CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025941	Bacillus subtilis strain BJ3-2 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,RT,WYL,DinG	0	1	11	0
CP025942	Bacillus subtilis strain BJ3-2 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025941_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025941_1

681426-681533

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025941_1

>merge|CP025941|1|681426-681533|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP025941|1|1|681426-681533|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP025941.1\|AUS11214.1\|671234_672308_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP025941.1\|AUS11225.1\|691957_692446_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP025941.1\|AUS11219.1\|677787_678930_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP025941.1\|AUS11212.1\|668841_669897_-\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP025941.1\|AUS11226.1\|692451_693033_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP025941.1\|AUS11222.1\|689175_689697_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025941.1\|AUS11224.1\|691264_691789_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP025941.1\|AUS11228.1\|696016_696559_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP025941.1\|AUS11229.1\|696756_697302_+\|flagellar-hook-assembly-protein-FlgD	unknown	unknown	gnl\|CDD\|379999
CP025941.1\|AUS11220.1\|680851_681031_-\|hypothetical-protein	unknown	unknown	unknown
CP025941.1\|AUS14506.1\|693120_694329_-\|NAD-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
CP025941.1\|AUS11218.1\|676732_677764_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP025941.1\|AUS11216.1\|672898_675295_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP025941.1\|AUS11215.1\|672400_672868_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226007
CP025941.1\|AUS11211.1\|668405_668840_-\|hypothetical-protein	unknown	unknown	unknown
CP025941.1\|AUS11213.1\|669911_671045_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP025941.1\|AUS11221.1\|688556_689135_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP025941.1\|AUS11223.1\|689714_691244_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP025941.1\|AUS11227.1\|694345_695818_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP025941.1\|AUS11217.1\|675281_676736_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809

Protein	Function_ID	Function_description	E-value
CP025941.1\|AUS11214.1\|671234_672308_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	2.40975e-131
CP025941.1\|AUS11225.1\|691957_692446_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	4.09523e-17
CP025941.1\|AUS11219.1\|677787_678930_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP025941.1\|AUS11212.1\|668841_669897_-\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.21953e-130
CP025941.1\|AUS11226.1\|692451_693033_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.6838e-06
CP025941.1\|AUS11224.1\|691264_691789_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	4.60144e-05
CP025941.1\|AUS11228.1\|696016_696559_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	3.41954e-71
CP025941.1\|AUS11229.1\|696756_697302_+\|flagellar-hook-assembly-protein-FlgD	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	2.32574e-46
CP025941.1\|AUS14506.1\|693120_694329_-\|NAD-dependent-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	2.98957e-175
CP025941.1\|AUS11218.1\|676732_677764_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP025941.1\|AUS11216.1\|672898_675295_-\|glycogen-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP025941.1\|AUS11215.1\|672400_672868_+\|hypothetical-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.25205e-38
CP025941.1\|AUS11222.1\|689175_689697_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.26265e-10
CP025941.1\|AUS11213.1\|669911_671045_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	4.13033e-73
CP025941.1\|AUS11221.1\|688556_689135_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	4.91492e-72
CP025941.1\|AUS11223.1\|689714_691244_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	2.05993e-122
CP025941.1\|AUS11227.1\|694345_695818_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP025941.1\|AUS11217.1\|675281_676736_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0

>CP025941.1|AUS11220.1|680851_681031_-|hypothetical-protein
MHILQGFFIFINHGYVISFVLFLKQATKISIYFVFLQKMKLIVYKYKRFQERAFFYFFE
>CP025941.1|AUS11219.1|677787_678930_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLEMNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDFHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITQFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLKEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHATVKSSVIMPDVTIGEHVVIENAIVPKGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP025941.1|AUS11218.1|676732_677764_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKEASALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>CP025941.1|AUS11217.1|675281_676736_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKMSMKKKAECTLAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPSYRNEILTPYYGEQLEQVLQYRENDVTGILNGIDDTFYQPKSDPYIEAQYDSEHLACKLENKTRLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRSYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQQDVWQSIMKTAMNADYSWGKSAKEYQRIFEHVTRSGRDVLE
>CP025941.1|AUS11216.1|672898_675295_-|glycogen-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIKTNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKDIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPVIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHEEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEEDMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFRPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAPRRWLLKANPGLSAIITEAIGDEWVKQPESLIHLESYASDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVADKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADDVLSYQENGGYRSREYYQHDRRIRQVVDQLINGFFEGEADEFESIYDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMI
>CP025941.1|AUS11215.1|672400_672868_+|hypothetical-protein
MKKMIGAIAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGSAIGIIWAILFALISLSAAIIYAAFSFKGAKSFWFALLINYVLNQAFSYFQFTQKNLLAASIDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFAIDSMNL
>CP025941.1|AUS11214.1|671234_672308_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDEKKLTELAENVLQGWDVHAEKIDVIQGNQMALVWKVHTGSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMARAEKEDPFSQLYLQEIDRFIEDGLRIKDQLLQSAYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGAWDDETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKSNALQQLI
>CP025941.1|AUS11213.1|669911_671045_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADRETAEGVHYVHLDEDRYEEAVGEELRRSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAEHINDLLRSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>CP025941.1|AUS11212.1|668841_669897_-|CotