASMGMGAIRVQPLAPREKCVPKP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025597_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025597_10

3121832-3123546

TypeIII

II-B,III-A

Consensus_repeat	Method
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	PILER-CR

23 spacers

cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of CP025597_10

>merge|CP025597|10|3121832-3123546|CRISPRCasFinder,CRT,PILER-CR
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGACTCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGGCGATTTACGACGCTGACGGGAACTCGTGCGAATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCGCGAAATTCACTGCGCGTTATTCAAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGCGAATCCGCTGTCAGCACATGGGATTCCGAGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTAGAAGGCGATCACTGGAAGCACGGCGCTTGCGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP025597|10|8|3121832-3123546|CRISPRCasFinder
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGAC	TCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCGAATCCGCTGTCAGCACATGGGATTCCGAGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TAGAAGGCGATCACTGGAAGCACGGCGCTTGCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP025597|10|4|3121832-3123546|CRT
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGAC	TCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCGAATCCGCTGTCAGCACATGGGATTCCGAGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TAGAAGGCGATCACTGGAAGCACGGCGCTTGCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP025597|10|2|3121908-3123546|PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGA	GCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGT	GGGGAGAGGGAATGGCAATGATGGTCGACGAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCG	GACAGCATCTCCCCGGGCGGGCAGCAGATATCCCATGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGAC	CCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGG	AAGTCAACTAGAGCGGGTGTCGAACGCTGCCCGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGC	GAATCCGCTGTCAGCACATGGGATTCCGAGTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAG	GCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGCGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCAGC	GCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGC	TGAAATTGAAGCCGGAAATGACGACGCATTGGTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAA	GCCCGCTAATCCCGCACAAGTGGTCAGAAAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGA	TGATTGGTCGGCGTATGACGTGCTACTGAGGTGTTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTAGA	AGGCGATCACTGGAAGCACGGCGCTTGCGAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGG	TCAAAAGCTGTCGCCCAAGCATGAGGCAAAAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGA	CTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGTGC	AAGAATTCCGGGTTGCAGTGCAACACGGTTTTAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025597.1\|AUP68941.1\|3113627_3114782_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP025597.1\|AUP70304.1\|3123936_3124953_-\|CRISPR-associated-endonuclease-Cas1	cas1	COG1518_cas1_CAS-I:CAS-II:CAS-III	gnl\|CDD\|272998
CP025597.1\|AUP68939.1\|3112398_3112764_+\|histone-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
CP025597.1\|AUP68951.1\|3128222_3128933_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
CP025597.1\|AUP68944.1\|3116108_3116717_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68952.1\|3128942_3129317_-\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
CP025597.1\|AUP68953.1\|3129313_3131743_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
CP025597.1\|AUP68949.1\|3126209_3127337_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	COG1332_csm5gr7_CAS-III-A	gnl\|CDD\|224251
CP025597.1\|AUP68954.1\|3131739_3132684_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838
CP025597.1\|AUP68943.1\|3115377_3115689_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68946.1\|3118193_3119006_+\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|225806
CP025597.1\|AUP68947.1\|3120535_3121797_-\|IS3-like-element-IS987-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP025597.1\|AUP68950.1\|3127333_3128242_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP025597.1\|AUP68948.1\|3123594_3123936_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG1343_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|224262
CP025597.1\|AUP68945.1\|3116787_3118197_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP025597.1\|AUP68940.1\|3113237_3113429_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP68942.1\|3115015_3115273_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP70306.1\|3132861_3133407_-\|DUF1802-domain-containing-protein	unknown	unknown	gnl\|CDD\|226743
CP025597.1\|AUP70302.1\|3112836_3113241_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP70305.1\|3124965_3126114_-\|type-III-A-CRISPR-associated-protein-Csm6	csm6	cd09699_csm6_CAS-III-A	gnl\|CDD\|187830

Protein	Function_ID	Function_description	E-value
CP025597.1\|AUP68941.1\|3113627_3114782_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.81781e-16
CP025597.1\|AUP68951.1\|3128222_3128933_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP025597.1\|AUP68954.1\|3131739_3132684_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	4.02032e-78
CP025597.1\|AUP68939.1\|3112398_3112764_+\|histone-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	0.00179041
CP025597.1\|AUP68953.1\|3129313_3131743_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
CP025597.1\|AUP68949.1\|3126209_3127337_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|224251	COG1332, COG1332, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.40728e-139
CP025597.1\|AUP68946.1\|3118193_3119006_+\|DUF2075-domain-containing-protein	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP025597.1\|AUP68947.1\|3120535_3121797_-\|IS3-like-element-IS987-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
CP025597.1\|AUP68950.1\|3127333_3128242_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.37381e-109
CP025597.1\|AUP68948.1\|3123594_3123936_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|224262	COG1343, COG1343, CRISPR-associated protein Cas2 [Defense mechanisms].	3.66595e-25
CP025597.1\|AUP68952.1\|3128942_3129317_-\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
CP025597.1\|AUP68945.1\|3116787_3118197_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28
CP025597.1\|AUP70306.1\|3132861_3133407_-\|DUF1802-domain-containing-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	1.13775e-85
CP025597.1\|AUP70304.1\|3123936_3124953_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|272998	TIGR00287, CRISPR-associated_endonuclease_Cas1, CRISPR-associated endonuclease Cas1. This model identifies CRISPR-associated protein Cas1, the most universal CRISPR system protein. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Cas1 is a metal-dependent DNA-specific endonuclease.	2.72742e-113
CP025597.1\|AUP70305.1\|3124965_3126114_-\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|187830	cd09699, Csm6_III-A, CRISPR/Cas system-associated protein Csm6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Protein of this family often fused to HTH domain; loosely associated with CRISPR/Cas systems.	0

>CP025597.1|AUP68947.1|3120535_3121797_-|IS3-like-element-IS987-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP025597.1|AUP68946.1|3118193_3119006_+|DUF2075-domain-containing-protein
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP025597.1|AUP68945.1|3116787_3118197_+|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP025597.1|AUP68944.1|3116108_3116717_+|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP025597.1|AUP68943.1|3115377_3115689_+|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP025597.1|AUP68942.1|3115015_3115273_+|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP025597.1|AUP68941.1|3113627_3114782_+|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLEAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP025597.1|AUP68940.1|3113237_3113429_+|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>CP025597.1|AUP70302.1|3112836_3113241_+|hypothetical-protein
MGRGNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>CP025597.1|AUP68939.1|3112398_3112764_+|histone-acetyltransferase
MGALSRPAGSWVLRARHGEHRADPGAIAAGPGPTRPDPIPVLVLARLALDRQEQGTGLGGDLLLDALIRSVAGARHYGARALVVDAIDDRAAEFYGHHGFLPLEGRRLYRRISDIARALGV
>CP025597.1|AUP68948.1|3123594_3123936_-|CRISPR-associated-endonuclease-Cas2
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF
>CP025597.1|AUP70304.1|3123936_3124953_-|CRISPR-associated-endonuclease-Cas1
MVQLYVSDSVSRISFADGRVIVWSEELGESQYPIETLDGITLFGRPTMTTPFIVEMLKRERDIQLFTTDGHYQGRISTPDVSYAPRLRQQVHRTDDPAFCLSLSKRIVSRKILNQQALIRAHTSGQDVAESIRTMKHSLAWVDRSGSLAELNGFEGNAAKAYFTALGHLVPQEFAFQGRSTRPPLDAFNSMVSLGYSLLYKNIIGAIERHSLNAYIGFLHQDSRGHATLASDLMEVWRAPIIDDTVLRLIADGVVDTRAFSKNSDTGAVFATREATRSIARAFGNRIARTATYIKGDPHRYTFQYALDLQLQSLVRVIEAGHPSRLVDIDITSEPSGA
>CP025597.1|AUP70305.1|3124965_3126114_-|type-III-A-CRISPR-associated-protein-Csm6
MLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSAEFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVSNLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPAITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDMAPLG
>CP025597.1|AUP68949.1|3126209_3127337_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE
>CP025597.1|AUP68950.1|3127333_3128242_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA
>CP025597.1|AUP68951.1|3128222_3128933_-|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>CP025597.1|AUP68952.1|3128942_3129317_-|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>CP025597.1|AUP68953.1|3129313_3131743_-|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE
>CP025597.1|AUP68954.1|3131739_3132684_-|CRISPR-associated-endoribonuclease-Cas6
MAARRGGIRRTDLLRRSGQPRGRHRASAAESGLTWISPTLILVGFSHRGDRRMTEHLSRLTLTLEVDAPLERARVATLGPHLHGVLMESIPADYVQTLHTVPVNPYSQYALARSTTSLEWKISTLTNEARQQIVGPINDAAFAGFRLRASGIATQVTSRSLEQNPLSQFARIFYARPETRKFRVEFLTPTAFKQSGEYVFWPDPRLVFQSLAQKYGAIVDGEEPDPGLIAEFGQSVRLSAFRVASAPFAVGAARVPGFTGSATFTVRGVDTFASYIAALLWFGEFSGCGIKASMGMGAIRVQPLAPREKCVPKP
>CP025597.1|AUP70306.1|3132861_3133407_-|DUF1802-domain-containing-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHKLAVLVVSAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025597_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025597_11

3740642-3741183

Orphan

Consensus_repeat	Method
CCGCCGTTNCCNCCGTTGCCGCC	CRT

7 spacers

The CRISPR arrays of CP025597_11

>merge|CP025597|11|3740642-3741183|CRT
CCGCCGTTGCCGCCGGCACCGCCGTTGCCGGCCTTAGCGAACGTGGCGAAGGCGTCACCACCCTTGCCGCCGATGCCGCCGTTGCCGCCGTTGCCGCCCTGTCCGCCATTCGCGCCATTGGCGGACGCGGAGAAGTCTTGGCCGTTGGCTCCGGCGCCCCCGTTGCCGCCCTTGCCGCCGTCCCCGCCCGTGCCGGCCGCCGATCCGCCGTTGCCGCCGATGCCGCCGTTGCCGCCGTTGCCGCCGTTGAGGGCAAGGCCGGTGCCGGCGACGCCATTTCCGCCGGCACCACCCGCACCGCCGTTACCGACCGACCCGCCATGGCCGCCGTTACCACCGGCGCCGCCGTTTTCTCCCGCGACGGTGGGGGTGGCGCCGGCACCTCCGTTGCCACCGTTGCCGCCGCTGGTGGGCGCGGTGCCGTTCGCCCCGGCCGAACCGTTCAGGGCCGGGTTCGCGCTAACACCGCCGGCCCCACCCTTGCCGCCAACGCCCACTTCACCGCCGTTGCCGCCGTCACCGCCGGCACCCTGGTTGACGGC

>CP025597|11|5|3740642-3741183|CRT
CCGCCGTTGCCGCCGGCACCGCC	GTTGCCGGCCTTAGCGAACGTGGCGAAGGCGTCACCACCCTTGCCGCCGATG
CCGCCGTTGCCGCCGTTGCCGCC	CTGTCCGCCATTCGCGCCATTGGCGGACGCGGAGAAGTCTTGGCCGTTGGCTCCGGCG
CCCCCGTTGCCGCCCTTGCCGCC	GTCCCCGCCCGTGCCGGCCGCCGATCCGCCGTTGCCGCCGATG
CCGCCGTTGCCGCCGTTGCCGCC	GTTGAGGGCAAGGCCGGTGCCGGCGACGCCATTTCCGCCGGCACCACCCGCACCGCCGTTACCGACCGACCCGCCATGG
CCGCCGTTACCACCGGCGCCGCC	GTTTTCTCCCGCGACGGTGGGGGTGGCGCCGGCA
CCTCCGTTGCCACCGTTGCCGCC	GCTGGTGGGCGCGGTGCCGTTCGCCCCGGCCGAACCGTTCAGGGCCGGGTTCGCGCTAACA
CCGCCGGCCCCACCCTTGCCGCC	AACGCCCACTTCACCGCCGTTGCCGCCGTCA
CCGCCGGCACCCTGGTTGACGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP025597.1\|AUP69432.1\|3729320_3736892_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
CP025597.1\|AUP69431.1\|3727444_3728584_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
CP025597.1\|AUP69434.1\|3743667_3753141_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
CP025597.1\|AUP70381.1\|3753766_3754213_+\|transposase	unknown	unknown	gnl\|CDD\|376564
CP025597.1\|AUP69435.1\|3754249_3755068_-\|transposase	unknown	unknown	gnl\|CDD\|376574
CP025597.1\|AUP69433.1\|3743154_3743412_-\|DUF3017-domain-containing-protein	unknown	unknown	gnl\|CDD\|378602
CP025597.1\|AUP69437.1\|3755908_3767059_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
CP025597.1\|AUP69438.1\|3767302_3768097_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|369658
CP025597.1\|AUP70380.1\|3728580_3729312_+\|methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025597.1\|AUP69427.1\|3722577_3723588_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|234866
CP025597.1\|AUP69439.1\|3768178_3768550_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
CP025597.1\|AUP69430.1\|3726083_3727433_+\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	unknown	unknown	gnl\|CDD\|236105
CP025597.1\|AUP69425.1\|3721213_3721654_+\|Zn(2+)-responsive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133398
CP025597.1\|AUP70379.1\|3720715_3721195_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP69429.1\|3724571_3725801_-\|isocitrate-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|236226
CP025597.1\|AUP69428.1\|3723872_3724505_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|184875
CP025597.1\|AUP69426.1\|3721687_3722557_-\|inner-membrane-protein-YhjD	unknown	unknown	gnl\|CDD\|188082
CP025597.1\|AUP70382.1\|3753178_3753670_-\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP69436.1\|3755284_3755521_-\|transposase	unknown	unknown	unknown
CP025597.1\|AUP69440.1\|3768447_3768858_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|366708

Protein	Function_ID	Function_description	E-value
CP025597.1\|AUP69432.1\|3729320_3736892_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	4.88392e-84
CP025597.1\|AUP69431.1\|3727444_3728584_+\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
CP025597.1\|AUP69434.1\|3743667_3753141_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	9.98029e-79
CP025597.1\|AUP70381.1\|3753766_3754213_+\|transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.45693e-11
CP025597.1\|AUP69435.1\|3754249_3755068_-\|transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.05794e-20
CP025597.1\|AUP69438.1\|3767302_3768097_-\|oxidoreductase	gnl\|CDD\|369658	pfam08031, BBE, Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.	2.38492e-05
CP025597.1\|AUP69437.1\|3755908_3767059_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	8.49736e-80
CP025597.1\|AUP70380.1\|3728580_3729312_+\|methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.03104e-26
CP025597.1\|AUP69427.1\|3722577_3723588_-\|tryptophan--tRNA-ligase	gnl\|CDD\|234866	PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed.	0
CP025597.1\|AUP69430.1\|3726083_3727433_+\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	gnl\|CDD\|236105	PRK07812, PRK07812, O-acetylhomoserine aminocarboxypropyltransferase; Validated.	0
CP025597.1\|AUP69425.1\|3721213_3721654_+\|Zn(2+)-responsive-transcriptional-regulator	gnl\|CDD\|133398	cd04770, HTH_HMRTR, Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper), CadR (cadmium), PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.31191e-56
CP025597.1\|AUP69433.1\|3743154_3743412_-\|DUF3017-domain-containing-protein	gnl\|CDD\|378602	pfam11222, DUF3017, Protein of unknown function (DUF3017). This bacterial family of proteins with unknown function appear to be restricted to Actinobacteria.	3.92596e-11
CP025597.1\|AUP69429.1\|3724571_3725801_-\|isocitrate-dehydrogenase-(NADP(+))	gnl\|CDD\|236226	PRK08299, PRK08299, NADP-dependent isocitrate dehydrogenase.	0
CP025597.1\|AUP69428.1\|3723872_3724505_+\|alpha/beta-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	1.23792e-15
CP025597.1\|AUP69426.1\|3721687_3722557_-\|inner-membrane-protein-YhjD	gnl\|CDD\|188082	TIGR00766, Uncharacterized_protein_Dda3937_02003, inner membrane protein YhjD. This family, including YhjD in E. coli, is a conserved inner membrane protein homologous YihY, which in turn was incorrectly assigned to be ribonuclease BN. This, any suggestion this family is similar to ribonucleases should be removed. [Transcription, Degradation of RNA].	3.67774e-123
CP025597.1\|AUP69439.1\|3768178_3768550_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	7.3689e-14
CP025597.1\|AUP69440.1\|3768447_3768858_-\|FAD-binding-protein	gnl\|CDD\|366708	pfam01565, FAD_binding_4, FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.	4.01471e-07

>CP025597.1|AUP69432.1|3729320_3736892_-|PPE-family-protein
MSFVVMPPEINSLLIYTGAGPGPLLAAAAAWDELAAELGSAAAAFGSVTSGLVGGIWQGPSSVAMAAAAAPYAGWLSAAAASAESAAGQARAVVGVFEAALAATVDPFVIAANRSRLVSLALSNLFGQNTPAIAAAEFDYELMWAQDVAAMLGYHTGASAAAEALAPFGSPLASLAAAAEPAKSLAVNLGLANVGLFNAGSGNVGSYNVGAGNVGSYNVGGGNIGGNNVGLGNVGWGNFGLGNSGLTPGLMGLGNIGFGNAGSYNFGLANMGVGNIGFANTGSGNFGIGLTGDNLTGFGGFNTGSGNVGLFNSGTGNVGFFNSGTGNWGVFNSGSYNTGIGNSGIASTGLFNAGGFNTGVVNAGSYNTGSFNAGEANTGGFNPGSVNTGWLNTGDINTGVANSGDVNTGAFISGNYSNGVLWRGDYQGLLGFSSGANVLPVIPLSLDINGGVGAITIEPIHILPDIPININETLYLGPLVVPPINVPAISLGVGIPNISIGPIKINPITLWPAQNFNQTITLAWPVSSITIPQIQQVALSPSPIPTTLIGPIHINTGFSIPVTFSYSTPALTLFPVGLSIPTGGPLTLTLGVTAGTEAFTIPGFSIPEQPLPLAINVIGHINALSTPAITIDNIPLNLHAIGGVGPVDIVGGNVPASPGFGNSTTAPSSGFFNTGAGGVSGFGNVGAHTSGWFNQSTQAMQVLPGTVSGYFNSGTLMSGIGNVGTQLSGMLSGGALGGNNFGLGNIGFDNVGFGNAGSSNFGLANMGIGNIGLANTGNGNIGIGLSGDNLTGFGGFNSGSENVGLFNSGTGNVGFFNSGTGNLGVFNSGSHNTGFFLTGNNINVLAPFTPGTLFTISEIPIDLQVIGGIGPIHVQPIDIPAFDIQITGGFIGIREFTLPEITIPAIPIHVTGTVGLEGFHVNPAFVLFGQTAMAEITADPVVLPDPFITIDHYGPPLGPPGAKFPSGSFYLSISDLQINGPIIGSYGGPGTIPGPFGATFNLSTSSLALFPAGLTVPDQTPVTVNLTGGLDSITLFPGGLAFPENPVVSLTNFSVGTGGFTVFPQGFTVDRIPVDLHTTLSIGPFPFRWDYIPPTPANGPIPAVPGGFGLTSGLFPFHFTLNGGIGPISIPTTTVVDALNPLLTVTGNLEVGPFTVPDIPIPAINFGLDGNVNVSFNAPATTLLSGLGITGSIDISGIQITNIQTQPAQLFMSVGQTLFLFDFRDGIELNPIVIPGSSIPITMAGLSIPLPTVSESIPLNFSFGSPASTVKSMILHEILPIDVSINLEDAVFIPATVLPAIPLNVDVTIPVGPINIPIITEPGSGNSTTTTSDPFSGLAVPGLGVGLLGLFDGSIANNLISGFNSAVGIVGPNVGLSNLGGGNVGLGNVGDFNLGAGNVGGFNVGGGNIGGNNVGLGNVGFGNVGLANSGLTPGLMGLGNIGFGNAGSYNFGLANMGVGNIGFANTGSGNFGIGLTGDNLTGFGGFNTGSGNVGLFNSGTGNVGFFNSGTGNWGVFNSGSYNTGIGNSGIASTGLFNAGGFNTGVVNAGSYNTGSFNAGQANTGGFNPGSVNTGWLNTGDINTGVANSGDVNTGAFISGNYSNGAFWRGDYQGLLGFSYRPAVLPQTPFLDLTLTGGLGSVVIPAIDIPAIRPEFSANVAIDSFTVPSIPIPQIDLAATTVSVGLGPITVPHLDIPRVPVTLNYLFGSQPGGPLKIGPITGLFNTPIGLTPLALSQIVIGASSSQGTITAFLANLPFSTPVVTIDEIPLLASITGHSEPVDIFPGGLTIPAMNPLSINLSGGTGAVTIPAITIGEIPFDLVAHSTLGPVHILIDLPAVPGFGNTTGAPSSGFFNSGAGGVSGFGNVGAMVSGGWNQAPSALLGGGSGVFNAGTLHSGVLNFGSGMSGLFNTSVLGLGAPALVSGLGSVGQQLSGLLASGTALHQGLVLNFGLADVGLGNVGLGNVGDFNLGAGNVGGFNVGGGNIGGNNVGLGNVGWGNFGLGNSGLTPGLMGLGNIGFGNAGSYNFGLANMGVGNIGFANTGSGNFGIGLTGDNLTGFGGFNTGSGNVGLFNSGTGNVGFFNSGTGNWGVFNSGSYNTGIGNSGIASTGLFNAGGFNTGVVNAGSYNTGSFNAGQANTGGFNPGSVNTGWLNTGDINTGVANSGDVNTGAFISGNYSNGAFWRGDYQGLLGFSYTSTIIPEFTVANIHASGGAGPIIVPSIQFPAIPLDLSATGHIGGFTIPPVSISPITVRIDPVFDLGPITVQDITIPALGLDPATGVTVGPIFSSGSIIDPFSLTLLGFINVNVPAIQTAPSEILPFTVLLSSLGVTHLTPEITIPGFHIPVDPIHVELPLSVTIGPFVSPEITIPQLPLGLALSGATPAFAFPLEITIDRIPVVLDVNALLGPINAGLVIPPVPGFGNTTAVPSSGFFNIGGGGGLSGFHNLGAGMSGVLNAISDPLLGSASGFANFGTQLSGILNRGADISGVYNTGALGLITSALVSGFGNVGQQLAGLIYTGTGP
>CP025597.1|AUP70380.1|3728580_3729312_+|methyltransferase
MTCSRRDMSLSFGSAVGAYERGRPSYPPEAIDWLLPAAARRVLDLGAGTGKLTTRLVERGLDVVAVDPIPEMLDVLRAALPQTVALLGTAEEIPLDDNSVDAVLVAQAWHWVDPARAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGEIIGRDGDPVRDRVTLPEPFTTVQRHQVEWTNYLTPQALIDLVASRSYCITSPAQVRTKTLDRVRQLLATHPALANSNGLALPYVTVCVRATLA
>CP025597.1|AUP69431.1|3727444_3728584_+|homoserine-O-acetyltransferase
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHALTGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGKPWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLLAVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIELDTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGGVSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAVGELIRQTLGLADREGACRR
>CP025597.1|AUP69430.1|3726083_3727433_+|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase
MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQRIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNTKAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFDWTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAARDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSPAEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
>CP025597.1|AUP69429.1|3724571_3725801_-|isocitrate-dehydrogenase-(NADP(+))
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGGVVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
>CP025597.1|AUP69428.1|3723872_3724505_+|alpha/beta-hydrolase
MLADHVERQLDELGWETSHIVGNSLGGWVAFELERRGRARSVTGIAPAGGWTRWSPVKFEVIAKFIAGAPILAVAHILGQRALRLPFSRLLATLPISATPDGVSERELSGIIDDAAHCPAYFQLLVKALVLPGLQELEHTAVPSHVVLCEQDRVVPPSRFSRHFTDSLPAGHRLTVLDGVGHVPMFEAPGRITELITSFIEECCPHVRAS
>CP025597.1|AUP69427.1|3722577_3723588_-|tryptophan--tRNA-ligase
MSTPTGSRRIFSGVQPTSDSLHLGNALGAVAQWVGLQDDHDAFFCVVDLHAITIPQDPEALRRRTLITAAQYLALGIDPGRATIFVQSQVPAHTQLAWVLGCFTGFGQASRMTQFKDKSARQGSEATTVGLFTYPVLQAADVLAYDTELVPVGEDQRQHLELARDVAQRFNSRFPGTLVVPDVLIPKMTAKIYDLQDPTSKMSKSAGTDAGLINLLDDPALSAKKIRSAVTDSERDIRYDPDVKPGVSNLLNIQSAVTGTDIDVLVDGYAGHGYGDLKKDTAEAVVEFVNPIQARVDELTADPAELEAVLAAGAQRAHDVASKTVQRVYDRLGFLL
>CP025597.1|AUP69426.1|3721687_3722557_-|inner-membrane-protein-YhjD
MGELAEPGVLDRLRARFGWLDHVVRAFTRFNDRNGSLFAAGLTYYTIFAIFPLLMVGFGVGGFALSRRPELLTTLEERIRTSVSGAVGQQLVDLMNSAIDARASVGVIGLATAAWVGLGWMWHLREALSQMWAHPVAPAGYLRTKLSDLAAMVGTFVVIVATIALTVLGHARPMAAVLRWLEIPQFSVFDEIFRGISVLVSVLVSWVLFTWMIGRLPREPVGLVTAARAGLMAAVGFELFKQVGAIYLQIVLRSPAGAVFGPVLGLMVFAFVTAWLILFATAWAATASA
>CP025597.1|AUP69425.1|3721213_3721654_+|Zn(2+)-responsive-transcriptional-regulator
MKISEVAALTNTSTKTLRFYENSGLLPPPARTASGYRNYGPEIVDRLRFIHRGQAAGLALQEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIALEGHLQTLLDHASYGPPTEHDHSTVCWILESDLDEPTAIEVSDIHA
>CP025597.1|AUP70379.1|3720715_3721195_+|hypothetical-protein
MASDAGEHDGVSVLLKAVTWRALDRDPRHRCGCLVRFDRRHDVVSQRRCSLGGDQGMGALRSQIQRTTPEPLAEAHPQAFDPAPVVGMGACRRNQRMVIVASGARPARAHAVRCRWLFSSGNSFPQAAIQRYGLTEIRLVTIARTAGGSHVPSVNLLVH
>CP025597.1|AUP69433.1|3743154_3743412_-|DUF3017-domain-containing-protein
MTVRAVLRRTVGAQWPILAGVNFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
>CP025597.1|AUP69434.1|3743667_3753141_-|PPE-family-protein
MNFPVLPPEINSVLMYSGAGSSPLLAAAAAWDGLAEELGSAAVSFGQVTSGLTAGVWQGAAAAAMAAAAAPYAGWLGSVAAQAVAVAGQARAAVAAFEAALAATVDPAAVAVNRMAMRALAMSNLLGQNAAAIAAVEAEYELMWAADVAAMAGYHSGASAAAAALPAFSPPAQALGGGVGAFLNALFAGPAKMLRLNAGLGNVGNYNVGLGNVGIFNLGAANVGAQNLGAANAGSGNFGFGNIGNANFGFGNSGLGLPPGMGNIGLGNAGSSNYGLANLGVGNIGFANTGSNNIGIGLTGDNLTGIGGLNSGTGNLGLFNSGTGNIGFFNSGTGNFGVFNSGSYNTGVGNAGTASTGLFNVGGFNTGVANVGSYNTGSFNAGNTNTGGFNPGNVNTGWLNTGNTNTGIANSGNVNTGAFISGNFSNGVLWRGDYEGLWGLSGGSTIPAIPIGLELNGGVGPITVLPIQILPTIPLNIHQTFSLGPLVVPDIVIPAFGGGTAIPISVGPITISPITLFPAQNFNTTFPVGPFFGLGVVNISGIEIKDLAGNVTLQLGNLNIDTRINQSFPVTVNWSTPAVTIFPNGISIPNNPLALLASASIGTLGFTIPGFTIPAAPLPLTIDIDGQIDGFSTPPITIDRIPLNLGASVTVGPILINGVNIPATPGFGNTTTAPSSGFFNSGDGGVSGFGNFGAGSSGWWNQAQTEVAGAGSGFANFGSLGSGVLNFGSGVSGLYNTGGLPPGTPAVVSGIGNVGEQLSGLSSAGTALNQSLIINLGLADVGSVNVGFGNVGDFNLGAANIGDLNVGLGNVGGGNVGFGNIGDANFGLGNAGLAAGLAGVGNIGLGNAGSGNVGFGNMGVGNIGFGNTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNVGLFNSGTGNFGLFNSGSFNTGIGNGGTGSTGLFNAGNFNTGVANPGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGVANSGNVDTGALMSGNFSNGILWRGNFEGLFGLNVGITIPEFPIHWTSTGGIGPIIIPDTTILPPIHLGLTGQANYGFAVPDIPIPAIHIDFDGAADAGFTAPATTLLSALGITGQFRFGPITVSNVQLNPFNVNLKLQFLHDAFPNEFPDPTISVQIQVAIPLTSATLGGLALPLQQTIDAIELPAISFSQSIPIDIPPIDIPASTINGISMSEVVPIDVSVDIPAVTITGTRIDPIPLNFDVLSSAGPINISIIDIPALPGFGNSTELPSSGFFNTGGGGGSGIANFGAGVSGLLNQASSPMVGTLSGLGNAGSLASGVLNSGVDISGMFNVSTLGSAPAVISGFGNLGNHVSGVSIDGLLAMLTSGGSGGSGQPSIIDAAIAELRHLNPLNIVNLGNVGSYNLGFANVGDVNLGAGNLGNLNLGGGNLGGQNLGLGNLGDGNVGFGNLGHGNVGFGNSGLGALPGIGNIGLGNAGSNNVGFGNMGLGNIGFGNTGTNNLGIGLTGDNQTGFGGLNSGAGNLGLFNSGTGNIGFFNTGTGNWGLFNSGSYNTGIGNSGTGSTGLFNAGSFNTGLANAGSYNTGSLNAGNTNTGGFNPGNVNTGWFNAGHTNTGGFNTGNVNTGAFNSGSFNNGALWTGDHHGLVGFSYSIEITGSTLVDINETLNLGPVHIDQIDIPGMSLFDIHELVNIGPFRIEPIDVPAVVLDIHETMVIPPIVFLPSMTIGGQTYTIPLDTPPAPAPPPFRLPLLFVNALGDNWIVGASNSTGMSGGFVTAPTQGILIHTGPSSATTGSLALTLPTVTIPTITTSPIPLKIDVSGGLPAFTLFPGGLNIPQNAIPLTIDASGVLDPITIFPGGFTIDPLPLSLALNISVPDSSVPIIIVPPTPGFGNATATPSSGFFNSGAGGVSGFGNFGAGSSGWWNQAHAALAGAGSGVLNVGTLNSGVLNVGSGISGLYNTAIVGLGTPALVSGAGNVGQQLSGVLAAGTALTQSPIINLGLADVGNYNLGLGNVGDFNLGAANLGDLNLGLGNIGNANVGFGNIGHGNVGFGNSGLGAALGIGNIGLGNAGSTNVGLANMGVGNIGFANTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNIGFFNSGTGNWGLFNSGSFNTGIGNSGTGSTGLFNAGGFTTGLANAGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGIANSGNVDTGALMSGNFSNGILWRGNYEGLFSYSYSLDVPRITILDAHFTGAFGPVVVPPIPVPAINAHLTGNAAMGAFTIPQIDIPALNPNVTGSVGFGPIAVPSVTIPALTAARAVLDMAASVGATSEIEPFIVWTSSGAIGPTWYSVGRIYNAGDLFVGGNIISGIPTLSTTGPVHAVFNAASQAFNTPALNIHQIPLGFQVPGSIDAITLFPGGLTFPANSLLNLDVFVGTPGATIPAITFPEIPANADGELYVIAGDIPLINIPPTPGIGNTTTVPSSGFFNTGAGGGSGFGNFGANMSGWWNQAHTALAGAGSGIANVGTLHSGVLNLGSGLSGIYNTSTLPLGTPALVSGLGNVGDHLSGLLASNVGQNPITIVNIGLANVGNGNVGLGNIGNLNLGAANIGDVNLGFGNIGDVNLGFGNIGGGNVGFGNIGDANFGFGNSGLAAGLAGMGNIGLGNAGSGNVGWANMGLGNIGFGNTGTNNLGIGLTGDNQSGIGGLNSGTGNIGLFNSGTGNIGFFNSGTANFGLFNSGSYNTGIGNSGVASTGLVNAGGFNTGVANAGSYNTGSFNAGDTNTGGFNPGSTNTGWFNTGNANTGVANAGNVNTGALITGNFSNGILWRGNYEGLAGFSFGYPIPLFPAVGADVTGDIGPATIIPPIHIPSIPLGFAAIGHIGPISIPNIAIPSIHLGIDPTFDVGPITVDPITLTIPGLSLDAAVSEIRMTSGSSSGFKVRPSFSFFAVGPDGMPGGEVSILQPFTVAPINLNPTTLHFPGFTIPTGPIHIGLPLSLTIPGFTIPGGTLIPQLPLGLGLSGGTPPFDLPTVVIDRIPVELHASTTIGPVSLPIFGFGGAPGFGNDTTAPSSGFFNTGGGGGSGFSNSGSGMSGVLNAISDPLLGSASGFANFGTQLSGILNRGAGISGVYNTGTLGLVTSAFVSGFMNVGQQLSGLLFAGTGP
>CP025597.1|AUP70382.1|3753178_3753670_-|hypothetical-protein
MLMKSSRIPGPTQPTVVRELVAVGEPSYTALPAGLPHHPRPQRGGSSRAAPVLVDDSMPHPGTRRCCALPQPGHQFPKPGQFRRQSWSRRSLSRAQTLSRKRRALQPLPRPPYLTTTPSKRHYKRYKPIWALMRRKCRHVCTRSGYCRLVCRSARAHHVVVRR
>CP025597.1|AUP70381.1|3753766_3754213_+|transposase
MDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR
>CP025597.1|AUP69435.1|3754249_3755068_-|transposase
MKAAAARRCWHGCKRAHRSSGRASSTVAIDPAAAYASAIRTPGLLPNAKLVVDHFHVTTLANDALTAVRRRVTWAFHDRRGRKIDPQWANRRRLLTARERLSDKSFAKMRNRINAVDPRAQILSAWIAKEELRTLLSTVRTGGDPHLARHHLHRFLPGASTRRSPNCSPWPPPLTSHPRSTPSWSPASPTRASVVGEVAEMLGDIDGQCVQVEVPVPERGPAGCGGLDGLGRAGVSATPRVCAAMTAVNVAGRCAGQQADVGPTPQHRCRGR
>CP025597.1|AUP69436.1|3755284_3755521_-|transposase
MKEYAVTSPKDLPYGEDRIMVRWNKIRWRCREDYCKLGPFTEAITQVPARVRSTLRLRRQMAKAIGDAARSVGRGRPG
>CP025597.1|AUP69437.1|3755908_3767059_-|PPE-family-protein
MEFPVLPPEINSVLMYSGAGSSPLLAAAAAWDGLAEELGSAAVSFGQVTSGLTAGVWQGAAAAAMAAAAAPYAGWLGSVAAAAEAVAGQARVVVGVFEAALAATVDPALVAANRARLVALAVSNLLGQNTPAIAAAEAEYELMWAADVAAMAGYHSGASAAAAALPAFSPPAQALGGGVGAFLTALFASPAKALSLNAGLGNVGNYNVGLGNVGVFNLGAGNVGGQNLGFGNAGGTNVGFGNLGNGNVGFGNSGLGAGLAGLGNIGLGNAGSSNYGFANLGVGNIGFGNTGTNNVGVGLTGNHLTGIGGLNSGTGNIGLFNSGTGNVGFFNSGTGNFGVFNSGNYNTGVGNAGTASTGLFNAGNFNTGVVNVGSYNTGSFNAGDTNTGGFNPGGVNTGWLNTGNTNTGIANSGNVNTGAFISGNFNNGVLWVGDYQGLFGVSAGSSIPAIPIGLVLNGDIGPITIQPIPILPTIPLSIHQTVNLGPLVVPDIVIPAFGGGIGIPINIGPLTITPITLFAQQTFVNQLPFPTFSLGKITIPQIQTFDSNGQLVSFIGPIVIDTTIPGPTNPQIDLTIRWDTPPITLFPNGISAPDNPLGLLVSVSISNPGFTIPGFSVPAQPLPLSIDIEGQIDGFSTPPITIDRIPLTVGGGVTIGPITIQGLHIPAAPGVGNTTTAPSSGFFNSGAGGVSGFGNVGAGSSGWWNQAPSALLGAGSGVGNVGTLGSGVLNLGSGISGFYNTSVLPFGTPAAVSGIGNLGQQLSGVSAAGTTLRSMLAGNLGLANVGNFNTGFGNVGDVNLGAANIGGHNLGLGNVGDGNLGLGNIGHGNLGFANLGLTAGAAGVGNVGFGNAGINNYGLANMGVGNIGFANTGTGNIGIGLVGDHRTGIGGLNSGIGNIGLFNSGTGNVGFFNSGTGNFGIGNSGRFNTGIGNSGTASTGLFNAGSFSTGIANTGDYNTGSFNAGDTNTGGFNPGGINTGWFNTGHANTGLANAGTFGTGAFMTGDYSNGLLWRGGYEGLVGVRVGPTISQFPVTVHAIGGVGPLHVAPVPVPAVHVEITDATVGLGPFTVPPISIPSLPIASITGSVDLAANTISPIRALDPLAGSIGLFLEPFRLSDPFITIDAFQVVAGVLFLENIIVPGLTVSGQILVTPTPIPLTLNLDTTPWTLFPNGFTIPAQTPVTVGMEVANDGFTFFPGGLTFPRASAGVTGLSVGLDAFTLLPDGFTLDTVPATFDGTILIGDIPIPIIDVPAVPGFGNTTTAPSSGFFNTGGGGGSGFANVGAGTSGWWNQGHDVLAGAGSGVANAGTLSSGVLNVGSGISGWYNTSTLGAGTPAVVSGIGNLGQQLSGFLANGTVLNRSPIVNIGWADVGAFNTGLGNVGDLNWGAANIGAQNLGLGNLGSGNVGFGNIGAGNVGFANSGPAVGLAGLGNVGLSNAGSNNWGLANLGVGNIGLANTGTGNIGIGLVGDYQTGIGGLNSGSGNIGLFNSGTGNVGFFNTGTGNFGLFNSGSFNTGIGNSGTGSTGLFNAGNFNTGIANPGSYNTGSFNVGDTNTGGFNPGDINTGWFNTGIMNTGTRNTGALMSGTDSNGMLWRGDHEGLFGLSYGITIPQFPIRITTTGGIGPIVIPDTTILPPLHLQITGDADYSFTVPDIPIPAIHIGINGVVTVGFTAPEATLLSALKNNGSFISFGPITLSNIDIPPMDFTLGLPVLGPITGQLGPIHLEPIVVAGIGVPLEIEPIPLDAISLSESIPIRIPVDIPASVIDGISMSEVVPIDASVDIPAVTITGTTISAIPLGFDIRTSAGPLNIPIIDIPAAPGFGNSTQMPSSGFFNTGAGGGSGIGNLGAGVSGLLNQAGAGSLVGTLSGLGNAGTLASGVLNSGTAISGLFNVSTLDATTPAVISGFSNLGDHMSGVSIDGLIAILTFPPAESVFDQIIDAAIAELQHLDIGNALALGNVGGVNLGLANVGEFNLGAGNVGNINVGAGNLGGSNLGLGNVGTGNLGFGNIGAGNFGFGNAGLTAGAGGLGNVGLGNAGSGSWGLANVGVGNIGLANTGTGNIGIGLTGDYRTGIGGLNSGTGNLGLFNSGTGNIGFFNTGTGNFGLFNSGSYSTGVGNAGTASTGLFNAGNFNTGLANAGSYNTGSLNVGSFNTGGVNPGTVNTGWFNTGHTNTGLFNTGNVNTGAFNSGSFNNGALWTGDYHGLVGFSFSIDIAGSTLVDINETLNLGPVHIEQIDIPGMSLFDVHEIVEIGPFTIPQVDVPAIPLEIHESIHMDPIVLVPATTIPAQTRTIPLDIPASPGSTMTLPLISMRFEGEDWILGSTAAIPNFGDPFPAPTQGITIHTGPGPGTTGELKISIPGFEIPQIATTRFLLDVNISGGLPAFTLFAGGLTIPTNAIPLTIDASGALDPITIFPGGYTIDPLPLHLALNLTVPDSSIPIIDVPPTPGFGNTTATPSSGFFNSGAGGVSGFGNVGSNLSGWWNQAASALAGSGSGVLNVGTLGSGVLNVGSGVSGIYNTSVLPLGTPAVLSGLGNVGHQLSGVSAAGTALNQIPILNIGLADVGNFNVGFGNVGDVNLGAANLGAQNLGLGNVGTGNLGFANVGHGNIGFGNSGLTAGAAGLGNTGFGNAGSANYGFANQGVRNIGLANTGTGNIGIGLVGDNLTGIGGLNSGAGNIGLFNSGTGNIGFFNSGTGNFGIGNSGSFNTGIGNSGTGSTGLFNAGSFNTGVANAGSYNTGSFNAGDTNTGGFNPGTINTGWFNTGHTNTGIANSGNVGTGAFMSGNFSNGLLWRGDHEGLFSLFYSLDVPRITIVDAHLDGGFGPVVLPPIPVPAVNAHLTGNVAMGAFTIPQIDIPALTPNITGSAAFRIVVGSVRIPPVSVIVEQIINASVGAEMRIDPFEMWTQGTNGLGITFYSFGSADGSPYATGPLVFGAGTSDGSHLTISASSGAFTTPQLETGPITLGFQVPGSVNAITLFPGGLTFPATSLLNLDVTAGAGGVDIPAITWPEIAASADGSVYVLASSIPLINIPPTPGIGNSTITPSSGFFNAGAGGGSGFGNFGAGTSGWWNQAHTALAGAGSGFANVGTLHSGVLNLGSGVSGIYNTSTLGVGTPALVSGLGNVGHQLSGLLSGGSAVNPVTVLNIGLANVGSHNAGFGNVGEVNLGAANLGAHNLGFGNIGAGNLGFGNIGHGNVGVGNSGLTAGVPGLGNVGLGNAGGNNWGLANVGVGNIGLANTGTGNIGIGLTGDYQTGIGGLNSGAGNLGLFNSGAGNVGFFNTGTGNFGLFNSGSFNTGVGNSGTGSTGLFNAGSFNTGVANAGSYNTGSFNVGDTNTGGFNPGSINTGWLNAGNANTGVANAGNVNTGAFVTGNFSNGILWRGDYQGLAGFAVGYTLPLFPAVGADVSGGIGPITVLPPIHIPPIPVGFAAVGGIGPIAIPDISVPSIHLGLDPAVHVGSITVNPITVRTPPVLVSYSQGAVTSTSGPTSEIWVKPSFFPGIRIAPSSGGGATSTQGAYFVGPISIPSGTVTFPGFTIPLDPIDIGLPVSLTIPGFTIPGGTLIPTLPLGLALSNGIPPVDIPAIVLDRILLDLHADTTIGPINVPIAGFGGAPGFGNSTTLPSSGFFNTGAGGGSGFSNTGAGMSGLLNAMSDPLLGSASGFANFGTQLSGILNRGAGISGVYNTGALGVVTAAVVSGFGNVGQQLSGLLFTGVGP
>CP025597.1|AUP69438.1|3767302_3768097_-|oxidoreductase
MLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR
>CP025597.1|AUP69439.1|3768178_3768550_-|FAD-binding-oxidoreductase
MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG
>CP025597.1|AUP69440.1|3768447_3768858_-|FAD-binding-protein
MGQSGLIDRRAGAAAGQRQGVHERKADLQFELQRLESGRGGDGRLAGRRPEGGFVAAASKLKIAVRGGGHSYIGASSANGAMVLDLLGLPGGVHFDSATRNVRCRPRPISMRSIKRWPVRAGRFRPAAARPWVWRV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025597_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025597_12

4110611-4110699

Orphan

Consensus_repeat	Method
GCTCGGCGACGATGCGGGCCGGATGACGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025597_12

>merge|CP025597|12|4110611-4110699|CRISPRCasFinder
GCTCGGCGACGATGCGGGCCGGATGACGGCCCGAGGAGGAGCCGAGCAATCGAACCGAGCTCGGCGACGATGCGGGCCGGATGACGGCC

>CP025597|12|9|4110611-4110699|CRISPRCasFinder
GCTCGGCGACGATGCGGGCCGGATGACGGCC	CGAGGAGGAGCCGAGCAATCGAACCGA
GCTCGGCGACGATGCGGGCCGGATGACGGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025597.1\|AUP69716.1\|4107189_4107459_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP69727.1\|4117991_4118447_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
CP025597.1\|AUP69722.1\|4114406_4115090_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
CP025597.1\|AUP70423.1\|4112254_4113448_-\|acid-resistance-periplasmic-serine-protease-MarP	unknown	unknown	gnl\|CDD\|379142
CP025597.1\|AUP69723.1\|4115089_4115827_-\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
CP025597.1\|AUP69712.1\|4099579_4100443_+\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|273654
CP025597.1\|AUP69720.1\|4111278_4112262_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP025597.1\|AUP69726.1\|4117190_4117985_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
CP025597.1\|AUP70422.1\|4103607_4104408_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
CP025597.1\|AUP69714.1\|4104463_4105390_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP025597.1\|AUP69725.1\|4116410_4117085_+\|cAMP-receptor-protein	unknown	unknown	gnl\|CDD\|223736
CP025597.1\|AUP69711.1\|4099302_4099497_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP70421.1\|4101964_4103611_-\|microcin-C-ABC-transporter-ATP-binding-protein-YejF	unknown	unknown	gnl\|CDD\|224048
CP025597.1\|AUP69719.1\|4110759_4111278_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
CP025597.1\|AUP69718.1\|4109715_4110414_-\|protease	unknown	unknown	unknown
CP025597.1\|AUP69724.1\|4115934_4116312_+\|hypothetical-protein	unknown	unknown	unknown
CP025597.1\|AUP69715.1\|4105391_4107017_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173853
CP025597.1\|AUP69717.1\|4107724_4109680_+\|acetyl-coenzyme-A-synthetase	unknown	unknown	gnl\|CDD\|234677
CP025597.1\|AUP69721.1\|4113453_4114275_-\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP025597.1\|AUP69713.1\|4101197_4101968_-\|oxidoreductase	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP025597.1\|AUP69727.1\|4117991_4118447_-\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	7.62827e-68
CP025597.1\|AUP69719.1\|4110759_4111278_+\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	8.41555e-32
CP025597.1\|AUP70423.1\|4112254_4113448_-\|acid-resistance-periplasmic-serine-protease-MarP	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	1.86888e-19
CP025597.1\|AUP69712.1\|4099579_4100443_+\|HAD-IB-family-hydrolase	gnl\|CDD\|273654	TIGR01490, Uncharacterized_protein_Rv3661/MT3761, HAD-superfamily subfamily IB hydrolase, TIGR01490. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled here are all bacterial. The IB subfamily includes the enzyme phosphoserine phosphatase (TIGR00338). Due to this relationship, several of these sequences have been annotated as "phosphoserine phosphatase related proteins," or "Phosphoserine phosphatase-family enzymes." There is presently no evidence that any of the enzymes in this model possess PSPase activity. OMNI\|NTL01ML1250 is annotated as a "possible transferase," however this is due to the C-terminal domain found on this sequence which is homologous to a group of glycerol-phosphate acyltransferases (between trusted and noise to TIGR00530). A subset of these sequences including OMNI\|CC1962, the Caulobacter crescentus CicA protein cluster together and may represent a separate equivalog. [Unknown function, Enzymes of unknown specificity].	5.37865e-86
CP025597.1\|AUP69720.1\|4111278_4112262_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.34553e-25
CP025597.1\|AUP69726.1\|4117190_4117985_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.29322e-75
CP025597.1\|AUP69714.1\|4104463_4105390_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.57934e-99
CP025597.1\|AUP69725.1\|4116410_4117085_+\|cAMP-receptor-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	2.11707e-55
CP025597.1\|AUP69723.1\|4115089_4115827_-\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	2.16645e-106
CP025597.1\|AUP70421.1\|4101964_4103611_-\|microcin-C-ABC-transporter-ATP-binding-protein-YejF	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
CP025597.1\|AUP69722.1\|4114406_4115090_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.72736e-22
CP025597.1\|AUP69715.1\|4105391_4107017_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.73988e-122
CP025597.1\|AUP69717.1\|4107724_4109680_+\|acetyl-coenzyme-A-synthetase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
CP025597.1\|AUP69721.1\|4113453_4114275_-\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	1.20605e-47
CP025597.1\|AUP70422.1\|4103607_4104408_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.07199e-77

>CP025597.1|AUP69718.1|4109715_4110414_-|protease
MQTAHRRFAAAFAAVLLAVVCLPANTAAADDKLPLGGGAGIVVNGDTMCTLTTIGHDKNGDLIGFTSAHCGGPGAQIAAEGAENAGPVGIMVAGNDGLDYAVIKFDPAKVTPVAVFNGFAINGIGPDPSFGQIACKQGRTTGNSCGVTWGPGESPGTLVMQVCGGPGDSGAPVTVDNLLVGMIHGAFSDNLPSCITKYIPLHTPAVVMSINADLADINAKNRPGAGFVPVPA
>CP025597.1|AUP69717.1|4107724_4109680_+|acetyl-coenzyme-A-synthetase
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWSGAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
>CP025597.1|AUP69716.1|4107189_4107459_+|hypothetical-protein
MLATHRDCASQGKTSPDRALLACGILEEDRWCRRCGEEGSPRDTVTRRLTHWCGLHPGVSVDHSCLSRCCRLDCRRRGPAVPQRDPPRR
>CP025597.1|AUP69715.1|4105391_4107017_-|ABC-transporter-substrate-binding-protein
MVRQMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTGTNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGWKFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKSRTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFGRNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFYANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDTPLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPGFDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVDAVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWRGDYPSMIEFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRILFHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
>CP025597.1|AUP69714.1|4104463_4105390_-|ABC-transporter-permease
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG
>CP025597.1|AUP70422.1|4103607_4104408_-|ABC-transporter-permease
MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA
>CP025597.1|AUP70421.1|4101964_4103611_-|microcin-C-ABC-transporter-ATP-binding-protein-YejF
MSVPAAPLLSVEGLEVTFGTDAPAVCGVDLAVRSGQTVAVVGESGSGKSTTAAAILGLLPAGGRITAGRVVFDGRDITGADAKRLRSIRGREIGYVPQDPMTNLNPVWKVGFQVTEALRANTDGRAARRRAVELLAEAGLPDPAKQAGRYPHQLSGGMCQRALIAIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQGLTDELGTALLLITHDLALAAQRAEAVVVVRRGVVVESGAAQSILQSPQHEYTRRLVAAAPSLTARSRRPPESRSRATTQAGDILVVSELTKIYRESRGAPWRRVESRAVDGVSFRLPRASTLAIVGESGSGKSTLARMVLGLLQPTSGTVVFDGTYDVGALARDQVLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRVHHVGDRRQRQRAVRELVDQVALPSSILGRRPRELSGGQRQRVAIARALALRPEVLVCDEAVSALDVLVQAQILDLLADLQADLGLTYLFISHDLAVIRQIADDVLVMRAGRVVEHASTEEVFSRPRHEYTRQLLQAIPGAPSAPRKVGNL
>CP025597.1|AUP69713.1|4101197_4101968_-|oxidoreductase
MTVDPLAPLMELPGVAAASDRVRDALSRVHRHRANLRGWPVAAAEASLRAARASSVLDGGPARLHDAGAPTSGKPALSDPVFAGALRVGQALEGGAGPVVGVWRRAPLQALARLHMLAAADQVDDDRLGRPRSDADVGPRLELLADVVTHPTLASAPVVAAVAHGELLTLRPFGCADGVVARAVSRLVTIATGLDPHGLGVPEVIWMRQPAEYHDAARRFAGGTPDGVAGWLLLCCGAMLDGAREALSIAESLSPG
>CP025597.1|AUP69712.1|4099579_4100443_+|HAD-IB-family-hydrolase
MTVSDSPAQRQTPPQTPGGTAPRARTAAFFDLDKTIIAKSSTLAFSKPFFAQGLLNRRAVLKSSYAQFIFLLSGADHDQMDRMRTHLTNMCAGWDVAQVRSIVNETLHDIVTPLVFAEAADLIAAHKLCGRDVVVVSASGEEIVGPIARALGATHAMATRMIVEDGKYTGEVAFYCYGEGKAQAIRELAASEGYPLEHCYAYSDSITDLPMLEAVGHASVVNPDRGLRKEASVRGWPVLSFSRPVSLRDRIPAPSAAAIATTAAVGISALAAGAVTYALLRRFAFQP
>CP025597.1|AUP69711.1|4099302_4099497_+|hypothetical-protein
MRGCQKGRPPPGGEEARVVVHQPRGVGLIHPRLWPSNAYYTHDSAQSRKYRTQWKAQLEPCKCS
>CP025597.1|AUP69719.1|4110759_4111278_+|phage-holin-family-protein
MSKIDRKNGVPSTLTTIPLADPHAGPAEPSIGDLIKDATTQMSTLVRAEVELARAEITRDVKKGLTGSVFFISSLVVGFYSTFFFFFFVAELLDTWIWRWVAFLLVFAIMVVVTAVLALLGFLKVRRIRGPRQTIASVKETRTALTPGHDKTPVTPKPVTSDRATPVDPSGW
>CP025597.1|AUP69720.1|4111278_4112262_+|alpha/beta-hydrolase
MAAPDPSMTRIAGPWRHLDVHANGIRFHVVEAVPSGQPEGPDAATPPMQPALARPLVILLHGFGSFWWSWRHQLCGLTGARVVAVDLRGYGGSDKPPRGYDGWTLAGDTAGLIRALGHPSATLVGHADGGLACWTTALLHSRLVRAIALISSPHPAALRRSTLTRRDQRHALLPTLLRYQLPIWPERLLTRNNAAEIERLVRARGCAKWLASEDFSQAIDHLRQAIQIPAAAHCALEYQRWAVRSQLRSEGRRFIRAMTQQLGMPLLHLRGDADPYVLADPVERTQRYAPHGRYISIAGAGHFSHEEAPEEVNRHLMRFLEQVHQLS
>CP025597.1|AUP70423.1|4112254_4113448_-|acid-resistance-periplasmic-serine-protease-MarP
MTPSQWLDIAVLAVAFIAAISGWRAGALGSMLSFGGVLLGATAGVLLAPHIVSQISAPRAKLFAALFLILALVVVGEVAGVVLGRAVRGAIRNRPIRLIDSVIGVGVQLVVVLTAAWLLAMPLTQSKEQPELAAAVKGSRVLARVNEAAPTWLKTVPKRLSALLNTSGLPAVLEPFSRTPVIPVASPDPALVNNPVVAATEPSVVKIRSLAPRCQKVLEGTGFVISPDRVMTNAHVVAGSNNVTVYAGDKPFEATVVSYDPSVDVAILAVPHLPPPPLVFAAEPAKTGADVVVLGYPGGGNFTATPARIREAIRLSGPDIYGDPEPVTRDVYTIRADVEQGDSGGPLIDLNGQVLGVVFGAAIDDAETGFVLTAGEVAGQLAKIGATQPVGTGACVS
>CP025597.1|AUP69721.1|4113453_4114275_-|CoA-pyrophosphatase
MSAGGTPLQAGATPTGSRGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRLPADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPEAGPGDGGVPDDADLLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRLHPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAFINPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQPWDTGDIRELDAAMVLIDDESDPR
>CP025597.1|AUP69722.1|4114406_4115090_-|TlpA-family-protein-disulfide-reductase
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG
>CP025597.1|AUP69723.1|4115089_4115827_-|endonuclease-III
MPGRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILSAQSTDKRVNLTTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASLIGLGQALVERFGGEVPATMDKLVTLPGVGRKTANVILGNAFGIPGITVDTHFGRLVRRWRWTTAEDPVKVEQAVGELIERKEWTLLSHRVIFHGRRVCHARRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLLALAGL
>CP025597.1|AUP69724.1|4115934_4116312_+|hypothetical-protein
MFTLLVSWLLVACVPGLLMLATLGLGRLERFLARDTVTATDVAEFLEQAEAVDVHTLARNGMPEALDYLHRRQARRITDSPPLGSGAGPRYAGPLFVTDLDSPVEPPRHGQPNPQFRTARHANHV
>CP025597.1|AUP69725.1|4116410_4117085_+|cAMP-receptor-protein
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
>CP025597.1|AUP69726.1|4117190_4117985_-|MBL-fold-metallo-hydrolase
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR
>CP025597.1|AUP69727.1|4117991_4118447_-|RidA-family-protein
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPEEGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVFGDSGAHARSAVGVSELPLDAPVEVELIVEVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP025597_5	5.8\|1212373\|16\|CP025597\|CRISPRCasFinder	1212373-1212388	16	CP025597.1	2088570-2088585	0	1.0
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	674748-674766	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1213453-1213471	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1217595-1217613	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1217667-1217685	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1630635-1630653	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1633461-1633479	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1990771-1990789	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2061495-2061513	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2061942-2061960	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2062041-2062059	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2802059-2802077	1	0.947
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2805587-2805605	1	0.947
CP025597_7	7.2\|2088336\|18\|CP025597\|CRT	2088336-2088353	18	CP025597.1	401059-401076	1	0.944
CP025597_7	7.2\|2088336\|18\|CP025597\|CRT	2088336-2088353	18	CP025597.1	607395-607412	1	0.944
CP025597_7	7.4\|2088426\|18\|CP025597\|CRT	2088426-2088443	18	CP025597.1	3450155-3450172	1	0.944
CP025597_1	1.5\|366749\|42\|CP025597\|CRISPRCasFinder	366749-366790	42	CP025597.1	374780-374821	2	0.952
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	CP025597.1	373595-373627	2	0.939
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	CP025597.1	675067-675102	2	0.944
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	CP025597.1	1213726-1213761	2	0.944
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	CP025597.1	2423730-2423765	2	0.944
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	CP025597.1	2960507-2960528	2	0.909
CP025597_5	5.11\|1212511\|22\|CP025597\|CRISPRCasFinder	1212511-1212532	22	CP025597.1	837405-837426	2	0.909
CP025597_5	5.11\|1212511\|22\|CP025597\|CRISPRCasFinder	1212511-1212532	22	CP025597.1	1217622-1217643	2	0.909
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	150184-150202	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	333763-333781	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	335182-335200	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	335635-335653	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	335686-335704	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	335695-335713	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	337983-338001	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	338112-338130	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	338379-338397	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	338426-338444	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	338502-338520	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	363033-363051	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	443406-443424	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	546749-546767	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	623957-623975	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	624179-624197	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	673914-673932	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	840188-840206	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1090974-1090992	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1091622-1091640	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1095661-1095679	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1213000-1213018	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1213372-1213390	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1218015-1218033	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1489147-1489165	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1618599-1618617	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1619052-1619070	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1635974-1635992	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1635983-1636001	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1864263-1864281	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1864791-1864809	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	1990045-1990063	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2001425-2001443	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2088765-2088783	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2303463-2303481	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2356915-2356933	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2419591-2419609	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2423660-2423678	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2569152-2569170	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2693468-2693486	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2795374-2795392	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	2795956-2795974	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3054564-3054582	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3054663-3054681	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3705471-3705489	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3737430-3737448	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3738054-3738072	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3738297-3738315	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3738430-3738448	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3802317-3802335	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3802500-3802518	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3802668-3802686	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3930457-3930475	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3932196-3932214	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3940703-3940721	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	3948687-3948705	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	4031650-4031668	2	0.895
CP025597_5	5.13\|1212628\|19\|CP025597\|CRISPRCasFinder	1212628-1212646	19	CP025597.1	4094194-4094212	2	0.895

1. spacer 5.8|1212373|16|CP025597|CRISPRCasFinder matches to position: 2088570-2088585, mismatch: 0, identity: 1.0

gtggctgtacggcgac	CRISPR spacer
gtggctgtacggcgac	Protospacer
****************

2. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 674748-674766, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggtggggccggtggc	Protospacer
******.************

3. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1213453-1213471, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

4. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1217595-1217613, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggaggc	Protospacer
*************** ***

5. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1217667-1217685, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

6. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1630635-1630653, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggtggc	Protospacer
********* *********

7. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1633461-1633479, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggaggc	Protospacer
*************** ***

8. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1990771-1990789, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

9. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2061495-2061513, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

10. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2061942-2061960, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

11. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2062041-2062059, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

12. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2802059-2802077, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgacggcggggccggtggc	Protospacer
** ****************

13. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2805587-2805605, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggcgggtggc	Protospacer
************ ******

14. spacer 7.2|2088336|18|CP025597|CRT matches to position: 401059-401076, mismatch: 1, identity: 0.944

gatcagcccgacggcgtt	CRISPR spacer
gatcagcccgtcggcgtt	Protospacer
********** *******

15. spacer 7.2|2088336|18|CP025597|CRT matches to position: 607395-607412, mismatch: 1, identity: 0.944

gatcagcccgacggcgtt	CRISPR spacer
gatcagcccgtcggcgtt	Protospacer
********** *******

16. spacer 7.4|2088426|18|CP025597|CRT matches to position: 3450155-3450172, mismatch: 1, identity: 0.944

gatcagcgtcccgccggt	CRISPR spacer
gatcagcgtcccgctggt	Protospacer
**************.***

17. spacer 1.5|366749|42|CP025597|CRISPRCasFinder matches to position: 374780-374821, mismatch: 2, identity: 0.952

ccggtgcccgagttgaagaacccgatgtttccgctgccggag	CRISPR spacer
ccggtgcccgagttgaacaacccgacgtttccgctgccggag	Protospacer
***************** *******.****************

18. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to position: 373595-373627, mismatch: 2, identity: 0.939

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
aggctgccgaacccgatctggccgctgccggtg	Protospacer
********** *************.********

19. spacer 3.17|927376|36|CP025597|CRT matches to position: 675067-675102, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatgggcaacggcggcaacggcggggccggcgg	Protospacer
****** ***********.*****************

20. spacer 3.17|927376|36|CP025597|CRT matches to position: 1213726-1213761, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatcggcaacggcggccacggcggggccggcgg	Protospacer
******************. ****************

21. spacer 3.17|927376|36|CP025597|CRT matches to position: 2423730-2423765, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatcggcaacggcggcaacggcggtgccggcgg	Protospacer
******************.******** ********

22. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to position: 2960507-2960528, mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tggcgggggtgccggcggtgtc	Protospacer
** *** ***************

23. spacer 5.11|1212511|22|CP025597|CRISPRCasFinder matches to position: 837405-837426, mismatch: 2, identity: 0.909

gctgtggggcggcggtggtgcc	CRISPR spacer
gctgtggggcgccggtggggcc	Protospacer
*********** ****** ***

24. spacer 5.11|1212511|22|CP025597|CRISPRCasFinder matches to position: 1217622-1217643, mismatch: 2, identity: 0.909

gctgtggggcggcggtggtgcc	CRISPR spacer
gctgtggggcgtcggtggcgcc	Protospacer
*********** ******.***

25. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 150184-150202, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcggcggtggc	Protospacer
********* * *******

26. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 333763-333781, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

27. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 335182-335200, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

28. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 335635-335653, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggctggcggc	Protospacer
************.**.***

29. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 335686-335704, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

30. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 335695-335713, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

31. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 337983-338001, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggcgggcggc	Protospacer
************ **.***

32. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 338112-338130, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

33. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 338379-338397, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggggtcggtggc	Protospacer
** ********.*******

34. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 338426-338444, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgccgccggtggc	Protospacer
********  *********

35. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 338502-338520, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccgccggc	Protospacer
************** .***

36. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 363033-363051, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccgtcggcgccggtggc	Protospacer
***** *** *********

37. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 443406-443424, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cggcggcggggacggtggc	Protospacer
** ******** *******

38. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 546749-546767, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggccgggccggtggc	Protospacer
** **** ***********

39. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 623957-623975, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggcgccggtggc	Protospacer
** ****** *********

40. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 624179-624197, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

41. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 673914-673932, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

42. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 840188-840206, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggcgggcggc	Protospacer
************ **.***

43. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1090974-1090992, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

44. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1091622-1091640, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggaggggccggcggc	Protospacer
****** ********.***

45. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1095661-1095679, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

46. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1213000-1213018, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggggccggaggc	Protospacer
******.******** ***

47. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1213372-1213390, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cggcggcggggccggcggc	Protospacer
** ************.***

48. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1218015-1218033, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

49. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1489147-1489165, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

50. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1618599-1618617, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

51. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1619052-1619070, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggagccggtggc	Protospacer
******.**.*********

52. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1635974-1635992, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggcgccggtggc	Protospacer
******.** *********

53. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1635983-1636001, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

54. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1864263-1864281, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

55. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1864791-1864809, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

56. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 1990045-1990063, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

57. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2001425-2001443, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgtcggcggtgccggtggc	Protospacer
**.****** *********

58. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2088765-2088783, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggggccggcggc	Protospacer
*** ***********.***

59. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2303463-2303481, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccgtcggc	Protospacer
************** .***

60. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2356915-2356933, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccgccggc	Protospacer
************** .***

61. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2419591-2419609, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggtcgatggc	Protospacer
***********.**.****

62. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2423660-2423678, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgcggccggcggc	Protospacer
******** ******.***

63. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2569152-2569170, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

64. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2693468-2693486, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

65. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2795374-2795392, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcaggcggtgccggtggc	Protospacer
*** ***** *********

66. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 2795956-2795974, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgggaccggcggc	Protospacer
**********.****.***

67. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3054564-3054582, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggggccggcggc	Protospacer
*** ***********.***

68. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3054663-3054681, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

69. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3705471-3705489, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccgtcgggcccggtggc	Protospacer
***** **** ********

70. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3737430-3737448, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

71. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3738054-3738072, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgcaggtggc	Protospacer
********* ** ******

72. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3738297-3738315, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggtgccggtggc	Protospacer
******.** *********

73. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3738430-3738448, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgcggccggcggc	Protospacer
******** ******.***

74. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3802317-3802335, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggggccggcggc	Protospacer
** ************.***

75. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3802500-3802518, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

76. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3802668-3802686, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

77. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3930457-3930475, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccagcggggccggcggc	Protospacer
****.**********.***

78. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3932196-3932214, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

79. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3940703-3940721, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgggcacggtggc	Protospacer
**********  *******

80. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 3948687-3948705, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgggaccggcggc	Protospacer
**********.****.***

81. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 4031650-4031668, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

82. spacer 5.13|1212628|19|CP025597|CRISPRCasFinder matches to position: 4094194-4094212, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	136890-136911	1	0.955
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1975819-1975840	1	0.955
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1109892-1109913	1	0.955
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP016457	Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence	87869-87890	1	0.955
CP025597_6	6.15\|1573159\|22\|CP025597\|CRISPRCasFinder	1573159-1573180	22	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	362668-362689	1	0.955
CP025597_6	6.15\|1573159\|22\|CP025597\|CRISPRCasFinder	1573159-1573180	22	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2289382-2289403	1	0.955
CP025597_6	6.15\|1573159\|22\|CP025597\|CRISPRCasFinder	1573159-1573180	22	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	81656-81677	1	0.955
CP025597_6	6.15\|1573159\|22\|CP025597\|CRISPRCasFinder	1573159-1573180	22	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	56160-56181	1	0.955
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	794580-794601	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	75477-75498	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	713470-713491	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_021056	Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence	29437-29458	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	56975-56996	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	458462-458483	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1354617-1354638	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	881389-881410	2	0.909
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_047977	Microbacterium phage Hendrix, complete genome	3065-3086	2	0.909
CP025597_5	5.15\|1212712\|22\|CP025597\|CRISPRCasFinder	1212712-1212733	22	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	917429-917450	2	0.909
CP025597_6	6.2\|1572232\|22\|CP025597\|CRISPRCasFinder	1572232-1572253	22	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	881140-881161	2	0.909
CP025597_6	6.2\|1572232\|22\|CP025597\|CRISPRCasFinder	1572232-1572253	22	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	225972-225993	2	0.909
CP025597_6	6.2\|1572232\|22\|CP025597\|CRISPRCasFinder	1572232-1572253	22	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	451168-451189	2	0.909
CP025597_6	6.2\|1572232\|22\|CP025597\|CRISPRCasFinder	1572232-1572253	22	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	234992-235013	2	0.909
CP025597_6	6.2\|1572232\|22\|CP025597\|CRISPRCasFinder	1572232-1572253	22	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	597449-597470	2	0.909
CP025597_6	6.3\|1572286\|22\|CP025597\|CRISPRCasFinder	1572286-1572307	22	NZ_CP025510	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvD, complete sequence	117076-117097	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP021032	Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence	448838-448859	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	160471-160492	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	175264-175285	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	457593-457614	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	166709-166730	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	166709-166730	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	166709-166730	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	166709-166730	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	164465-164486	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	97458-97479	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP012698	Microbacterium sp. No. 7 plasmid A, complete sequence	53118-53139	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	100830-100851	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	307854-307875	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	23841-23862	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	279961-279982	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	359201-359222	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	606826-606847	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	411558-411579	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	300111-300132	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	483830-483851	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP024312	Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence	68146-68167	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	175112-175133	2	0.909
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	314082-314103	2	0.909
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	402883-402907	2	0.92
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	416172-416196	2	0.92
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	472935-472959	2	0.92
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4024254-4024277	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4460576-4460599	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP034768	Enterobacter sp. N18-03635 plasmid pFRI-6, complete sequence	122201-122224	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	37773-37796	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_AP019631	Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence	116652-116675	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_AP019631	Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence	72348-72371	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	KU716094	Mycobacterium phage Eidsmoe, complete genome	5649-5672	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MH371122	Mycobacterium phage Priya, complete genome	5650-5673	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MK016502	Mycobacterium phage Pat3, complete genome	22827-22850	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MK937593	Mycobacterium phage Flypotenuse, complete genome	23717-23740	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MG872835	Mycobacterium phage Conquerage, complete genome	5649-5672	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MH536820	Mycobacterium phage Glexan, complete genome	23717-23740	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	91001-91024	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	44795-44818	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1701753-1701776	3	0.875
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MH271298	Microbacterium phage Floof, complete genome	37939-37962	3	0.875
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	MN703413	Arthrobacter phage Powerpuff, complete genome	38834-38858	3	0.88
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	MT024871	Arthrobacter phage YesChef, complete genome	37693-37717	3	0.88
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	355111-355132	3	0.864
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP040721	Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence	58695-58716	3	0.864
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP040721	Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence	90623-90644	3	0.864
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1457966-1457987	3	0.864
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	422944-422965	3	0.864
CP025597_5	5.7\|1212328\|22\|CP025597\|CRISPRCasFinder	1212328-1212349	22	KT381864	Thiobacimonas phage vB_ThpS-P1, complete genome	3900-3921	3	0.864
CP025597_5	5.11\|1212511\|22\|CP025597\|CRISPRCasFinder	1212511-1212532	22	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	4076-4097	3	0.864
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	9264-9285	3	0.864
CP025597_6	6.4\|1572340\|22\|CP025597\|CRISPRCasFinder	1572340-1572361	22	NZ_CP021649	Acidovorax sp. T1 plasmid p1-T1, complete sequence	13233-13254	3	0.864
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	937294-937318	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1470762-1470786	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	MN586053	Arthrobacter phage BeatusComedenti, complete genome	26689-26713	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NC_031254	Arthrobacter phage Kitkat, complete genome	26809-26833	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NC_031231	Arthrobacter phage KellEzio, complete genome	26691-26715	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	633177-633201	3	0.88
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	74124-74148	3	0.88
CP025597_6	6.15\|1573159\|22\|CP025597\|CRISPRCasFinder	1573159-1573180	22	NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	380879-380900	3	0.864
CP025597_7	7.5\|2088465\|24\|CP025597\|CRT	2088465-2088488	24	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1555522-1555545	3	0.875
CP025597_7	7.5\|2088465\|24\|CP025597\|CRT	2088465-2088488	24	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1560190-1560213	3	0.875
CP025597_1	1.1\|366494\|27\|CP025597\|CRISPRCasFinder	366494-366520	27	NC_023591	Mycobacterium phage Adler, complete genome	61249-61275	4	0.852
CP025597_1	1.1\|366494\|27\|CP025597\|CRISPRCasFinder	366494-366520	27	KF981876	UNVERIFIED: Mycobacterium phage ADLER F1725, complete genome	61247-61273	4	0.852
CP025597_1	1.7\|366890\|27\|CP025597\|CRISPRCasFinder	366890-366916	27	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	10066-10092	4	0.852
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	460464-460490	4	0.852
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NC_016652	Rhodococcus phage REQ2, complete genome	36035-36061	4	0.852
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	KY945355	Mycobacterium phage Shandong1, complete genome	25634-25660	4	0.852
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	106725-106751	4	0.852
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NC_041888	Mycobacterium phage Tortellini, complete genome	37216-37242	4	0.852
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1096460-1096489	4	0.867
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1898211-1898234	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	261506-261529	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	673134-673157	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP016822	Rhodococcus sp. p52 plasmid pDF03, complete sequence	60076-60099	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MN582086	Siphoviridae sp. ctdEk19, complete genome	33324-33347	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	21980-22003	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MT889380	Mycobacterium phage Coco12, complete genome	22623-22646	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NC_023698	Mycobacterium phage Avani, complete genome	21987-22010	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MT114167	Mycobacterium phage Phanphagia, complete genome	22278-22301	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	558871-558894	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1500559-1500582	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	295932-295955	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	1116335-1116358	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MN096355	Mycobacterium phage Purky, complete genome	48975-48998	4	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	MK279853	Gordonia phage Gray, complete genome	68404-68427	4	0.833
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	9745-9769	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1906386-1906410	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	794756-794780	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	CP003956	Rhodococcus opacus PD630 plasmid 7, complete sequence	34847-34871	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1665271-1665295	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NC_012723	Burkholderia glumae BGR1 plasmid bglu_1p, complete sequence	15832-15856	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	348896-348920	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	406425-406449	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	26065-26089	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	450297-450321	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NC_022437	Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence	16147-16171	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1382131-1382155	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1418915-1418939	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP051294	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence	118938-118962	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1711697-1711721	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	722328-722352	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	67000-67024	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP033363	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence	118938-118962	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1149411-1149435	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	438623-438647	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP014580	Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence	243636-243660	4	0.84
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1410063-1410087	4	0.84
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	818773-818800	4	0.857
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	420542-420569	4	0.857
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	77799-77826	4	0.857
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP021372	Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence	176640-176664	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	29428-29452	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	38191-38215	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	MT553342	Microbacterium phage Kelcole, complete genome	51573-51597	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NC_048068	Microbacterium phage OneinaGillian, complete genome	50894-50918	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	MT310894	Microbacterium phage Tempo, complete genome	51697-51721	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	42080-42104	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	67777-67801	4	0.84
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	MN034284	Leviviridae sp. isolate H2_Rhizo_Litter_49_scaffold_25938 sequence	624-648	4	0.84
CP025597_6	6.14\|1573102\|25\|CP025597\|CRISPRCasFinder	1573102-1573126	25	MN582064	Podoviridae sp. ctka020, complete genome	29274-29298	4	0.84
CP025597_7	7.5\|2088465\|24\|CP025597\|CRT	2088465-2088488	24	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	680430-680453	4	0.833
CP025597_7	7.5\|2088465\|24\|CP025597\|CRT	2088465-2088488	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5913119-5913142	4	0.833
CP025597_7	7.5\|2088465\|24\|CP025597\|CRT	2088465-2088488	24	NZ_CP015007	Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence	143186-143209	4	0.833
CP025597_1	1.1\|366494\|27\|CP025597\|CRISPRCasFinder	366494-366520	27	LR794124	Vibrio phage vB_Vc_SrVc9 genome assembly, chromosome: 1	34861-34887	5	0.815
CP025597_1	1.1\|366494\|27\|CP025597\|CRISPRCasFinder	366494-366520	27	NC_012662	Vibrio phage VP93, complete genome	35301-35327	5	0.815
CP025597_1	1.7\|366890\|27\|CP025597\|CRISPRCasFinder	366890-366916	27	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	2189-2215	5	0.815
CP025597_1	1.7\|366890\|27\|CP025597\|CRISPRCasFinder	366890-366916	27	MN693945	Marine virus AFVG_250M952, complete genome	34909-34935	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	369429-369455	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	338832-338858	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	363377-363403	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP015368	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p1, complete sequence	104717-104743	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	338543-338569	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	340811-340837	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	342690-342716	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	343060-343086	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	355714-355740	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	343060-343086	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	348335-348361	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	343052-343078	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP020444	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence	69464-69490	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	363377-363403	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	355714-355740	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	342690-342716	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP044078	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence	10340-10366	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP031081	Paracoccus yeei strain CCUG 32053 plasmid pYEE3, complete sequence	19365-19391	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MN586031	Gordonia phage Gambino, complete genome	3053-3079	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	KU998236	Gordonia phage Blueberry, complete genome	3053-3079	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MN062704	Gordonia phage JuJu, complete genome	3063-3089	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MK501729	Gordonia phage Walrus, complete genome	3053-3079	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NC_031226	Gordonia phage BaxterFox, complete genome	2982-3008	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MK967393	Rhodococcus phage Whack, complete genome	3063-3089	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MT723935	Gordonia phage Azula, complete genome	3053-3079	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	KU963249	Gordonia phage Yeezy, complete genome	2982-3008	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MH153808	Gordonia phage Petra, complete genome	3053-3079	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MT639650	Gordonia phage Ohgeesy, complete genome	2982-3008	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MH536818	Gordonia phage Frokostdame, complete genome	3055-3081	5	0.815
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	KX557275	Gordonia phage CarolAnn, complete genome	3052-3078	5	0.815
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	KX683875	Mycobacterium phage Baehexic, complete genome	12181-12207	5	0.815
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	KM197169	Mycobacterium phage Piro94, complete genome	12178-12204	5	0.815
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MF668269	Mycobacterium phage Drake55, complete genome	12177-12203	5	0.815
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MK284522	Mycobacterium phage Malec, complete genome	11950-11976	5	0.815
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	KM677210	Mycobacterium phage Larenn, complete genome	11945-11971	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	1800-1826	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	136919-136945	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	658056-658082	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1514868-1514894	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5852040-5852066	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP049908	Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence	235006-235032	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_CP049700	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence	263243-263269	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	MH576962	Streptomyces phage Satis, complete genome	95306-95332	5	0.815
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	MK620894	Streptomyces phage Kradal, complete genome	95310-95336	5	0.815
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1068923-1068952	5	0.833
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1739900-1739929	5	0.833
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	233389-233418	5	0.833
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP031193	Humibacter sp. BT305 plasmid unnamed1	44938-44967	5	0.833
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	137673-137702	5	0.833
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	984252-984281	5	0.833
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1598936-1598965	5	0.833
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	233398-233427	5	0.833
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP046705	Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence	292905-292934	5	0.833
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	AY950802	Haloarcula phage SH1, complete genome	16104-16133	5	0.833
CP025597_3	3.16\|927334\|24\|CP025597\|CRT	927334-927357	24	NC_006911	Streptomyces sp. F11 plasmid pFP11, complete sequence	11649-11672	5	0.792
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MG925349	Mycobacterium phage Mendokysei, complete genome	21052-21085	5	0.853
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3841167-3841191	5	0.8
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NC_015178	Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence	157500-157524	5	0.8
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	179155-179179	5	0.8
CP025597_5	5.4\|1212148\|25\|CP025597\|CRISPRCasFinder	1212148-1212172	25	NC_009469	Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence	67026-67050	5	0.8
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_LN907828	Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence	94483-94510	5	0.821
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	KU728633	Mycobacterium phage Bipper, complete genome	41992-42019	5	0.821
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	MK977701	Mycobacterium phage Cracklewink, complete genome	41985-42012	5	0.821
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	100320-100347	5	0.821
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	614111-614135	5	0.8
CP025597_6	6.5\|1572394\|25\|CP025597\|CRISPRCasFinder	1572394-1572418	25	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	92705-92729	5	0.8
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_018746	Pseudomonas putida ND6 plasmid pND6-2, complete sequence	45440-45470	5	0.839
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	MN961671	Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence	123562-123592	5	0.839
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	MN961672	Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence	72551-72581	5	0.839
CP025597_6	6.13\|1573036\|34\|CP025597\|CRISPRCasFinder	1573036-1573069	34	NC_006362	Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence	89410-89443	5	0.853
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NC_010850	Rhodococcus sp. NS1 plasmid pNSL1, complete sequence	92901-92931	5	0.839
CP025597_1	1.1\|366494\|27\|CP025597\|CRISPRCasFinder	366494-366520	27	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	207335-207361	6	0.778
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	435770-435802	6	0.818
CP025597_1	1.7\|366890\|27\|CP025597\|CRISPRCasFinder	366890-366916	27	NZ_CP022542	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence	32942-32968	6	0.778
CP025597_1	1.9\|367040\|27\|CP025597\|CRISPRCasFinder	367040-367066	27	NC_009959	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence	50750-50776	6	0.778
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	179708-179734	6	0.778
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4846911-4846937	6	0.778
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	78863-78889	6	0.778
CP025597_1	1.10\|367100\|27\|CP025597\|CRISPRCasFinder	367100-367126	27	MK494099	Mycobacterium phage Typha, complete genome	33831-33857	6	0.778
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	GQ141189	Bifidobacterium phage Bbif-1, complete sequence	38062-38092	6	0.806
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	658647-658673	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	NC_023606	Mycobacterium phage CRB1, complete genome	11649-11675	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MK524491	Mycobacterium phage Whabigail7, complete genome	12139-12165	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	KX619650	Mycobacterium phage Jerm, complete genome	12089-12115	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MN585998	Mycobacterium phage Bugsy, complete genome	12128-12154	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	JN408460	Mycobacterium phage Turbido, complete genome	12151-12177	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MH077576	Mycobacterium phage AbbyPaige, complete genome	12129-12155	6	0.778
CP025597_3	3.5\|926839\|27\|CP025597\|CRT	926839-926865	27	MH825704	Mycobacterium phage LilTurb, complete genome	12148-12174	6	0.778
CP025597_3	3.10\|927049\|27\|CP025597\|CRT	927049-927075	27	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	147990-148016	6	0.778
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	508-537	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	280809-280838	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	561652-561681	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	554428-554457	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	542116-542145	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	610786-610815	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	571170-571199	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1563589-1563618	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	421135-421164	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1217050-1217079	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1265979-1266008	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1135414-1135443	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP037868	Hydrogenophaga pseudoflava strain DSM 1084 plasmid pDSM1084, complete sequence	5790-5819	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1195134-1195163	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1134511-1134540	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	762260-762289	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1168711-1168740	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1168700-1168729	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1135406-1135435	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1134762-1134791	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1135397-1135426	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1217165-1217194	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1217149-1217178	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1217142-1217171	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_019408	Caulobacter phage CcrRogue, complete genome	180466-180495	6	0.8
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	174181-174210	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP017941	Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence	270228-270257	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	MK937608	Microbacterium phage Cressida, complete genome	54022-54051	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	554437-554466	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	542125-542154	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP017592	Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence	7337-7366	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP008898	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-576, complete sequence	43955-43984	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP023489	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence	73653-73682	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP043515	Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed4, complete sequence	36331-36360	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	571179-571208	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_LT984809	Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence	317155-317184	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP026371	Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence	116386-116415	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP050069	Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence	79588-79617	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP039425	Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence	132572-132601	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP009856	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-784, complete sequence	26128-26157	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP039430	Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence	132570-132599	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	32030-32059	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	14031-14060	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	17715-17744	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP006588	Hymenobacter sp. APR13 plasmid pHA, complete sequence	19031-19060	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1930897-1930926	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190353-190382	6	0.8
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	MH029534	Myoviridae environmental samples clone NHS-Seq2, complete sequence	34123-34152	6	0.8
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	MT723940	Mycobacterium phage Ellie, complete genome	24126-24161	6	0.833
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466597-3466630	6	0.824
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210883-2210916	6	0.824
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283764-283797	6	0.824
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445248-445281	6	0.824
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	39276-39303	6	0.786
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	76834-76861	6	0.786
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NZ_LR594663	Variovorax sp. RA8 plasmid 2	131793-131820	6	0.786
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	27764-27794	6	0.806
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	438646-438676	6	0.806
CP025597_6	6.13\|1573036\|34\|CP025597\|CRISPRCasFinder	1573036-1573069	34	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	28989-29022	6	0.824
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NC_009478	Clavibacter michiganensis subsp. michiganensis NCPPB 382 plasmid pCM1, complete sequence	8328-8358	6	0.806
CP025597_1	1.4\|366689\|27\|CP025597\|CRISPRCasFinder	366689-366715	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	48081-48107	7	0.741
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MK977708	Mycobacterium phage Fulbright, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MG099948	Mycobacterium phage Philonius, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MH926055	Mycobacterium phage Chewbacca, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MT723932	Mycobacterium phage Schnauzer, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	KU935726	Mycobacterium phage Xerxes, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	KU935730	Mycobacterium phage Pipsqueaks, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MH316570	Mycobacterium phage Silvafighter, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MK524518	Mycobacterium phage Smurph, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MK524515	Mycobacterium phage Parmesanjohn, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MH697585	Mycobacterium phage Gex, complete genome	10280-10310	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	KM588359	Mycobacterium phage Carcharodon, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MH697576	Mycobacterium phage Aggie, complete genome	10282-10312	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MH697593	Mycobacterium phage Tapioca, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	MG099936	Mycobacterium phage Andies, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	NC_031243	Mycobacterium phage Xeno, complete genome	10281-10311	7	0.774
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	JN256079	Mycobacterium phage Charlie, complete genome	10281-10311	7	0.774
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	943873-943902	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	392100-392129	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1838430-1838459	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	616186-616215	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	397449-397478	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1703655-1703684	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	212329-212358	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	679499-679528	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1744018-1744047	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1760732-1760761	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	178925-178954	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	75369-75398	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	153012-153041	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	589998-590027	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	81538-81567	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	845884-845913	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	258296-258325	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1723933-1723962	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1859622-1859651	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1841724-1841753	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1841724-1841753	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	137321-137350	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	258496-258525	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	257917-257946	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	234345-234374	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	461507-461536	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	254201-254230	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	236985-237014	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	298368-298397	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	258487-258516	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	461579-461608	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	390422-390451	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1964821-1964850	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	461516-461545	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	237930-237959	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	849014-849043	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1227007-1227036	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	238244-238273	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	245279-245308	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	235437-235466	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	126762-126791	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	234570-234599	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	258309-258338	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	231309-231338	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	235690-235719	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	238261-238290	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	251052-251081	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	298440-298469	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	230351-230380	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	461938-461967	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	438995-439024	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	245262-245291	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	245236-245265	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	241864-241893	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	240004-240033	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	235466-235495	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	280525-280554	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	251050-251079	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	HM560026	Uncultured bacterium plasmid pTRACA45, complete sequence	1764-1793	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_010867	Neisseria lactamica plasmid pNL3.1, complete sequence	3216-3245	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	121720-121749	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	535160-535189	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	326858-326887	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	121664-121693	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	KT997827	Uncultured Mediterranean phage uvDeep-CGR0-KM15-C219, complete genome	28429-28458	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	235977-236006	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1424992-1425021	7	0.767
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	KT997829	Uncultured Mediterranean phage uvDeep-CGR0-KM22-C158, complete genome	24686-24715	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	278785-278814	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	113824-113853	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	158849-158878	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	384914-384943	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	317121-317150	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	385410-385439	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	260932-260961	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	329309-329338	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	391416-391445	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	243975-244004	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	301676-301705	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	201076-201105	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	635292-635321	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	422833-422862	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	494408-494437	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	MN582086	Siphoviridae sp. ctdEk19, complete genome	33318-33347	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	864583-864612	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP022700	Acetobacter tropicalis strain BDGP1 plasmid pAtBDGP1A, complete sequence	61493-61522	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1238691-1238720	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1484042-1484071	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1466967-1466996	7	0.767
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	119508-119537	7	0.767
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	NC_022087	Mycobacterium phage AnnaL29, complete genome	5558-5593	7	0.806
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210628-2210661	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2209827-2209860	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	24930-24963	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2133215-2133248	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT889380	Mycobacterium phage Coco12, complete genome	22836-22869	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT114167	Mycobacterium phage Phanphagia, complete genome	22491-22524	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	531146-531179	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	117310-117343	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	254574-254607	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP039641	Azospirillum sp. TSH100 plasmid p2, complete sequence	30914-30947	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH697583	Mycobacterium phage EricMillard, complete genome	32257-32290	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH727551	Mycobacterium phage Kalah2, complete genome	32307-32340	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH077579	Mycobacterium phage Halley, complete genome	31970-32003	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH669017	Mycobacterium phage Zelink, complete genome	33051-33084	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN062701	Mycobacterium phage Dallas, complete genome	31496-31529	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK524527	Mycobacterium phage ThreeRngTarjay, complete genome	32107-32140	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK524529	Mycobacterium phage Phoebus, complete genome	32257-32290	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MF919512	Mycobacterium phage Klein, complete genome	31531-31564	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KF114875	Mycobacterium phage Redno2, complete genome	31720-31753	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK967379	Mycobacterium phage HokkenD, complete genome	31519-31552	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	307986-308019	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	178492-178525	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	275379-275412	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445383-445416	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	275378-275411	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN813686	Mycobacterium phage BirdsNest, complete genome	30327-30360	7	0.794
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_042035	Mycobacterium phage Zemanar, complete sequence	31516-31549	7	0.794
CP025597_5	5.9\|1212412\|37\|CP025597\|CRISPRCasFinder	1212412-1212448	37	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	136890-136926	7	0.811
CP025597_6	6.1\|1572172\|28\|CP025597\|CRISPRCasFinder	1572172-1572199	28	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	259627-259654	7	0.75
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	281800-281830	7	0.774
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	CP017041	Propionibacterium sp. oral taxon 193 strain F0672 plasmid unnamed1, complete sequence	68407-68437	7	0.774
CP025597_7	7.3\|2088375\|30\|CP025597\|CRT	2088375-2088404	30	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	52187-52216	7	0.767
CP025597_7	7.3\|2088375\|30\|CP025597\|CRT	2088375-2088404	30	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	75140-75169	7	0.767
CP025597_7	7.3\|2088375\|30\|CP025597\|CRT	2088375-2088404	30	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	376489-376518	7	0.767
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	147567-147597	7	0.774
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	36995-37025	7	0.774
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP042263	Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence	372247-372277	7	0.774
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1386736-1386768	8	0.758
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	35126-35158	8	0.758
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1241611-1241643	8	0.758
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	275839-275871	8	0.758
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	310597-310629	8	0.758
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2714450-2714479	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	837910-837939	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	424702-424731	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	975216-975245	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1013021-1013050	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_KY126370	Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence	93253-93282	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	22400-22429	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1889334-1889363	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	21202-21231	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	30108-30137	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	32856-32885	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP032156	Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence	111116-111145	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	KY555144	Caulobacter phage Ccr5, complete genome	178242-178271	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_KP873172	Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence	21059-21088	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	159096-159125	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NC_021492	Enterobacter sp. R4-368 plasmid pENT01, complete sequence	50097-50126	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	15249-15278	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP024682	Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence	41943-41972	8	0.733
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	242723-242752	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	28649-28678	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	310870-310899	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	462801-462830	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	292109-292138	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	287383-287412	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	292305-292334	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	292675-292704	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	306458-306487	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	292675-292704	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	295900-295929	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	292670-292699	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	306458-306487	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	292305-292334	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	298287-298316	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1682210-1682239	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	294530-294559	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	375826-375855	8	0.733
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	112972-113001	8	0.733
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	MG770216	Mycobacterium phage Rem711, complete genome	26292-26327	8	0.778
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	KY087993	Mycobacterium phage Hammy, complete genome	24359-24394	8	0.778
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	MF140406	Mycobacterium phage DarthP, complete genome	24368-24403	8	0.778
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466471-3466504	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350662-350695	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350530-350563	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051061-3051094	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	36586-36619	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_047958	Burkholderia phage vB_BmuP_KL4, complete genome	28566-28599	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	117037-117070	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	928385-928418	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	131278-131311	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	117079-117112	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	117037-117070	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	670302-670335	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1123064-1123097	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	530145-530178	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	187401-187434	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN234223	Mycobacterium phage Philly, complete genome	30948-30981	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KJ194581	Mycobacterium phage Audrey, complete genome	31094-31127	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH051265	Mycobacterium phage Yahalom, complete genome	31107-31140	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH316565	Mycobacterium phage Mortcellus, complete genome	31732-31765	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT310871	Mycobacterium phage Jackstina, complete genome	31017-31050	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	EU816589	Mycobacterium phage Phaedrus, complete genome	31013-31046	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT952851	Mycobacterium phage Gervas, complete genome	31075-31108	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MG920059	Mycobacterium phage Baloo, complete genome	31097-31130	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_023686	Mycobacterium phage Gadjet, complete genome	31104-31137	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_041965	Mycobacterium phage Athena, complete genome	31845-31878	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	DQ398049	Mycobacterium phage Pipefish, complete genome	32489-32522	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT310892	Mycobacterium phage Compostia, complete genome	31524-31557	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN699018	Mycobacterium phage Kamiyu, complete genome	31063-31096	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687345-687378	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	118498-118531	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	539300-539333	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK814754	Mycobacterium phage Sumter, complete genome	28141-28174	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK814754	Mycobacterium phage Sumter, complete genome	28639-28672	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN369739	Mycobacterium phage Kenuha5, complete genome	22588-22621	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK967397	Mycobacterium phage Mahavrat, complete genome	24814-24847	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT522000	Mycobacterium phage Soul22, complete genome	22192-22225	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KY348865	Mycobacterium phage Bubbles123, complete genome	25540-25573	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN428047	Mycobacterium phage Doomphist, complete genome	24962-24995	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22190-22223	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AY129336	Mycobacteriophage Che9d, complete genome	22205-22238	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT771340	Mycobacterium phage Jorgensen, complete genome	28476-28509	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK359343	Mycobacterium phage Pollywog, complete genome	23655-23688	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_042030	Mycobacterium phage Yoshi, complete sequence	22193-22226	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_048729	Mycobacterium phage Renaud18, complete genome	22865-22898	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_026585	Mycobacteriophage Estave1, complete genome	22558-22591	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK305886	Mycobacterium phage Poenanya, complete genome	24962-24995	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN859129	Mycobacterium virus DotProduct, complete genome	24829-24862	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MG925354	Mycobacterium phage Ogopogo, complete genome	22785-22818	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN698995	Mycobacterium phage Dori, complete genome	28163-28196	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_023698	Mycobacterium phage Avani, complete genome	22197-22230	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_011054	Mycobacterium phage Boomer, complete genome	24637-24670	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN234184	Mycobacterium phage IdentityCrisis, complete genome	19984-20017	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH077585	Mycobacterium phage TChen, complete genome	22970-23003	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_048788	Mycobacterium phage ThetaBob, complete genome	22783-22816	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	125963-125996	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	138036-138069	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN096355	Mycobacterium phage Purky, complete genome	13505-13538	8	0.765
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN234183	Mycobacterium phage Antsirabe, complete genome	23060-23093	8	0.765
CP025597_5	5.9\|1212412\|37\|CP025597\|CRISPRCasFinder	1212412-1212448	37	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	683728-683764	8	0.784
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	349053-349083	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP039899	Agrobacterium tumefaciens strain CFBP5877 plasmid pAtCFBP5877a, complete sequence	336247-336277	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP039913	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence	262996-263026	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP039890	Agrobacterium tumefaciens strain CFBP5499 plasmid pAtCFBP5499a, complete sequence	336247-336277	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	264529-264559	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	458177-458207	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	311056-311086	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	88587-88617	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	CP036360	Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence	284157-284187	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP021914	Sagittula sp. P11 plasmid unnamed1, complete sequence	300067-300097	8	0.742
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1510497-1510527	8	0.742
CP025597_7	7.3\|2088375\|30\|CP025597\|CRT	2088375-2088404	30	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	9194-9223	8	0.733
CP025597_7	7.3\|2088375\|30\|CP025597\|CRT	2088375-2088404	30	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	983284-983313	8	0.733
CP025597_10	10.24\|3122381\|29\|CP025597\|PILER-CR	3122381-3122409	29	MK599315	Pseudomonas phage PA1C, complete genome	299172-299200	8	0.724
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	CP033373	Lactobacillus fermentum strain DR9 plasmid unnamed2, complete sequence	12237-12267	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1260343-1260373	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1009358-1009388	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1260501-1260531	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1009351-1009381	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	756669-756699	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1137767-1137797	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1009365-1009395	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1260057-1260087	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1260001-1260031	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	981946-981976	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	938267-938297	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	748414-748444	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	896022-896052	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	215713-215743	8	0.742
CP025597_11	11.7\|3741130\|31\|CP025597\|CRT	3741130-3741160	31	NC_014213	Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence	111748-111778	8	0.742
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	91175-91207	9	0.727
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	668963-668995	9	0.727
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	789706-789738	9	0.727
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	625853-625885	9	0.727
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	NZ_CP014964	Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence	13698-13728	9	0.71
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	20960-20990	9	0.71
CP025597_2	2.1\|692022\|31\|CP025597\|CRISPRCasFinder	692022-692052	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	15390-15420	9	0.71
CP025597_3	3.13\|927190\|30\|CP025597\|CRT	927190-927219	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5046041-5046070	9	0.7
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	65937-65966	9	0.7
CP025597_3	3.15\|927286\|30\|CP025597\|CRT	927286-927315	30	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	65937-65966	9	0.7
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	MF140398	Mycobacterium phage Amohnition, complete genome	24446-24481	9	0.75
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350101-350134	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210928-2210961	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	231456-231489	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306612-306645	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283233-283266	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	EF602154	Burkholderia phage BcepNY3, complete genome	21505-21538	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AY369265	Burkholderia cenocepacia phage Bcep1, complete genome	23287-23320	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_005263	Burkholderia phage Bcep1, complete genome	23287-23320	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	307143-307176	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	298112-298145	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	723127-723160	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP053906	Hymenobacter sp. BRD67 plasmid unnamed2, complete sequence	19270-19303	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KC170279	Uncultured bacterium plasmid pMBUI8, complete sequence	15929-15962	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	652970-653003	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	490801-490834	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	637964-637997	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	235008-235041	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	646029-646062	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	635838-635871	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684904-684937	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1303766-1303799	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	897262-897295	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233325-233358	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	560015-560048	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1424629-1424662	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	796570-796603	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	659643-659676	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1083784-1083817	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1052610-1052643	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1150006-1150039	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	654523-654556	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	771404-771437	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	290861-290894	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	371773-371806	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1224363-1224396	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	997046-997079	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1083789-1083822	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH001451	Mycobacterium phage Nairb, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MF155936	Mycobacterium phage ZenTime222, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH588544	Caulobacter phage CcrBL10, complete genome	39042-39075	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK494089	Mycobacterium phage Ibrahim, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_024135	Mycobacterium phage Bernal13, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KM591905	Mycobacterium phage RonRayGun, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN735432	Mycobacteriophage Whitty, complete genome	21242-21275	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KX443399	Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence	82507-82540	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KX443400	Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence	82532-82565	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KX443398	Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence	82528-82561	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	CP054922	Streptomyces sp. NA03103 plasmid unnamed2, complete sequence	90688-90721	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KP851975	Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence	82645-82678	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	55533-55566	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	318448-318481	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KF439868	Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence	81659-81692	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	84861-84894	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	135548-135581	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	498515-498548	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	927230-927263	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	241368-241401	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	455289-455322	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	241368-241401	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	239809-239842	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	244056-244089	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	238174-238207	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013512	Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence	131481-131514	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	241368-241401	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	747004-747037	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KC736071	Mycobacterium phage WIVsmall, complete genome	29683-29716	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	171949-171982	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	52095-52128	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP041653	Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence	129601-129634	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	301604-301637	9	0.735
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	779027-779060	9	0.735
CP025597_5	5.9\|1212412\|37\|CP025597\|CRISPRCasFinder	1212412-1212448	37	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	686592-686628	9	0.757
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	345043-345073	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	245050-245080	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	194387-194417	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	MN234199	Mycobacterium phage Ekdilam, complete genome	24235-24265	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1145162-1145192	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	453136-453166	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP013740	Streptomyces globisporus C-1027 plasmid pSGL1, complete sequence	2806-2836	9	0.71
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1908459-1908489	9	0.71
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	922290-922323	9	0.735
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	MG812496	Gordonia phage SallySpecial, complete genome	7675-7708	9	0.735
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	91179-91211	10	0.697
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	90245-90277	10	0.697
CP025597_1	1.6\|366824\|33\|CP025597\|CRISPRCasFinder	366824-366856	33	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	99166-99198	10	0.697
CP025597_3	3.2\|926686\|39\|CP025597\|CRT	926686-926724	39	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	107058-107096	10	0.744
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	MN369764	Mycobacterium phage Rahalelujah, complete genome	24340-24375	10	0.722
CP025597_3	3.17\|927376\|36\|CP025597\|CRT	927376-927411	36	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	25147-25182	10	0.722
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210946-2210979	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1732364-1732397	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	21676-21709	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	CP000620	Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence	96060-96093	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP020810	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed1, complete sequence	93944-93977	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	98684-98717	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK524490	Mycobacterium phage Donny, complete genome	33811-33844	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MK494095	Mycobacterium phage Daegal, complete genome	5959-5992	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN699007	Mycobacterium phage Acadian, complete genome	33806-33839	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MT889381	Mycobacterium phage Suigeneris, complete genome	33811-33844	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	47518-47551	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AP018709	Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence	27460-27493	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	194712-194745	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	362178-362211	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_008766	Acidovorax sp. JS42 plasmid pAOVO02, complete sequence	10252-10285	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	677361-677394	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	8446-8479	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	65893-65926	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	640930-640963	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	104485-104518	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_024998	Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83	31366-31399	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_008385	Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence	29995-30028	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP018471	Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence	16577-16610	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_MN366359	Bacterium plasmid pALTS31, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	100724-100757	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_001735	Enterobacter aerogenes plasmid R751, complete sequence	31148-31181	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AGRM01000006	Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence	12357-12390	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AJ863570	Uncultured bacterium IncP-1beta multiresistance plasmid pB8	25168-25201	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	17683-17716	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1350942-1350975	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	136497-136530	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_021492	Enterobacter sp. R4-368 plasmid pENT01, complete sequence	46815-46848	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JX469828	Uncultured bacterium plasmid pRSB223, complete sequence	25131-25164	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JX469829	Uncultured bacterium plasmid pB1, complete sequence	16215-16248	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	15931-15964	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	15932-15965	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	15939-15972	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	15929-15962	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN386974	Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence	16066-16099	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_001381	Mycobacterium fortuitum plasmid pAL5000, complete sequence	2682-2715	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	31441-31474	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP021650	Acidovorax sp. T1 plasmid p2-T1, complete sequence	40579-40612	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	JX486125	Uncultured bacterium plasmid pRWC72a, complete sequence	15940-15973	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP038640	Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence	50284-50317	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	AJ639924	Uncultured bacterium plasmid pB3 complete genome	17431-17464	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KU356987	Variovorax paradoxus plasmid pBS64, complete sequence	15928-15961	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	KU356988	Variovorax paradoxus plasmid pHB44, complete sequence	15930-15963	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	155712-155745	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP009797	Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence	16433-16466	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	10533-10566	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_019320	Variovorax sp. DB1 plasmid pDB1, complete sequence	49358-49391	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP017455	Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence	23524-23557	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	71777-71810	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_MN366358	Bacterium plasmid pALTS29, complete sequence	15940-15973	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MN234219	Mycobacterium phage Mercurio, complete genome	23308-23341	10	0.706
CP025597_5	5.9\|1212412\|37\|CP025597\|CRISPRCasFinder	1212412-1212448	37	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	331923-331959	10	0.73
CP025597_5	5.9\|1212412\|37\|CP025597\|CRISPRCasFinder	1212412-1212448	37	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	716620-716656	10	0.73
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	425898-425928	10	0.677
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	344090-344120	10	0.677
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	68383-68413	10	0.677
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	16322-16352	10	0.677
CP025597_6	6.10\|1572787\|31\|CP025597\|CRISPRCasFinder	1572787-1572817	31	NZ_AP014581	Burkholderia sp. RPE67 plasmid p3, complete sequence	131907-131937	10	0.677
CP025597_6	6.13\|1573036\|34\|CP025597\|CRISPRCasFinder	1573036-1573069	34	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	1081518-1081551	10	0.706
CP025597_9	9.9\|3119783\|35\|CP025597\|PILER-CR,CRISPRCasFinder,CRT	3119783-3119817	35	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	414652-414686	10	0.714
CP025597_10	10.20\|3123254\|34\|CP025597\|CRISPRCasFinder,CRT	3123254-3123287	34	NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	171698-171731	10	0.706
CP025597_10	10.36\|3123258\|34\|CP025597\|PILER-CR	3123258-3123291	34	NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	171698-171731	10	0.706
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	470079-470112	10	0.706
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	68774-68807	10	0.706
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	172270-172303	10	0.706
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	172270-172303	10	0.706
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350092-350125	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	239254-239287	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MH051334	Escherichia phage vB_EcoS-Ro145c2YLVW, complete genome	23136-23169	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	MG852086	Escherichia phage vB_EcoS-Ro145clw, complete genome	41310-41343	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261086-261119	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	584732-584765	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	70292-70325	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	507461-507494	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	155836-155869	11	0.676
CP025597_5	5.5\|1212196\|40\|CP025597\|CRISPRCasFinder	1212196-1212235	40	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261884-261923	11	0.725
CP025597_11	11.5\|3740989\|34\|CP025597\|CRT	3740989-3741022	34	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	326578-326611	11	0.676
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190139-190172	12	0.647
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_CP026703	Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence	14966-14999	12	0.647
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	302491-302524	14	0.588
CP025597_5	5.3\|1212091\|34\|CP025597\|CRISPRCasFinder	1212091-1212124	34	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	282346-282379	15	0.559

1. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 1, identity: 0.955

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggcggtgcc	Protospacer
********************.*

2. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcggcc	Protospacer
*********************

3. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcggcc	Protospacer
*********************

4. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP016457 (Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcgggccggcggca	Protospacer
**********.***********

5. spacer 6.15|1573159|22|CP025597|CRISPRCasFinder matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

6. spacer 6.15|1573159|22|CP025597|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

7. spacer 6.15|1573159|22|CP025597|CRISPRCasFinder matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

8. spacer 6.15|1573159|22|CP025597|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

9. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggcggtggg	Protospacer
********************

10. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
agtcggcggtgccgacggtgtc	Protospacer
 *************.*******

11. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggcgtc	Protospacer
.*****************.***

12. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_021056 (Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgtcggcggtgtc	Protospacer
.**********.**********

13. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
ggtcggcggtgccggcggcgtc	Protospacer
 *****************.***

14. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggccgtgta	Protospacer
**************** ****

15. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggccgtgta	Protospacer
**************** ****

16. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
ggtcggcggtgccggccgtgtc	Protospacer
 *************** *****

17. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_047977 (Microbacterium phage Hendrix, complete genome) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgacggcggtgccggcggtgtg	Protospacer
** ******************

18. spacer 5.15|1212712|22|CP025597|CRISPRCasFinder matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 2, identity: 0.909

ggacggtggtaccggcggtcag	CRISPR spacer
tgacggtggtgccggcggtcag	Protospacer
 *********.***********

19. spacer 6.2|1572232|22|CP025597|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

20. spacer 6.2|1572232|22|CP025597|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

21. spacer 6.2|1572232|22|CP025597|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

22. spacer 6.2|1572232|22|CP025597|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

23. spacer 6.2|1572232|22|CP025597|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

24. spacer 6.3|1572286|22|CP025597|CRISPRCasFinder matches to NZ_CP025510 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvD, complete sequence) position: , mismatch: 2, identity: 0.909

ggtaccgtcctcgccggcggtg	CRISPR spacer
ggcaccgtcctcgccggcggtt	Protospacer
**.******************

25. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP021032 (Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcc	Protospacer
.********************

26. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

27. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

28. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcc	Protospacer
.********************

29. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

30. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

31. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

32. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

33. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

34. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgggg	Protospacer
******************** .

35. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP012698 (Microbacterium sp. No. 7 plasmid A, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
accgccgatcaggccggcggca	Protospacer
..********************

36. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
ctcggcgatcaggccggcggca	Protospacer
 *** *****************

37. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

38. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

39. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

40. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

41. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcg	Protospacer
***************** ***.

42. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
ggcgccgatcaggccggcggcc	Protospacer
* *******************

43. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggcctgcggcg	Protospacer
*************** *****.

44. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

45. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP024312 (Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgccg	Protospacer
******************* *.

46. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgagcaggccggcggcc	Protospacer
******** ************

47. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

48. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

49. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

50. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

51. spacer 3.16|927334|24|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgacctcggcggcgcgggcga	Protospacer
.***************** ****.

52. spacer 3.16|927334|24|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccggcctgggcggcgctggcgg	Protospacer
 ****.*** **************

53. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP034768 (Enterobacter sp. N18-03635 plasmid pFRI-6, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

54. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
agccgacctcggcggcgatggcgc	Protospacer
*.*************** *****

55. spacer 3.16|927334|24|CP025597|CRT matches to NZ_AP019631 (Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

56. spacer 3.16|927334|24|CP025597|CRT matches to NZ_AP019631 (Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

57. spacer 3.16|927334|24|CP025597|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

58. spacer 3.16|927334|24|CP025597|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

59. spacer 3.16|927334|24|CP025597|CRT matches to MK016502 (Mycobacterium phage Pat3, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

60. spacer 3.16|927334|24|CP025597|CRT matches to MK937593 (Mycobacterium phage Flypotenuse, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

61. spacer 3.16|927334|24|CP025597|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

62. spacer 3.16|927334|24|CP025597|CRT matches to MH536820 (Mycobacterium phage Glexan, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

63. spacer 3.16|927334|24|CP025597|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
aaccggcctcggcggcgctgccgc	Protospacer
*****.************** **

64. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccgagctcggcggcgctgccgg	Protospacer
 ***** ************* ***

65. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccggcctcggcggcgcgggcgg	Protospacer
 ****.************ *****

66. spacer 3.16|927334|24|CP025597|CRT matches to MH271298 (Microbacterium phage Floof, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
aacccacctcggcggcgatggcgc	Protospacer
**** ************ *****

67. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to MN703413 (Arthrobacter phage Powerpuff, complete genome) position: , mismatch: 3, identity: 0.88

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgcgggcggcctcggcgtagcgctt	Protospacer
*** *******************..

68. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to MT024871 (Arthrobacter phage YesChef, complete genome) position: , mismatch: 3, identity: 0.88

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgcgggcggcctcggcgtagcgctt	Protospacer
*** *******************..

69. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtgag	Protospacer
.*******************

70. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP040721 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
gtgcggcggtgccggcggtgtc	Protospacer
   *******************

71. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP040721 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
gtgcggcggtgccggcggtgtc	Protospacer
   *******************

72. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtgag	Protospacer
.*******************

73. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtggt	Protospacer
.******************* .

74. spacer 5.7|1212328|22|CP025597|CRISPRCasFinder matches to KT381864 (Thiobacimonas phage vB_ThpS-P1, complete genome) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
catcggcggtgccggcggtgtg	Protospacer
..*******************

75. spacer 5.11|1212511|22|CP025597|CRISPRCasFinder matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.864

gctgtggggcggcggtggtgcc	CRISPR spacer
cgtgtggggcggcggtggtgca	Protospacer
  *******************

76. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 3, identity: 0.864

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgcgg	Protospacer
*******************  .

77. spacer 6.4|1572340|22|CP025597|CRISPRCasFinder matches to NZ_CP021649 (Acidovorax sp. T1 plasmid p1-T1, complete sequence) position: , mismatch: 3, identity: 0.864

gtcgccgatcaggccggcggca	CRISPR spacer
ttcgccgatcaggccggcggtg	Protospacer
 *******************..

78. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
ctcgccgaacacgcggaagccgtct	Protospacer
**.*********** *********

79. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
attgtcgaacacgcggaagccgtcg	Protospacer
 ***.********* **********

80. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

81. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NC_031254 (Arthrobacter phage Kitkat, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

82. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

83. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
catgcggaacacgccgaatccgtcg	Protospacer
* *** ************ ******

84. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgatcacgccgtagccgttg	Protospacer
******** ******* ******.*

85. spacer 6.15|1573159|22|CP025597|CRISPRCasFinder matches to NC_008270 (Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence) position: , mismatch: 3, identity: 0.864

caatccggcggcgccgccggca	CRISPR spacer
gaatccggcggcgccgccgggc	Protospacer
 *******************

86. spacer 7.5|2088465|24|CP025597|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 3, identity: 0.875

atcgaagaagctgaacccgccgtt	CRISPR spacer
cgcgaagaagctgaagccgccgtt	Protospacer
  ************* ********

87. spacer 7.5|2088465|24|CP025597|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 3, identity: 0.875

atcgaagaagctgaacccgccgtt	CRISPR spacer
cgcgaagaagctgaagccgccgtt	Protospacer
  ************* ********

88. spacer 1.1|366494|27|CP025597|CRISPRCasFinder matches to NC_023591 (Mycobacterium phage Adler, complete genome) position: , mismatch: 4, identity: 0.852

-aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
cagtgc-ccggtgtccccatcgcccgtg	Protospacer
 *..** ********* ***********

89. spacer 1.1|366494|27|CP025597|CRISPRCasFinder matches to KF981876 (UNVERIFIED: Mycobacterium phage ADLER F1725, complete genome) position: , mismatch: 4, identity: 0.852

-aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
cagtgc-ccggtgtccccatcgcccgtg	Protospacer
 *..** ********* ***********

90. spacer 1.7|366890|27|CP025597|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 4, identity: 0.852

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
ccgaagccgatgtcgtagcggccggcg	Protospacer
 ************.***** *****.*

91. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgaaggtgaggtcgccgggg	Protospacer
.* ********* ***********.**

92. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NC_016652 (Rhodococcus phage REQ2, complete genome) position: , mismatch: 4, identity: 0.852

accccgccgaagttgaggtcgccgagg	CRISPR spacer
acggcgccgaagttgaggccgccgacg	Protospacer
**  **************.****** *

93. spacer 3.10|927049|27|CP025597|CRT matches to KY945355 (Mycobacterium phage Shandong1, complete genome) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgcatccggcggcggcggttgcgttct	Protospacer
** **************** ***** .

94. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggcctcggcggcggcggtggcgttgc	Protospacer
*** ..*************.*******

95. spacer 3.10|927049|27|CP025597|CRT matches to NC_041888 (Mycobacterium phage Tortellini, complete genome) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggccgcggcggcggcggtagcggtgc	Protospacer
*** . ***************** ***

96. spacer 3.15|927286|30|CP025597|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.867

cctgctgttcggctccggcggcgctggcgg-	CRISPR spacer
gctgctgttcggcgccggcggcg-tggtggc	Protospacer
 ************ ********* ***.**

97. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ctacgaccacggcggcgctggcgg	Protospacer
   ***** ***************

98. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
gcccgatctcggcggcgctggcgt	Protospacer
. ****.****************

99. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tcccgacctcggcggtgctggcgc	Protospacer
  *************.*******

100. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP016822 (Rhodococcus sp. p52 plasmid pDF03, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cgtcgacgtcggcggcgctggcgg	Protospacer
 ..**** ****************

101. spacer 3.16|927334|24|CP025597|CRT matches to MN582086 (Siphoviridae sp. ctdEk19, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cttcgacttcggcggcgctggcgg	Protospacer
  .****.****************

102. spacer 3.16|927334|24|CP025597|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

103. spacer 3.16|927334|24|CP025597|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

104. spacer 3.16|927334|24|CP025597|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

105. spacer 3.16|927334|24|CP025597|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

106. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cgccgacctcggcggcggtggcga	Protospacer
 .*************** *****.

107. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tcccgacctcggcggtgctggcgc	Protospacer
  *************.*******

108. spacer 3.16|927334|24|CP025597|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ctacgaccacggcggcgctggcgg	Protospacer
   ***** ***************

109. spacer 3.16|927334|24|CP025597|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tctcgacctcggcggcgatggcgg	Protospacer
  .************** ******

110. spacer 3.16|927334|24|CP025597|CRT matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tgccgacctcggctgcgctggcgc	Protospacer
 .*********** *********

111. spacer 3.16|927334|24|CP025597|CRT matches to MK279853 (Gordonia phage Gray, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ggtcgacctcgacggcgctggcgg	Protospacer
...********.************

112. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggcggcctcggcggagcgctg	Protospacer
 **************** *****.

113. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggcggcctcggcggagcgctg	Protospacer
 **************** *****.

114. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

115. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to CP003956 (Rhodococcus opacus PD630 plasmid 7, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
gtccggcggccttggcgtagcgcct	Protospacer
  **********.***********.

116. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

117. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NC_012723 (Burkholderia glumae BGR1 plasmid bglu_1p, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggccccggcgtcgcgcga	Protospacer
***********.****** ****

118. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtaatggtc	Protospacer
*******************..* .*

119. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggcatcggcgtagcggcg	Protospacer
.********* *********** *

120. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggcctccgcgtcgcgcct	Protospacer
.************ **** *****.

121. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgtcggcggcctcggcgtagcgggc	Protospacer
.*.*******************  *

122. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NC_022437 (Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggccgcgtcgtagcgcca	Protospacer
.********** ** *********

123. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

124. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggtgtcctcggcgtagcgcga	Protospacer
******.* **************

125. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP051294 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctccgcgaagcgctt	Protospacer
************* *** *****..

126. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggctgcctcggcatagcgccg	Protospacer
 ****** ********.*******

127. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

128. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggtggcctcggcgtagccccg	Protospacer
.*****.************** **

129. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP033363 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctccgcgaagcgctt	Protospacer
************* *** *****..

130. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tggcggcggcctcgccgtagcgctt	Protospacer
** *********** ********..

131. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgtcggcggcctcggcgtagcggac	Protospacer
.*.*******************  *

132. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP014580 (Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
agccggcggcctcggcctcgcgccg	Protospacer
 *************** * *****

133. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

134. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

135. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

136. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

137. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP021372 (Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
tccgccgaacgcgccgaagccgtcg	Protospacer
...*******.**************

138. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gctgccgaacacgccgatgccgacg	Protospacer
 .*************** **** **

139. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gctgccgaacacgccgatgccgacg	Protospacer
 .*************** **** **

140. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to MT553342 (Microbacterium phage Kelcole, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

141. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NC_048068 (Microbacterium phage OneinaGillian, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

142. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to MT310894 (Microbacterium phage Tempo, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

143. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacacgccgatgccctgc	Protospacer
***************** *** *

144. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
aatgccgaattcgccgaagccgtcg	Protospacer
  *******. **************

145. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to MN034284 (Leviviridae sp. isolate H2_Rhizo_Litter_49_scaffold_25938 sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cccgtagaacacgccgaagccgtcg	Protospacer
*..*. *******************

146. spacer 6.14|1573102|25|CP025597|CRISPRCasFinder matches to MN582064 (Podoviridae sp. ctka020, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgccaccgacccccccttgc	CRISPR spacer
ttttccgacaccgacccccccttga	Protospacer
.** *** ****************

147. spacer 7.5|2088465|24|CP025597|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
atcgaagaagctgaacacgcccgc	Protospacer
**************** ****  .

148. spacer 7.5|2088465|24|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
gtcgatgaagctgaacccgccgaa	Protospacer
.**** ****************

149. spacer 7.5|2088465|24|CP025597|CRT matches to NZ_CP015007 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
atcggagaagctgaacccgcccgg	Protospacer
****.****************

150. spacer 1.1|366494|27|CP025597|CRISPRCasFinder matches to LR794124 (Vibrio phage vB_Vc_SrVc9 genome assembly, chromosome: 1) position: , mismatch: 5, identity: 0.815

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
aacgcaccgttgtccacatcaccaatc	Protospacer
********* **********.** .*

151. spacer 1.1|366494|27|CP025597|CRISPRCasFinder matches to NC_012662 (Vibrio phage VP93, complete genome) position: , mismatch: 5, identity: 0.815

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
aacgcaccgttgtccacatcaccaatc	Protospacer
********* **********.** .*

152. spacer 1.7|366890|27|CP025597|CRISPRCasFinder matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
gcgaagccgaagttgtagctgcgctcg	Protospacer
********** ***********   .*

153. spacer 1.7|366890|27|CP025597|CRISPRCasFinder matches to MN693945 (Marine virus AFVG_250M952, complete genome) position: , mismatch: 5, identity: 0.815

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
atgaagccgatgttgtcgctaccgggg	Protospacer
..************** ***.**** *

154. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

155. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

156. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

157. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP015368 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p1, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tccccgcggaagttgaggtcgcgggtg	Protospacer
 ****** ************** *. *

158. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

159. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

160. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

161. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

162. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

163. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

164. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

165. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

166. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP020444 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

167. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

168. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

169. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

170. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP044078 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

171. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP031081 (Paracoccus yeei strain CCUG 32053 plasmid pYEE3, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

172. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MN586031 (Gordonia phage Gambino, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

173. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to KU998236 (Gordonia phage Blueberry, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

174. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MN062704 (Gordonia phage JuJu, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

175. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MK501729 (Gordonia phage Walrus, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

176. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NC_031226 (Gordonia phage BaxterFox, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

177. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MK967393 (Rhodococcus phage Whack, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tccttaccgaagttgaggtcgacgagg	Protospacer
 **...*************** *****

178. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MT723935 (Gordonia phage Azula, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

179. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to KU963249 (Gordonia phage Yeezy, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

180. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MH153808 (Gordonia phage Petra, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

181. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MT639650 (Gordonia phage Ohgeesy, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

182. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MH536818 (Gordonia phage Frokostdame, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

183. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to KX557275 (Gordonia phage CarolAnn, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

184. spacer 3.5|926839|27|CP025597|CRT matches to KX683875 (Mycobacterium phage Baehexic, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

185. spacer 3.5|926839|27|CP025597|CRT matches to KM197169 (Mycobacterium phage Piro94, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

186. spacer 3.5|926839|27|CP025597|CRT matches to MF668269 (Mycobacterium phage Drake55, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

187. spacer 3.5|926839|27|CP025597|CRT matches to MK284522 (Mycobacterium phage Malec, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

188. spacer 3.5|926839|27|CP025597|CRT matches to KM677210 (Mycobacterium phage Larenn, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

189. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
ggcaggcggcggcggcggtagcgttgg	Protospacer
 * *  ********************

190. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
ggcaggcggcggcggcggtagcgttgg	Protospacer
 * *  ********************

191. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
aggatccggccgcggcggtagcgctcg	Protospacer
 ********* ************.*

192. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
aggatccggccgcggcggtagcgctcg	Protospacer
 ********* ************.*

193. spacer 3.10|927049|27|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgggtccggcggcggcggtggcggttt	Protospacer
***.***************.*** * .

194. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP049908 (Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgactccggcggcgggggtagcgttcg	Protospacer
**. *********** *********

195. spacer 3.10|927049|27|CP025597|CRT matches to NZ_CP049700 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgccgccggcggcggcggtggcgttgg	Protospacer
**   **************.******

196. spacer 3.10|927049|27|CP025597|CRT matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
tgactccggcggcggccgtggcgttgc	Protospacer
.*. ************ **.*******

197. spacer 3.10|927049|27|CP025597|CRT matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
tgactccggcggcggccgtggcgttgc	Protospacer
.*. ************ **.*******

198. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgaggccggcctgctggtcgtctccgggct	Protospacer
*** **************** ******

199. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
agattccggcctgttcgtcggctccggcgg	Protospacer
 **. ********.* **************

200. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgccatcggcctgctgctcggcaccggcgg	Protospacer
** *..********** ***** *******

201. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP031193 (Humibacter sp. BT305 plasmid unnamed1) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgccgccggcctgctggtcggcgcggcggg	Protospacer
** ******************* * *  **

202. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggc-tccggcgg	CRISPR spacer
cgacgccggcatgccggtcggcttcctgct-	Protospacer
********** ***.******* *** **

203. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
attgctgttcggctgcggcggcgcgggcgc	Protospacer
 .************ ********* ****

204. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
attgctgttcggctgcggcggcgcgggcgc	Protospacer
 .************ ********* ****

205. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcactcgg	Protospacer
*******.***** **********   ***

206. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP046705 (Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctg--ttcggctccggcggcgctggcgg	CRISPR spacer
--tactgattacggctccggcggtgctggcgg	Protospacer
  *.***  * ************.********

207. spacer 3.15|927286|30|CP025597|CRT matches to AY950802 (Haloarcula phage SH1, complete genome) position: , mismatch: 5, identity: 0.833

--cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ggcctac--ttcggctccggcggctccggcgg	Protospacer
  ***.*  *************** *.*****

208. spacer 3.16|927334|24|CP025597|CRT matches to NC_006911 (Streptomyces sp. F11 plasmid pFP11, complete sequence) position: , mismatch: 5, identity: 0.792

aaccgacctcggcggcgctggcgg	CRISPR spacer
gggcgacctcggcggcgctggcct	Protospacer
.. *******************

209. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MG925349 (Mycobacterium phage Mendokysei, complete genome) position: , mismatch: 5, identity: 0.853

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggcgacggcgggttcccc	Protospacer
******************** ********  *.

210. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
gcgcggcggcctcggcgtagagccg	Protospacer
   ***************** ***

211. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NC_015178 (Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtggccgag	Protospacer
******************.**

212. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
caccggcggcctcggcgtagcttgc	Protospacer
..******************* . *

213. spacer 5.4|1212148|25|CP025597|CRISPRCasFinder matches to NC_009469 (Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtggccgag	Protospacer
******************.**

214. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_LN907828 (Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gctgccgtgggtgccatcgttgccgagt	Protospacer
*.***** *****************. .

215. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to KU728633 (Mycobacterium phage Bipper, complete genome) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gcgtccgggggtgccgtcgttgccgtcc	Protospacer
*.  ***********.********* **

216. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to MK977701 (Mycobacterium phage Cracklewink, complete genome) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gcgtccgggggtgccgtcgttgccgtcc	Protospacer
*.  ***********.********* **

217. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gttgccgcgggtgccctcgttgcggacg	Protospacer
******* ******* ******* *.*

218. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 5, identity: 0.8

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gccgccgaacacgccgaagccgttt	Protospacer
 ..********************.

219. spacer 6.5|1572394|25|CP025597|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 5, identity: 0.8

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaacacgccgacgccgcgc	Protospacer
 **************** ****.

220. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_018746 (Pseudomonas putida ND6 plasmid pND6-2, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

221. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to MN961671 (Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

222. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to MN961672 (Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

223. spacer 6.13|1573036|34|CP025597|CRISPRCasFinder matches to NC_006362 (Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence) position: , mismatch: 5, identity: 0.853

gtcgccgtgcagccagccaccaccgcca-ccggcg	CRISPR spacer
ttcgccgtgcagccggccaccacctccagcctgc-	Protospacer
 *************.********* *** ** **

224. spacer 11.7|3741130|31|CP025597|CRT matches to NC_010850 (Rhodococcus sp. NS1 plasmid pNSL1, complete sequence) position: , mismatch: 5, identity: 0.839

aacgccc-acttcaccgccgttgccgccgtca	CRISPR spacer
-acacccgacttcaccgccgctgccgccgaga	Protospacer
 **.*** ************.********  *

225. spacer 1.1|366494|27|CP025597|CRISPRCasFinder matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 6, identity: 0.778

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
agttcactggtgtccacatcgcccgaa	Protospacer
*.. ***.***************** .

226. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agcaggtcgatcacgatctggccgttgccggcg	Protospacer
**   *.***** ******************.*

227. spacer 1.7|366890|27|CP025597|CRISPRCasFinder matches to NZ_CP022542 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
ggataggcgatgttgtagctgccggaa	Protospacer
* . ** ****************** .

228. spacer 1.9|367040|27|CP025597|CRISPRCasFinder matches to NC_009959 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence) position: , mismatch: 6, identity: 0.778

gccaagccgatatcgaagatcccggtg	CRISPR spacer
accatgccgatatcgacgatcccgtcc	Protospacer
.*** *********** ******* .

229. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tagacgccgaagtcgaggtcggcgagg	Protospacer
    *********.******* *****

230. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
ctcccgccgaagttgagggtgccgaac	Protospacer
 .**************** .*****.

231. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
aagaagccgaagttgaggtcgccgtag	Protospacer
*    ******************* .*

232. spacer 1.10|367100|27|CP025597|CRISPRCasFinder matches to MK494099 (Mycobacterium phage Typha, complete genome) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
cggtcgccgaggtcgaggtcgccgagg	Protospacer
   .******.**.*************

233. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to GQ141189 (Bifidobacterium phage Bbif-1, complete sequence) position: , mismatch: 6, identity: 0.806

agcgcgaacggcaagccgaac----cgttggaccc	CRISPR spacer
agcgcgaacggccagccgaaccatgcgctgg----	Protospacer
************ ********    **.***

234. spacer 3.5|926839|27|CP025597|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
gatggccggtaggctgttgaacggcgc	Protospacer
.. *******.******* *******

235. spacer 3.5|926839|27|CP025597|CRT matches to NC_023606 (Mycobacterium phage CRB1, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

236. spacer 3.5|926839|27|CP025597|CRT matches to MK524491 (Mycobacterium phage Whabigail7, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

237. spacer 3.5|926839|27|CP025597|CRT matches to KX619650 (Mycobacterium phage Jerm, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

238. spacer 3.5|926839|27|CP025597|CRT matches to MN585998 (Mycobacterium phage Bugsy, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

239. spacer 3.5|926839|27|CP025597|CRT matches to JN408460 (Mycobacterium phage Turbido, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

240. spacer 3.5|926839|27|CP025597|CRT matches to MH077576 (Mycobacterium phage AbbyPaige, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

241. spacer 3.5|926839|27|CP025597|CRT matches to MH825704 (Mycobacterium phage LilTurb, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

242. spacer 3.10|927049|27|CP025597|CRT matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 6, identity: 0.778

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggatcctgcggcggcggtagaaagcc	Protospacer
******* ************* .   *

243. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gagcgtcggcctgctggtcggcttcggcgc	Protospacer
 ..**.*****************.*****

244. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gagcgtcggcctgctggtcggcttcggcgc	Protospacer
 ..**.*****************.*****

245. spacer 3.13|927190|30|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgacggcctggtggtcggctacctcga	Protospacer
***** ******* ********* *  **.

246. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

247. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

248. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgcgcggcgtgccggtcggctccggcgg	Protospacer
**    **** ***.***************

249. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

250. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgcgcggcgtgccggtcggctccggcgg	Protospacer
**    **** ***.***************

251. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcggcgggcctgctggtcggcttcggcac	Protospacer
**  ** ****************.****.

252. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

253. spacer 3.13|927190|30|CP025597|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

254. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

255. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP037868 (Hydrogenophaga pseudoflava strain DSM 1084 plasmid pDSM1084, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcg----gctccggcgg	CRISPR spacer
cgacgccggccggctggtcggagagctgcg----	Protospacer
*********** ********    *** **

256. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

257. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

258. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtcgccggcctgctgatcggcttcttctg	Protospacer
** *************.******.*  * *

259. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

260. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

261. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

262. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

263. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

264. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

265. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

266. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

267. spacer 3.13|927190|30|CP025597|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtcatcggcctgctggtcgtcgccggcgc	Protospacer
** *..************** * ******

268. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgccgacctgctggtcggggcggactg	Protospacer
********.************  * *.* *

269. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP017941 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
caagctggtcggccccggcggcgctggcaa	Protospacer
*  **** *****.**************..

270. spacer 3.15|927286|30|CP025597|CRT matches to MK937608 (Microbacterium phage Cressida, complete genome) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tcacctgtccggctccggcggcggtggcga	Protospacer
.*  ****.************** *****.

271. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

272. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

273. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP017592 (Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg--	CRISPR spacer
tctgctgttcggctgcggcggcg--agcagcg	Protospacer
.************* ********  .**.*

274. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP008898 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-576, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

275. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP023489 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

276. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP043515 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

277. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

278. spacer 3.15|927286|30|CP025597|CRT matches to NZ_LT984809 (Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
catcgcgctcggcttcggcggcgctggcgg	Protospacer
* *  .*.******.***************

279. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP026371 (Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

280. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP050069 (Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

281. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP039425 (Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgttcggcaccgacggcgccctccg	Protospacer
************* ***.******.  * *

282. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP009856 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-784, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

283. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP039430 (Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgttcggcaccgacggcgccctccg	Protospacer
************* ***.******.  * *

284. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgt-tcggctccggcggcgctggcgg	CRISPR spacer
-ccgccgcgccggctccggccgcgctggcgg	Protospacer
 *.**.*. .********** **********

285. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgtccagctcggcgccggcggcgctggcgt	Protospacer
* * * *.***** ***************

286. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgtccagctcggcgccggcggcgctggcgt	Protospacer
* * * *.***** ***************

287. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP006588 (Hymenobacter sp. APR13 plasmid pHA, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgt-tcggctccggcggcgctggcgg	CRISPR spacer
-ccgccgcgccggctccggccgcgctggcgg	Protospacer
 *.**.*. .********** **********

288. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgtt--cggctccggcggcgctggcgg	CRISPR spacer
--cgccgctggcggcgccggcggcgctggcgg	Protospacer
  .**.*.*  **** ****************

289. spacer 3.15|927286|30|CP025597|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgtt----cggctccggcggcgctggcgg	CRISPR spacer
----cagttggggcggctccggcggcgcgggcgg	Protospacer
    * ***    *************** *****

290. spacer 3.15|927286|30|CP025597|CRT matches to MH029534 (Myoviridae environmental samples clone NHS-Seq2, complete sequence) position: , mismatch: 6, identity: 0.8

-cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
atttggt-ttcggcgctggcggcgctggcgg	Protospacer
 ..** * ****** *.**************

291. spacer 3.17|927376|36|CP025597|CRT matches to MT723940 (Mycobacterium phage Ellie, complete genome) position: , mismatch: 6, identity: 0.833

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
cgttgtcggcaacggcggtaacggcgggggtggcgg	Protospacer
  * .************************ .*****

292. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
ggccggcggcaagggcggcgacggcggcgccggc--	Protospacer
************ ******* *****  * .***

293. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgggt--ggcta	CRISPR spacer
caccggcggcaacggcggcggcggcggcttcggc--	Protospacer
 .****************** ****** *  ***

294. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
caccggcggcagcggcggcgccggcggcacggct-	Protospacer
 .*********.*************** ..****

295. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
cggcggcggcaacggcggcgctggt-ggtggcaac	Protospacer
 * ******************.**. ****** *

296. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccgggggtggcaccgttgccgcgg	Protospacer
* *********** **.********

297. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccgggggtggcaccgttgccgcgg	Protospacer
* *********** **.********

298. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccggcggtgccatcggtgccgagg	Protospacer
* ****** ********** *****.

299. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 6, identity: 0.806

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ccttgcgccttgcccgccgctgccgcagggc	Protospacer
  *****************.****** **

300. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 6, identity: 0.806

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ccttgcgccttgcccgccgctgccgcagggc	Protospacer
  *****************.****** **

301. spacer 6.13|1573036|34|CP025597|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.824

--gtcgccgtgcagccagccaccaccgccaccggcg	CRISPR spacer
ctgtcgtc--gcagcgcgccaccaccgccaccggca	Protospacer
  ****.*  *****  ******************.

302. spacer 11.7|3741130|31|CP025597|CRT matches to NC_009478 (Clavibacter michiganensis subsp. michiganensis NCPPB 382 plasmid pCM1, complete sequence) position: , mismatch: 6, identity: 0.806

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgaccacttcaccgccgtcgccgccggcg	Protospacer
. ** ***************.******* *.

303. spacer 1.4|366689|27|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.741

aagccgcccgagttcgcgagaccgaag	CRISPR spacer
tgaccgcccgagttcgcgagacgttgg	Protospacer
 ..*******************   .*

304. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

305. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

306. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

307. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

308. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

309. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

310. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

311. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

312. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

313. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

314. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

315. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

316. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

317. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

318. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to NC_031243 (Mycobacterium phage Xeno, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

319. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

320. spacer 3.13|927190|30|CP025597|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggtcgccggcctgctggtcgggttcggatc	Protospacer
 * ****************** *.***

321. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

322. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

323. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ctgctgcagcctgctggtcagctccggcgc	Protospacer
* .*  *.***********.*********

324. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

325. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

326. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ctgctgcagcctgctggtcagctccggcgc	Protospacer
* .*  *.***********.*********

327. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

328. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

329. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

330. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

331. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

332. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

333. spacer 3.13|927190|30|CP025597|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgggaccggcccgctggtcggccccggctt	Protospacer
**. .******.**********.*****

334. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gctgggcggcctgctggtcggctggggcgg	Protospacer
    * *****************  *****

335. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

336. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

337. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

338. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

339. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

340. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

341. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgcaggtcggcttcacctt	Protospacer
 ************* ********.*. *

342. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

343. spacer 3.13|927190|30|CP025597|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

344. spacer 3.13|927190|30|CP025597|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

345. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

346. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

347. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

348. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

349. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

350. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

351. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

352. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

353. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

354. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

355. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

356. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

357. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

358. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

359. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

360. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

361. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

362. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

363. spacer 3.13|927190|30|CP025597|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

364. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

365. spacer 3.13|927190|30|CP025597|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

366. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

367. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

368. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

369. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

370. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

371. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

372. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

373. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

374. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

375. spacer 3.13|927190|30|CP025597|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

376. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

377. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

378. spacer 3.13|927190|30|CP025597|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

379. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

380. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

381. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

382. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

383. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

384. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

385. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

386. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

387. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

388. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

389. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

390. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

391. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

392. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

393. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

394. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

395. spacer 3.13|927190|30|CP025597|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

396. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

397. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

398. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

399. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

400. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

401. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

402. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

403. spacer 3.13|927190|30|CP025597|CRT matches to HM560026 (Uncultured bacterium plasmid pTRACA45, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
acacgccgccctgctggtcggcttaggtcg	Protospacer
  ****** **************. **. *

404. spacer 3.13|927190|30|CP025597|CRT matches to NC_010867 (Neisseria lactamica plasmid pNL3.1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gaacgccgccctgctggtcggcttagtcgc	Protospacer
 .****** **************. * **

405. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
agacgccggcctgctgttcggcctcgaccc	Protospacer
 *************** *****..**.*

406. spacer 3.13|927190|30|CP025597|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgggctcggcctgctgctcggcttcggcga	Protospacer
**.  .********** ******.*****.

407. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggc-tccggcgg	CRISPR spacer
gtcggccggcctgctggtcggcgcccggct-	Protospacer
    ****************** .*****

408. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgacggcctgctggtcgacttcatccc	Protospacer
***** **************.**.*. *

409. spacer 3.13|927190|30|CP025597|CRT matches to KT997827 (Uncultured Mediterranean phage uvDeep-CGR0-KM15-C219, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcgccggcctgctggaccgctccgtggg	Protospacer
   ************** * ******  **

410. spacer 3.13|927190|30|CP025597|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtgtccggcctgctggtcgggttcggcac	Protospacer
**   **************** *.****.

411. spacer 3.13|927190|30|CP025597|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
tgacgccgccctgctggtcggcaaagtcga	Protospacer
.******* *************   * **.

412. spacer 3.13|927190|30|CP025597|CRT matches to KT997829 (Uncultured Mediterranean phage uvDeep-CGR0-KM22-C158, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcgccggcctgctggaccgctccgtggg	Protospacer
   ************** * ******  **

413. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttcggggtcggctccggcggcgctggcga	Protospacer
..*   * *********************.

414. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttcggggtcggctccggcggcgctggcga	Protospacer
..*   * *********************.

415. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctccgcgctcggctccggcggcggtggcgg	Protospacer
*..  .*.*************** ******

416. spacer 3.15|927286|30|CP025597|CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

417. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

418. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

419. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

420. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

421. spacer 3.15|927286|30|CP025597|CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

422. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

423. spacer 3.15|927286|30|CP025597|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

424. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

425. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

426. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

427. spacer 3.15|927286|30|CP025597|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg-	CRISPR spacer
actgctgtccggctccggcggca-tgatgtc	Protospacer
 *******.*************. **..*

428. spacer 3.15|927286|30|CP025597|CRT matches to MN582086 (Siphoviridae sp. ctdEk19, complete genome) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gccggccttcgacttcggcggcgctggcgg	Protospacer
 *.* . ****.**.***************

429. spacer 3.15|927286|30|CP025597|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

430. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP022700 (Acetobacter tropicalis strain BDGP1 plasmid pAtBDGP1A, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gttcctccacggttccggcggcgctggcgg	Protospacer
 .* ** . ***.*****************

431. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

432. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

433. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

434. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

435. spacer 3.17|927376|36|CP025597|CRT matches to NC_022087 (Mycobacterium phage AnnaL29, complete genome) position: , mismatch: 7, identity: 0.806

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
cgtgatcggcaacggcggaaacggcgggagctgggg	Protospacer
  **************** *********. * * **

436. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
ggccggaggcaccggcggcgccggcggcacgggc-	Protospacer
****** **** *************** ..** .

437. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg--tggcta	CRISPR spacer
gaccggcggcagcggcggcgcgggcggagccggc--	Protospacer
*.*********.********* *****.  .***

438. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
cgcaggcggcaacggcggccccggcggcgccgcc-	Protospacer
 ** *************** ******* *. **.

439. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta----	CRISPR spacer
ggccgggggcaacggcggcgacggc----gtctacgac	Protospacer
****** ************* ****    * ***

440. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
tgccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 ******************. ******  *..**

441. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
tgccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 ******************. ******  *..**

442. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg--tggcta	CRISPR spacer
tgtcggcggcagcggcggcggcggcggggccggc--	Protospacer
 *.********.******** *******  .***

443. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggt--ggcta	CRISPR spacer
ggccggcggcatcggcgacgccggctgcttcagc--	Protospacer
*********** *****.******* * *  .**

444. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
caccggcggccacggcggcaccggc-ggcggcgat	Protospacer
 .******** ********.***** **.*** *

445. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP039641 (Azospirillum sp. TSH100 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
agacggcggcaccggcggcggcggcggtgaggcc-	Protospacer
.* ******** ******** ****** * ***.

446. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH697583 (Mycobacterium phage EricMillard, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

447. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH727551 (Mycobacterium phage Kalah2, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

448. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH077579 (Mycobacterium phage Halley, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

449. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH669017 (Mycobacterium phage Zelink, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

450. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN062701 (Mycobacterium phage Dallas, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

451. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK524527 (Mycobacterium phage ThreeRngTarjay, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

452. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK524529 (Mycobacterium phage Phoebus, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

453. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MF919512 (Mycobacterium phage Klein, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

454. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KF114875 (Mycobacterium phage Redno2, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

455. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

456. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
agacggtggcagcggcggcgccggcggcggtgct-	Protospacer
.* ***.****.*************** *  ***

457. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg-tggcta	CRISPR spacer
ggtcggcgccaacggcggcgccggtgaactgggt-	Protospacer
**.***** ***************.*.. *** *

458. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggc--gggtggcta	CRISPR spacer
cgctggcggcaacgtcggcgccggccatggcggc--	Protospacer
 **.********** **********   **.***

459. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
tggcggcggcaacggcggcggtggc-ggtggcggt	Protospacer
 * ***************** .*** ****** .

460. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggc--gggtggcta	CRISPR spacer
cgctggcggcaacgtcggcgccggccatggcggc--	Protospacer
 **.********** **********   **.***

461. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
tgctggcggcaacggcggcgtcggcatcgctggc--	Protospacer
 **.****************.****.  * ****

462. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
cgacggcggcaacggcggcggtggc-ggtggtcac	Protospacer
 * ***************** .*** *****..*

463. spacer 5.9|1212412|37|CP025597|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 7, identity: 0.811

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
tgtcggcggtgccggcggtgccggcggtgccggcgac	Protospacer
******************..*******  . ***.**

464. spacer 6.1|1572172|28|CP025597|CRISPRCasFinder matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 7, identity: 0.75

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
agcacccggggtgccgtcgttgccggcg	Protospacer
. ..** ********.***********

465. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 7, identity: 0.774

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gttgccgccatgcccgccgctgccgccggcc	Protospacer
. *  **** *********.**********

466. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to CP017041 (Propionibacterium sp. oral taxon 193 strain F0672 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
aacggcgtcttgcccgccgtggccgccaccg	Protospacer
**. ***.************ ******. *.

467. spacer 7.3|2088375|30|CP025597|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

468. spacer 7.3|2088375|30|CP025597|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

469. spacer 7.3|2088375|30|CP025597|CRT matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

470. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cccacccacttcaccgacgtcgccgccgacg	Protospacer
  *.************ ***.******* *.

471. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cccacccacttcaccgacgtcgccgccgacg	Protospacer
  *.************ ***.******* *.

472. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP042263 (Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
atccgccatttcaccgccgttgccgacgccg	Protospacer
* *  ***.**************** **.*.

473. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttggtgtcgatctcgatctggccgttgcccgca	Protospacer
  * **.*****.**************** *..

474. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agctggttgatgccgatctggccgctgccggtc	Protospacer
** . *..*** ************.*******

475. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
atgctgccgaccccgatctggtcgttttcgact	Protospacer
* ********.**********.**** .**..

476. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtcgaccttc	Protospacer
 ***************** ** ***.* *  *

477. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agctggttgatgccgatctggccgctgccggtc	Protospacer
** . *..*** ************.*******

478. spacer 3.13|927190|30|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgccggcctgctggtcgggctgacctc	Protospacer
********************* .. . *

479. spacer 3.13|927190|30|CP025597|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccgcaaactcctgctggtcggcgccggcgg	Protospacer
* .*.    ************* *******

480. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

481. spacer 3.13|927190|30|CP025597|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccgcaaactcctgctggtcggcgccggcgg	Protospacer
* .*.    ************* *******

482. spacer 3.13|927190|30|CP025597|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccttcagggcgtgctggtcggctccggcgc	Protospacer
*  .   *** ******************

483. spacer 3.13|927190|30|CP025597|CRT matches to NZ_KY126370 (Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

484. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggccgccggcctgctgtgcggctccgcgct	Protospacer
 * *************  ********

485. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

486. spacer 3.13|927190|30|CP025597|CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcaccgccctgctgatcggctccggcat	Protospacer
   *.*** *******.***********.

487. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

488. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

489. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP032156 (Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
aatcgccggcctgctggtcggtgccgcggt	Protospacer
 . ******************. ***  *

490. spacer 3.13|927190|30|CP025597|CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggtgatcggcctgctggtcgtcgccggcgc	Protospacer
 *  ..************** * ******

491. spacer 3.13|927190|30|CP025597|CRT matches to NZ_KP873172 (Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

492. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

493. spacer 3.13|927190|30|CP025597|CRT matches to NC_021492 (Enterobacter sp. R4-368 plasmid pENT01, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

494. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

495. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP024682 (Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

496. spacer 3.13|927190|30|CP025597|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

497. spacer 3.15|927286|30|CP025597|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgaccatctcggctccgacggcgctggcgc	Protospacer
*   *  .*********.***********

498. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

499. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gccaccccgcggctccggaggcgctggcgg	Protospacer
 *..*. . ********* ***********

500. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

501. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

502. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

503. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

504. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

505. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

506. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

507. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

508. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

509. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

510. spacer 3.15|927286|30|CP025597|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

511. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgatcggctccggcgccggcttctc	Protospacer
******* ************ ** .  *

512. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgtgcggctccggcggcaaccccga	Protospacer
 ******* *************. .  **.

513. spacer 3.15|927286|30|CP025597|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgatgttcgactccggcggcgacgcacc	Protospacer
**** ******.*********** .*

514. spacer 3.15|927286|30|CP025597|CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gcaccgcgccggctccggcggcggtggcgg	Protospacer
 *  *   .************** ******

515. spacer 3.17|927376|36|CP025597|CRT matches to MG770216 (Mycobacterium phage Rem711, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
attcggcggcaacggcggcaacggcgcggccggcgc	Protospacer
..* . ************.******* ********

516. spacer 3.17|927376|36|CP025597|CRT matches to KY087993 (Mycobacterium phage Hammy, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtgcagc	Protospacer
** ******** *************** * .*  *

517. spacer 3.17|927376|36|CP025597|CRT matches to MF140406 (Mycobacterium phage DarthP, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtgcagc	Protospacer
** ******** *************** * .*  *

518. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caacggcggcaacggcggcgacggcggtcgcggt--	Protospacer
 . ***************** ******  *.**.

519. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ccccggcggcaacggcggcaacggcggcaatgcc--	Protospacer
  *****************. ******  .** *

520. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
cgccggcggcagcgccggcgccggcagtatcggc--	Protospacer
 **********.** **********.*   .***

521. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
tgtcggcggtaacggcggcgtcggcgg--agccagc	Protospacer
 *.******.**********.******  .**.*

522. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

523. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_047958 (Burkholderia phage vB_BmuP_KL4, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggccgcaacgacggcgccggcggccggtgc	Protospacer
 ****** ******.************ .**.

524. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

525. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

526. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcgggaagggcggcgccggcggcggtctg	Protospacer
  ******* ** **************  * **.

527. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

528. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

529. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgccggcggaaacggtggcgccggcggcacggtg	Protospacer
 ******** *****.***********   * *.

530. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
taccggcggcaatggaggcgccggcggcatcgcc-	Protospacer
 .**********.** *********** .* **.

531. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

532. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

533. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN234223 (Mycobacterium phage Philly, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

534. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KJ194581 (Mycobacterium phage Audrey, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

535. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH051265 (Mycobacterium phage Yahalom, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

536. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH316565 (Mycobacterium phage Mortcellus, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

537. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT310871 (Mycobacterium phage Jackstina, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

538. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to EU816589 (Mycobacterium phage Phaedrus, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

539. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT952851 (Mycobacterium phage Gervas, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

540. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MG920059 (Mycobacterium phage Baloo, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

541. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_023686 (Mycobacterium phage Gadjet, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

542. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_041965 (Mycobacterium phage Athena, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

543. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to DQ398049 (Mycobacterium phage Pipefish, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

544. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT310892 (Mycobacterium phage Compostia, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

545. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN699018 (Mycobacterium phage Kamiyu, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

546. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg----gtggcta	CRISPR spacer
cggcggcggcaccggcggcaccggcggtgccgtg----	Protospacer
 * ******** *******.*******    ***

547. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ggccggcggcaacgggagcgccggc--ctcgccgcc	Protospacer
*************** .********   * **..

548. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcg-gcaacggcggcgccggcgggtggcta	CRISPR spacer
-ccgagcgcgccacggcggctccggcgggtggccc	Protospacer
  * .*** ** ******** ************.

549. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

550. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

551. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

552. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

553. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

554. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

555. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

556. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

557. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

558. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

559. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

560. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

561. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

562. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

563. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

564. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

565. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

566. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN698995 (Mycobacterium phage Dori, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggccctggcggctcggtg	Protospacer
 .***************** *.***** * * *.

567. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

568. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

569. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN234184 (Mycobacterium phage IdentityCrisis, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caccggcggcagcggcggcgcaggcggaaacggc--	Protospacer
 .*********.********* *****  ..***

570. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

571. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

572. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
tctcggcggcgacggcggcgacggcggtgttgat-	Protospacer
  .*******.********* ****** ** * *

573. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcaacggcggccgcggctgccagcca	Protospacer
.******************  **** * ..**.*

574. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
gcgcggcggcaccggcggcaccggc-ggcggtcat	Protospacer
*  ******** *******.***** **.**..*

575. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN234183 (Mycobacterium phage Antsirabe, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgtcggcggcagcggcggcggcggcggacgtcca	Protospacer
 *.********.******** ******..* *.*

576. spacer 5.9|1212412|37|CP025597|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.784

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
agtcggcggcggcggcggcaccggcgggaccggcggc	Protospacer
 ********.* **************** . ***..*

577. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcgggcgccttgtccgccgctgccgccgggc	Protospacer
.   ********.******.*********

578. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP039899 (Agrobacterium tumefaciens strain CFBP5877 plasmid pAtCFBP5877a, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

579. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP039913 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

580. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP039890 (Agrobacterium tumefaciens strain CFBP5499 plasmid pAtCFBP5499a, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

581. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

582. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

583. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

584. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcgagcgccttgcccgccgtggtcgccgccc	Protospacer
.   **************** *.***** *

585. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to CP036360 (Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

586. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP021914 (Sagittula sp. P11 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgc--gccttgcccgccgttgccgccggca	CRISPR spacer
--ccgctggccttgcccggggttgccgccgggg	Protospacer
  ..**  **********  *********** .

587. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
attgccgccctggccgccgttgccgccgatc	Protospacer
* *  ****.** ***************..

588. spacer 7.3|2088375|30|CP025597|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 8, identity: 0.733

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ccgcgagcagccgtcggtttgcgcgctgtc	Protospacer
.** ... **************.******.

589. spacer 7.3|2088375|30|CP025597|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 8, identity: 0.733

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ccgcgagcagccgtcggtttgcgcgctgtc	Protospacer
.** ... **************.******.

590. spacer 10.24|3122381|29|CP025597|PILER-CR matches to MK599315 (Pseudomonas phage PA1C, complete genome) position: , mismatch: 8, identity: 0.724

tccgcgaaattcactgcgcgttattcaag	CRISPR spacer
gacgcgaaatacactgcgctttattttca	Protospacer
  ******** ******** *****.  .

591. spacer 11.7|3741130|31|CP025597|CRT matches to CP033373 (Lactobacillus fermentum strain DR9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
ttagcccacttcacggccgttgccgacgcgg	Protospacer
   *********** ********** **. .

592. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

593. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

594. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

595. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

596. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

597. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

598. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

599. spacer 11.7|3741130|31|CP025597|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

600. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

601. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cgcaactccttcaccgccgctgccgccgtct	Protospacer
 .*. *. ***********.**********

602. spacer 11.7|3741130|31|CP025597|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

603. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

604. spacer 11.7|3741130|31|CP025597|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

605. spacer 11.7|3741130|31|CP025597|CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
ctcggtggcttcgccgccgtcgccgccgtca	Protospacer
  ** . .****.*******.**********

606. spacer 11.7|3741130|31|CP025597|CRT matches to NC_014213 (Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
atcgcccacttcaccggcgtttccgaccctt	Protospacer
* ************** **** *** * ..

607. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtattcgatcccgatctggccgtcgccggcc	Protospacer
  *.  .******************.*****.

608. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

609. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

610. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

611. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to NZ_CP014964 (Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
ggaacgaacggcaagccgaaatgttggtgga	Protospacer
.* .**************** .*****

612. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
taagcgaacggtaagccgaaccgctgaggcg	Protospacer
 . ********.***********.**.. *

613. spacer 2.1|692022|31|CP025597|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
taagcgaacggtaagccgaaccgctgaggcg	Protospacer
 . ********.***********.**.. *

614. spacer 3.13|927190|30|CP025597|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.7

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggcgccggcctgctggtcggactgctcac	Protospacer
**.****************** ..   *.

615. spacer 3.15|927286|30|CP025597|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.7

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gaccacgttcggctccggccgcgctcgcgt	Protospacer
  .  .************* ***** ***

616. spacer 3.15|927286|30|CP025597|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.7

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gaccacgttcggctccggccgcgctcgcgt	Protospacer
  .  .************* ***** ***

617. spacer 3.17|927376|36|CP025597|CRT matches to MF140398 (Mycobacterium phage Amohnition, complete genome) position: , mismatch: 9, identity: 0.75

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtacggc	Protospacer
** ******** *************** * ..  *

618. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcaacggc--	Protospacer
 . ****************. ******  ..***

619. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
cagcggcggcaacggcggccgcggcggcgacggc--	Protospacer
 . ****************  *****  *..***

620. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgccggcggcaactgcggcgccggcgcccaccgc	Protospacer
 ************ ************  .. *

621. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
cagcggcagcaatggcggcgccggcggcgccggc--	Protospacer
 . ****.****.*************  * .***

622. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cggcggcgggaccggcggcgccggcggcagtatc	Protospacer
 * ****** * ***************  *  *

623. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to EF602154 (Burkholderia phage BcepNY3, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

624. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AY369265 (Burkholderia cenocepacia phage Bcep1, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

625. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_005263 (Burkholderia phage Bcep1, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

626. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcggcattttc	Protospacer
.**********  **************    .*

627. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcggcattttc	Protospacer
.**********  **************    .*

628. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgtcggcggccacggcggcgtcggcggtcaggaa	Protospacer
 *.******* *********.****** ..*  *

629. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP053906 (Hymenobacter sp. BRD67 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaccggcggcggcggcgggggcacc	Protospacer
 .********* ******** ******* *  .

630. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KC170279 (Uncultured bacterium plasmid pMBUI8, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggcgccggcgtctaccag	Protospacer
  ********** *************  *. * .

631. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

632. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gaccggcggcaccggcggcgccgccggccatcat	Protospacer
*.********* *********** *** .. *

633. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

634. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

635. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

636. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

637. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cggcggcggcaatggcggcaccggcggcacggtc	Protospacer
 * *********.******.*******   * *

638. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

639. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

640. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcggcagcggtggtgga	Protospacer
  ****************** *.****  *   *

641. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

642. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

643. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

644. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

645. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

646. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

647. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

648. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

649. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

650. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

651. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

652. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

653. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

654. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

655. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

656. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

657. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gaccggcggcaacggcggcggcggtggctcctcg	Protospacer
*.****************** ***.** *  ...

658. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

659. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

660. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

661. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

662. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KX443399 (Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

663. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KX443400 (Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

664. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KX443398 (Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

665. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to CP054922 (Streptomyces sp. NA03103 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggcggccccggcggcgccggccagctgcac	Protospacer
 *********  ************* .*. **

666. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KP851975 (Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

667. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
ctgcggcggcgacggcggcaccggcggaggcagc--	Protospacer
   *******.********.******  **..**

668. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gttcggcggcgagggcggcgccggcggcaagcgt	Protospacer
* .*******.* **************  .**

669. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KF439868 (Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

670. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacggcggcaacggcggccgcggcggctccgtg	Protospacer
 * ****************  ****** *   *.

671. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

672. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgcggcggcgccggcggcgccggcggcgaggga	Protospacer
*  *******. ***************  .*  *

673. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

674. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

675. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
caccggcggcaacggcggcaccgccgacaacggc--	Protospacer
 .*****************.*** **  ...***

676. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

677. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

678. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

679. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

680. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013512 (Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

681. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

682. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

683. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcggcagc--	Protospacer
 . ****************. *****  **..**

684. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

685. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gagcggcggcaacggcggcaacggcggcttcccc	Protospacer
*. ****************. ****** *  *.

686. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP041653 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacggccgcaacggcggctccggcggcgggaac	Protospacer
 * **** *********** *******  **

687. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

688. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

689. spacer 5.9|1212412|37|CP025597|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.757

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
ggtgggcggtgccggcggcagcggcggcatggccttc	Protospacer
 ** **************** ******  *.* *  *

690. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcctcgccctgcccgccgttgccgcccacg	Protospacer
.... ****.***************** .*.

691. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
tggcccgccttgccctccattgccgccggac	Protospacer
 . . ********** **.**********

692. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
atccttgccttgaccgccgttgccgccgctg	Protospacer
* .. .****** *************** ..

693. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
accccagccctgcccgccgttgccgccgctc	Protospacer
* ..  ***.****************** .

694. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcttgcgcctggcccgccgtagccggacacc	Protospacer
. ******** ********* ****   .*

695. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
accggcaccttgcccgccattgccgccatgt	Protospacer
* . **.***********.********.

696. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP013740 (Streptomyces globisporus C-1027 plasmid pSGL1, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
cgggccgccttgtccgccgtggccgccgacc	Protospacer
 .   *******.******* *******.*

697. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
agcgtggccttggccgccgttgccggcggtc	Protospacer
*..   ****** ************ ***.

698. spacer 11.5|3740989|34|CP025597|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.735

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
attgagatccgcgacgatgggtgtggcgccggcg	Protospacer
.**    .********.**** ***********.

699. spacer 11.5|3740989|34|CP025597|CRT matches to MG812496 (Gordonia phage SallySpecial, complete genome) position: , mismatch: 9, identity: 0.735

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gcgcaccaccgcggcggtgcgggtggcgccggcg	Protospacer
*. . *. *****.***** *************.

700. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtactcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

701. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtactcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

702. spacer 1.6|366824|33|CP025597|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtattcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

703. spacer 3.2|926686|39|CP025597|CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.744

cggcgcgggcggggccgtcacgggaaccggcgccaccgg	CRISPR spacer
cacgggggccggggccgccacgggaaccggcgccccgcc	Protospacer
*.  * ** ********.**************** *

704. spacer 3.17|927376|36|CP025597|CRT matches to MN369764 (Mycobacterium phage Rahalelujah, complete genome) position: , mismatch: 10, identity: 0.722

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
atctggaggcaacggcggtaacggcggggccagcac	Protospacer
... .  ************************.**.

705. spacer 3.17|927376|36|CP025597|CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gaccggcggcaacggcggaaacggcggcgccgcagc	Protospacer
* . . ************ ******** ****  *

706. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcg-----ggtggcta	CRISPR spacer
ccgcggcggcgacggcggcgcgggcggcaccggt-----	Protospacer
   *******.********** ****     ***

707. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gagcggcggcaacggcggtaccggcggtgacgtc	Protospacer
*. ***************..*******  .  *

708. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acccggcggcaccggcggcgcgggcggtccggcc	Protospacer
. ********* ********* ***** . * .

709. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to CP000620 (Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggcggcatcggcgccgccggcgcggcatcg	Protospacer
 ********** ***** ******** *  ....

710. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP020810 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaccggaggcgccggcggaggcacc	Protospacer
  ********* *** ***********. *  .

711. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
atccggcggcgccggcggcgccggcggcggaact	Protospacer
. ********. ***************  *. .

712. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

713. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaccggcggcaccggcggcaccgga	Protospacer
 .********* *******.*******      *

714. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

715. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

716. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

717. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AP018709 (Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

718. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta-------	CRISPR spacer
ggccgacggcaagggcggcgcc-------ggttacgcctcc	Protospacer
*****.****** *********       **.**

719. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcatcggcggcgcgggcgaggcccag	Protospacer
  ********* ********* ****.*   * .

720. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_008766 (Acidovorax sp. JS42 plasmid pAOVO02, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

721. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgacggcggcaacagcggcaccggcggagcgaag	Protospacer
 * **********.*****.*******.  *  .

722. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

723. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

724. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcatcggcggcgcgggcgaggcccag	Protospacer
  ********* ********* ****.*   * .

725. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

726. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_024998 (Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

727. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_008385 (Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

728. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP018471 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

729. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

730. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_MN366359 (Bacterium plasmid pALTS31, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

731. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcaacaacggcggcgccggcgccttcttc	Protospacer
 .*****..*****************  *  .*

732. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_001735 (Enterobacter aerogenes plasmid R751, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

733. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AGRM01000006 (Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

734. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AJ863570 (Uncultured bacterium IncP-1beta multiresistance plasmid pB8) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

735. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

736. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgtctgggccacggcggcgctggcgggtgggtg	Protospacer
*  .   *** **********.********* *.

737. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgtctgggccacggcggcgctggcgggtgggtg	Protospacer
*  .   *** **********.********* *.

738. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_021492 (Enterobacter sp. R4-368 plasmid pENT01, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

739. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JX469828 (Uncultured bacterium plasmid pRSB223, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tcccggcggcaagggcggtgccggcgtctatcag	Protospacer
  ********** *****.*******  *. * .

740. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JX469829 (Uncultured bacterium plasmid pB1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tcccggcggcaagggcggtgccggcgtctatcag	Protospacer
  ********** *****.*******  *. * .

741. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

742. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

743. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

744. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

745. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

746. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

747. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

748. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

749. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

750. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN386974 (Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

751. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_001381 (Mycobacterium fortuitum plasmid pAL5000, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgcggcggcagcggcggcgctggcggcggcacg	Protospacer
*  ********.*********.*****  *  ..

752. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

753. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP021650 (Acidovorax sp. T1 plasmid p2-T1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

754. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to JX486125 (Uncultured bacterium plasmid pRWC72a, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

755. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP038640 (Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

756. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to AJ639924 (Uncultured bacterium plasmid pB3 complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

757. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KU356987 (Variovorax paradoxus plasmid pBS64, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

758. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to KU356988 (Variovorax paradoxus plasmid pHB44, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

759. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcgacggcggcgacggcgccccgcgc	Protospacer
  ********.********* *****  . **

760. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP009797 (Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

761. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

762. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_019320 (Variovorax sp. DB1 plasmid pDB1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

763. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP017455 (Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

764. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NC_007337 (Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

765. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_MN366358 (Bacterium plasmid pALTS29, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

766. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MN234219 (Mycobacterium phage Mercurio, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacgtcggcaccggcggcgccggcggcgcgaag	Protospacer
 * ** ***** ***************   *  .

767. spacer 5.9|1212412|37|CP025597|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 10, identity: 0.73

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
cctcgacggtgccggcggcatcggcgggcgctggacc	Protospacer
. ***.**************.*******.   * * *

768. spacer 5.9|1212412|37|CP025597|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 10, identity: 0.73

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
cctcgacggtgccggcggcatcggcgggcgctggacc	Protospacer
. ***.**************.*******.   * * *

769. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gggctcgcctcgcccgccgttcccgccgctc	Protospacer
.. . *****.********** ****** .

770. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ttcctcgccttccccgccgctgccgccgcgg	Protospacer
  .. ****** *******.********  .

771. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggccagaacttccccgctgttgccgccggca	Protospacer
..... . *** *****.*************

772. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gggctcgcctcgcccgccgttcccgccgctc	Protospacer
.. . *****.********** ****** .

773. spacer 6.10|1572787|31|CP025597|CRISPRCasFinder matches to NZ_AP014581 (Burkholderia sp. RPE67 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcgtggccttggccgccgttgccggcggtc	Protospacer
...   ****** ************ ***.

774. spacer 6.13|1573036|34|CP025597|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.706

gtcgccgtgcagccagccaccaccgccaccggcg	CRISPR spacer
ccgatgatgcagccggccaccaccgccaccagca	Protospacer
 . .. .*******.***************.**.

775. spacer 9.9|3119783|35|CP025597|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 10, identity: 0.714

acttgcgcgcacaacgcatccgccatccacggggc	CRISPR spacer
gtcaccgcgcacaacacattcgccatccacacggt	Protospacer
...  **********.***.**********. **.

776. spacer 10.20|3123254|34|CP025597|CRISPRCasFinder,CRT matches to NZ_AP022335 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence) position: , mismatch: 10, identity: 0.706

tagaaggcgatcactggaagcacggcgcttgcga	CRISPR spacer
ggcaaggcgatcagtggaagctcggcggcggcac	Protospacer
 . ********** ******* ***** . **.

777. spacer 10.36|3123258|34|CP025597|PILER-CR matches to NZ_AP022335 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence) position: , mismatch: 10, identity: 0.706

tagaaggcgatcactggaagcacggcgcttgcga	CRISPR spacer
ggcaaggcgatcagtggaagctcggcggcggcac	Protospacer
 . ********** ******* ***** . **.

778. spacer 11.5|3740989|34|CP025597|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
cagcgcggccgcgtcggtgggggtggcgcccgcc	Protospacer
   . *  ***** **************** **

779. spacer 11.5|3740989|34|CP025597|CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

780. spacer 11.5|3740989|34|CP025597|CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

781. spacer 11.5|3740989|34|CP025597|CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

782. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcacgtcg	Protospacer
 . ****************. ******   *...

783. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tttcggcggcagcggcggcggcggcggaaccccg	Protospacer
  .********.******** ******.   *..

784. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MH051334 (Escherichia phage vB_EcoS-Ro145c2YLVW, complete genome) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggcggctacggcggcggcggcggcaattgg	Protospacer
 .******** ********* ******  . . .

785. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to MG852086 (Escherichia phage vB_EcoS-Ro145clw, complete genome) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggcggctacggcggcggcggcggcaattgg	Protospacer
 .******** ********* ******  . . .

786. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggccacggcggggccggcggcgacgcg	Protospacer
 .******** ******* ********  .  ..

787. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tttcggcggcaagggcggcgccgccggcgatcag	Protospacer
  .********* ********** ***  . * .

788. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caggggcggcaacggcggccccggcaggacggcg	Protospacer
 .  *************** *****.**  * ..

789. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cataggcggcgatggcggcgccggcgggatggcg	Protospacer
 .. ******.*.***************  * ..

790. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccgacggcaagggcggcgccggatacgccccc	Protospacer
*****.****** ***********  .    *.

791. spacer 5.5|1212196|40|CP025597|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.725

tgccggcggcgccggcggtgtcggcggacccgccgggttg	CRISPR spacer
ggttggcggcaccggcggtgtcggcggagccggtgacatc	Protospacer
 *..******.***************** *** .*.  *

792. spacer 11.5|3740989|34|CP025597|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 11, identity: 0.676

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
cgcccccggcgtgacggtggaggtggcgccggcc	Protospacer
  ...*.  **.********.************

793. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 12, identity: 0.647

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
aaccggcggcgacggcgtcgccggcgccaattcg	Protospacer
..********.****** ********   . ...

794. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_CP026703 (Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 12, identity: 0.647

ggccggcggcaacggcggcgc-----cggcgggtggcta	CRISPR spacer
-gccggaaacgccggcgccgctgttgcggccggtg----	Protospacer
 ***** ..*. ***** ***     **** ****

795. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 14, identity: 0.588

-----ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acggcggccgccggcgccggcgtttccgccgaga-----	Protospacer
     ***** ****. ***** . *** **.*

796. spacer 5.3|1212091|34|CP025597|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 15, identity: 0.559

-----ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acggcggccgccggcgccgacgtttccgccgaga-----	Protospacer
     ***** ****. **.** . *** **.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

889044 : 947617

Burkholderia_virus(16.67%)

transposase,protease,bacteriocin,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUP67069.1\|889044_890305_+\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
AUP67070.1\|890360_891455_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUP67071.1\|891444_892242_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AUP67072.1\|892238_893246_-	peroxidase	NA	NA	NA	NA
AUP67073.1\|893290_894592_+	m18 family aminopeptidase	NA	NA	NA	NA
AUP67074.1\|894603_894951_+	VOC family protein	NA	NA	NA	NA
AUP67075.1\|894944_895601_-	N-acetyltransferase	NA	NA	NA	NA
AUP70038.1\|895792_898057_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.1e-274	64.3
AUP67076.1\|898053_898683_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AUP67077.1\|898803_899760_+	phosphodiesterase	NA	NA	NA	NA
AUP67078.1\|899704_901303_-	exopolysaccharide phosphotransferase CpsY	NA	NA	NA	NA
AUP67079.1\|901607_901997_+	hypothetical protein	NA	NA	NA	NA
AUP67080.1\|902083_903667_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	2.6e-45	30.6
AUP67081.1\|903697_904792_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.3e-56	37.3
AUP67082.1\|904877_905060_-	DUF3073 domain-containing protein	NA	NA	NA	NA
AUP67083.1\|905206_906313_-	folate-binding protein	NA	NA	NA	NA
AUP70039.1\|906395_907265_+	4-amino-4-deoxychorismate lyase	NA	NA	NA	NA
AUP67084.1\|907310_907991_-	FABP family protein	NA	NA	NA	NA
AUP67085.1\|908153_908456_-	DUF1416 domain-containing protein	NA	NA	NA	NA
AUP70040.1\|908457_909291_-	sulfurtransferase	NA	NA	NA	NA
AUP67086.1\|909583_910006_-	thioredoxin	NA	NA	NA	NA
AUP67087.1\|910002_910815_-	DUF2993 domain-containing protein	NA	NA	NA	NA
AUP70041.1\|910944_911712_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.1e-15	31.5
AUP67088.1\|911708_912656_+	mycothiol synthase	NA	NA	NA	NA
AUP67089.1\|912698_913475_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-16	35.1
AUP67090.1\|913530_914172_-	phosphate-specific transport system accessory protein PhoU	NA	NA	NA	NA
AUP67091.1\|914229_916284_-	LytR family transcriptional regulator	NA	NA	NA	NA
AUP67092.1\|916449_917619_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
AUP67093.1\|917706_918723_-	acyl-ACP desaturase	NA	NA	NA	NA
AUP67094.1\|918884_919526_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUP70042.1\|919606_920662_+	DUF2236 domain-containing protein	NA	NA	NA	NA
AUP67095.1\|920713_921106_-	transcriptional regulator	NA	NA	NA	NA
AUP67096.1\|921163_921586_-	nucleoside deaminase	NA	NA	NA	NA
AUP67097.1\|921547_921838_+\|transposase	transposase	NA	NA	NA	NA
AUP67098.1\|921942_922848_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AUP67099.1\|922866_923682_-	TIGR04255 family protein	NA	NA	NA	NA
AUP67100.1\|924923_925337_+	PE family protein	NA	NA	NA	NA
AUP67101.1\|925333_927583_+	PE family protein	NA	NA	NA	NA
AUP67102.1\|927601_927781_+	hypothetical protein	NA	NA	NA	NA
AUP67103.1\|927809_930458_-	PE family protein	NA	NA	NA	NA
AUP67104.1\|930925_931570_+	sensor domain-containing protein	NA	NA	NA	NA
AUP67105.1\|931550_932102_-	hypothetical protein	NA	NA	NA	NA
AUP70043.1\|932251_932905_-	hypothetical protein	NA	NA	NA	NA
AUP67106.1\|932975_934004_-	hypothetical protein	NA	NA	NA	NA
AUP67107.1\|934265_934454_-	hypothetical protein	NA	NA	NA	NA
AUP67108.1\|934692_935463_+	D-Ala-D-Ala dipeptidase VanX	NA	NA	NA	NA
AUP67109.1\|935549_936362_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AUP67110.1\|936429_937290_-	proline iminopeptidase	NA	NA	NA	NA
AUP67111.1\|937377_937641_+	hypothetical protein	NA	NA	NA	NA
AUP67112.1\|937565_937808_+	hypothetical protein	NA	NA	NA	NA
AUP70044.1\|938084_939377_+	hypothetical protein	NA	NA	NA	NA
AUP67113.1\|939360_940365_+	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
AUP67114.1\|940428_941079_-	DNA-binding response regulator	NA	NA	NA	NA
AUP67115.1\|941162_942440_+	sensor histidine kinase	NA	NA	NA	NA
AUP67116.1\|942652_944167_-	oxidase	NA	NA	NA	NA
AUP70045.1\|944315_944708_+	hypothetical protein	NA	NA	NA	NA
AUP70046.1\|944910_946029_+	cysteine synthase CysK	NA	NA	NA	NA
AUP67117.1\|946028_947288_+	MFS transporter	NA	NA	NA	NA
AUP70047.1\|947284_947617_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1125435 : 1177237

Klosneuvirus(20.0%)

transposase,protease,integrase,tRNA

attL 1133258:1133274|attR 1182317:1182333

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUP67267.1\|1125435_1126995_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.8e-100	39.2
AUP70069.1\|1127080_1127875_+	YchF/TatD family DNA exonuclease	NA	NA	NA	NA
AUP67268.1\|1128082_1129171_+	resuscitation-promoting factor RpfB	Q856D9	Mycobacterium_phage	8.2e-22	59.4
AUP67269.1\|1129143_1130097_+	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AUP70070.1\|1130182_1131103_+	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
AUP67270.1\|1131119_1131413_+	hypothetical protein	NA	NA	NA	NA
AUP70071.1\|1131372_1131672_-	hypothetical protein	NA	NA	NA	NA
AUP67271.1\|1131616_1133251_+	polyketide synthase	NA	NA	NA	NA
1133258:1133274	attL	NA	NA	NA	NA
AUP67272.1\|1133324_1133900_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
AUP67273.1\|1133912_1134560_-	50S ribosomal protein L25	NA	NA	NA	NA
AUP67274.1\|1134776_1135457_-	hypothetical protein	NA	NA	NA	NA
AUP67275.1\|1135492_1136473_-	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	1.8e-44	32.7
AUP67276.1\|1136564_1138052_-	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase	NA	NA	NA	NA
AUP70072.1\|1138306_1138900_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUP67277.1\|1138958_1142663_+	transcription-repair coupling factor	NA	NA	NA	NA
AUP70073.1\|1142662_1143640_+	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
AUP67278.1\|1143727_1144459_+	murein transglycosylase B	NA	NA	NA	NA
AUP67279.1\|1144555_1145845_+	enolase	W6LP63	Streptococcus_phage	2.1e-133	56.6
AUP67280.1\|1145849_1146536_+	septation inhibitor protein	NA	NA	NA	NA
AUP70074.1\|1146552_1147020_+	DUF501 domain-containing protein	NA	NA	NA	NA
AUP67281.1\|1147010_1147970_+	exopolyphosphatase	NA	NA	NA	NA
AUP67282.1\|1148209_1148422_+	hypothetical protein	NA	NA	NA	NA
AUP67283.1\|1148418_1149099_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.2e-24	30.6
AUP67284.1\|1149095_1151678_-	sensor protein KdpD	NA	NA	NA	NA
AUP67285.1\|1151768_1151915_+	potassium transporter Trk	NA	NA	NA	NA
AUP70075.1\|1151911_1152004_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
AUP67286.1\|1152003_1153719_+	potassium-transporting ATPase A chain	NA	NA	NA	NA
AUP67287.1\|1153715_1155845_+	potassium-transporting ATPase subunit B	M1HRW9	Paramecium_bursaria_Chlorella_virus	3.8e-23	26.2
AUP67288.1\|1155844_1156414_+	potassium-transporting ATPase subunit C	NA	NA	NA	NA
AUP67289.1\|1156417_1157947_-	sensor histidine kinase	NA	NA	NA	NA
AUP67290.1\|1157954_1158728_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.3e-34	36.3
AUP67291.1\|1160535_1160820_-	ESAT-6-like protein EsxI	NA	NA	NA	NA
AUP67292.1\|1160846_1161143_-	WXG100 family type VII secretion target	NA	NA	NA	NA
AUP67293.1\|1161288_1162464_-	PPE family protein	NA	NA	NA	NA
AUP67294.1\|1162540_1163368_-	PE family protein	NA	NA	NA	NA
AUP67295.1\|1163928_1164177_+	hypothetical protein	NA	NA	NA	NA
AUP67296.1\|1164155_1164395_-	hypothetical protein	NA	NA	NA	NA
AUP67297.1\|1164300_1164519_-	hypothetical protein	NA	NA	NA	NA
AUP70076.1\|1164563_1165046_-\|transposase	IS5 family transposase	A0A1V0SLQ8	Klosneuvirus	8.1e-06	28.7
AUP67298.1\|1165083_1165482_-\|transposase	IS5 family transposase	NA	NA	NA	NA
AUP70077.1\|1165773_1166799_-\|protease	serine protease	NA	NA	NA	NA
AUP67299.1\|1167045_1167669_+	hypothetical protein	NA	NA	NA	NA
AUP67300.1\|1168629_1169418_-	hypothetical protein	NA	NA	NA	NA
AUP67301.1\|1169417_1170665_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.1e-81	45.1
AUP67302.1\|1171032_1172148_-	hypothetical protein	NA	NA	NA	NA
AUP67303.1\|1172104_1172308_-	hypothetical protein	NA	NA	NA	NA
AUP67304.1\|1172380_1172827_+	MarR family transcriptional regulator	NA	NA	NA	NA
AUP70078.1\|1172875_1173781_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AUP67305.1\|1173939_1174695_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUP70079.1\|1174989_1175616_-	hypothetical protein	NA	NA	NA	NA
AUP67306.1\|1175682_1175865_+	hypothetical protein	NA	NA	NA	NA
AUP67307.1\|1176560_1176899_+\|integrase	integrase	NA	NA	NA	NA
AUP67308.1\|1176922_1177237_+\|integrase	integrase	Q854H9	Mycobacterium_phage	1.0e-09	53.6
1182317:1182333	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2941158 : 2976524

Tupanvirus(11.11%)

capsid,transposase,terminase,integrase,protease,tRNA,head

attL 2969959:2969986|attR 2980941:2980968

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUP68779.1\|2941158_2943237_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.5e-104	34.9
AUP68780.1\|2943345_2943573_+	hypothetical protein	NA	NA	NA	NA
AUP70265.1\|2943569_2944955_-	PE family protein	NA	NA	NA	NA
AUP68781.1\|2945299_2945800_+	DUF1990 domain-containing protein	NA	NA	NA	NA
AUP68782.1\|2945816_2946257_-	DoxX family membrane protein	NA	NA	NA	NA
AUP70266.1\|2946403_2947081_+	transcriptional regulator	NA	NA	NA	NA
AUP68783.1\|2947065_2947419_-	cupin domain-containing protein	NA	NA	NA	NA
AUP68784.1\|2947431_2947857_-	hypothetical protein	NA	NA	NA	NA
AUP68785.1\|2947853_2948528_-	transcriptional regulator	NA	NA	NA	NA
AUP68786.1\|2948605_2949427_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AUP68787.1\|2949562_2950456_+	universal stress protein	NA	NA	NA	NA
AUP70267.1\|2950458_2951277_-	universal stress protein	NA	NA	NA	NA
AUP68788.1\|2951291_2952473_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AUP68789.1\|2952531_2952963_-	hypoxic response protein 1	A0A2I6B2H4	Macacine_betaherpesvirus	1.9e-75	100.0
AUP68790.1\|2953476_2954718_-	alpha/beta hydrolase	NA	NA	NA	NA
AUP70268.1\|2955027_2955390_+	hypothetical protein	NA	NA	NA	NA
AUP68791.1\|2955736_2956861_+	hypothetical protein	NA	NA	NA	NA
AUP68792.1\|2956862_2957402_+	archease	NA	NA	NA	NA
AUP68793.1\|2957541_2958840_+	RNA-splicing ligase RtcB	A2RQD0	Archaeal_BJ1_virus	3.8e-90	43.3
AUP68794.1\|2958878_2959160_-	DUF1876 domain-containing protein	NA	NA	NA	NA
AUP68795.1\|2959304_2959790_-	hemerythrin domain-containing protein	NA	NA	NA	NA
AUP68796.1\|2959816_2960074_-	hypothetical protein	NA	NA	NA	NA
AUP68797.1\|2960074_2962411_-	PE family protein	NA	NA	NA	NA
AUP68798.1\|2962439_2962682_+	hypothetical protein	NA	NA	NA	NA
AUP68799.1\|2962682_2963360_+	hypothetical protein	NA	NA	NA	NA
AUP68800.1\|2963555_2964212_+	DedA family protein	NA	NA	NA	NA
AUP68801.1\|2964374_2964821_+	STAS domain-containing protein	NA	NA	NA	NA
AUP68802.1\|2964995_2965328_-	YnfA family protein	NA	NA	NA	NA
AUP68803.1\|2965447_2965807_-	transcriptional regulator	NA	NA	NA	NA
AUP68804.1\|2965908_2966367_+	cadmium-induced protein CadI	NA	NA	NA	NA
AUP68805.1\|2966502_2966883_+	transcriptional regulator	NA	NA	NA	NA
AUP68806.1\|2966879_2968376_+	arsenical-resistance protein	A0A2H4PQT9	Staphylococcus_phage	5.1e-14	39.7
AUP70269.1\|2968565_2968802_+	DUF3018 domain-containing protein	NA	NA	NA	NA
AUP68807.1\|2968874_2969048_+	hypothetical protein	NA	NA	NA	NA
2969959:2969986	attL	NA	NA	NA	NA
AUP68808.1\|2970092_2970524_+	hypothetical protein	NA	NA	NA	NA
AUP68809.1\|2970520_2971519_+\|integrase	integrase	A0A2D1G8E2	Mycobacterium_phage	7.4e-62	47.8
AUP68810.1\|2971532_2971997_+	hypothetical protein	NA	NA	NA	NA
AUP68811.1\|2971984_2972173_+	hypothetical protein	NA	NA	NA	NA
AUP68812.1\|2972129_2973390_+\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
AUP68813.1\|2973764_2975204_-\|capsid	phage major capsid protein	A0A1B3AYS4	Gordonia_phage	1.4e-66	40.6
AUP70270.1\|2975211_2975745_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	3.1e-06	32.9
AUP68814.1\|2975897_2976524_-\|terminase	phage terminase small subunit P27 family	V9H0V4	Actinophage	1.6e-17	47.2
2980941:2980968	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3710389 : 3796327

Burkholderia_virus(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUP69418.1\|3710389_3711650_+\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
AUP69419.1\|3711888_3713418_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUP70378.1\|3713350_3714289_-	RNA polymerase sigma factor SigJ	NA	NA	NA	NA
AUP69420.1\|3714297_3715665_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.1e-18	26.0
AUP69421.1\|3715733_3716951_+	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	8.0e-10	27.3
AUP69422.1\|3717046_3718555_+	MFS transporter	NA	NA	NA	NA
AUP69423.1\|3718551_3719703_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
AUP69424.1\|3719893_3720739_-	DUF732 domain-containing protein	NA	NA	NA	NA
AUP70379.1\|3720715_3721195_+	hypothetical protein	NA	NA	NA	NA
AUP69425.1\|3721213_3721654_+	Zn(2+)-responsive transcriptional regulator	NA	NA	NA	NA
AUP69426.1\|3721687_3722557_-	inner membrane protein YhjD	NA	NA	NA	NA
AUP69427.1\|3722577_3723588_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AUP69428.1\|3723872_3724505_+	alpha/beta hydrolase	NA	NA	NA	NA
AUP69429.1\|3724571_3725801_-	isocitrate dehydrogenase (NADP(+))	NA	NA	NA	NA
AUP69430.1\|3726083_3727433_+	bifunctional o-acetylhomoserine/o-acetylserine sulfhydrylase	A0A0B5JD48	Pandoravirus	2.5e-12	26.5
AUP69431.1\|3727444_3728584_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AUP70380.1\|3728580_3729312_+	methyltransferase	NA	NA	NA	NA
AUP69432.1\|3729320_3736892_-	PPE family protein	NA	NA	NA	NA
AUP69433.1\|3743154_3743412_-	DUF3017 domain-containing protein	NA	NA	NA	NA
AUP69434.1\|3743667_3753141_-	PPE family protein	NA	NA	NA	NA
AUP70382.1\|3753178_3753670_-	hypothetical protein	NA	NA	NA	NA
AUP70381.1\|3753766_3754213_+\|transposase	transposase	NA	NA	NA	NA
AUP69435.1\|3754249_3755068_-\|transposase	transposase	NA	NA	NA	NA
AUP69436.1\|3755284_3755521_-\|transposase	transposase	NA	NA	NA	NA
AUP69437.1\|3755908_3767059_-	PPE family protein	NA	NA	NA	NA
AUP69438.1\|3767302_3768097_-	oxidoreductase	NA	NA	NA	NA
AUP69439.1\|3768178_3768550_-	FAD-binding oxidoreductase	A0A0B5JBT9	Pandoravirus	3.3e-15	56.4
AUP69440.1\|3768447_3768858_-	FAD-binding protein	NA	NA	NA	NA
AUP70383.1\|3768692_3768953_-	oxidoreductase	NA	NA	NA	NA
AUP69441.1\|3769067_3769457_+	DUF732 domain-containing protein	NA	NA	NA	NA
AUP69442.1\|3769470_3769764_-	DUF3017 domain-containing protein	NA	NA	NA	NA
AUP69443.1\|3769760_3770606_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	NA	NA	NA	NA
AUP69444.1\|3770729_3771005_+	antitoxin	NA	NA	NA	NA
AUP69445.1\|3771001_3771259_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
AUP69446.1\|3771300_3772491_+	oxidoreductase	NA	NA	NA	NA
AUP69447.1\|3772607_3772976_+	hypothetical protein	NA	NA	NA	NA
AUP69448.1\|3772972_3773524_-	pentapeptide repeat protein MfpA	NA	NA	NA	NA
AUP69449.1\|3773530_3774112_-	ATP/GTP-binding protein	NA	NA	NA	NA
AUP70384.1\|3774092_3774461_-	DUF742 domain-containing protein	NA	NA	NA	NA
AUP69450.1\|3774438_3774831_-	dynein regulation protein LC7	NA	NA	NA	NA
AUP69451.1\|3774827_3777458_-	sensor histidine kinase	NA	NA	NA	NA
AUP69452.1\|3777693_3778158_+\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
AUP69453.1\|3778524_3780300_+	PE family protein	NA	NA	NA	NA
AUP69454.1\|3780300_3780945_-	oxidoreductase	NA	NA	NA	NA
AUP69455.1\|3780943_3781378_+	TIGR03667 family PPOX class F420-dependent oxidoreductase	NA	NA	NA	NA
AUP69456.1\|3781466_3784706_-	DNA polymerase III subunit alpha	A0A1C9LWS4	Streptomyces_phage	1.6e-118	32.4
AUP69457.1\|3784897_3786238_+	wax ester/triacylglycerol synthase family O-acyltransferase	NA	NA	NA	NA
AUP69458.1\|3786279_3787455_+	trehalose-phosphatase	NA	NA	NA	NA
AUP69459.1\|3787691_3788333_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUP69460.1\|3788333_3788582_+	enoyl-CoA hydratase	NA	NA	NA	NA
AUP69461.1\|3788586_3790014_+	amidase	NA	NA	NA	NA
AUP70385.1\|3790121_3790775_+	haloacid dehalogenase	NA	NA	NA	NA
AUP69462.1\|3790813_3792319_-	type B diterpene cyclase	NA	NA	NA	NA
AUP69463.1\|3792323_3793214_-	diterpene synthase	NA	NA	NA	NA
AUP69464.1\|3793222_3794833_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AUP69465.1\|3794777_3795023_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AUP69466.1\|3795065_3796327_-\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025597

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection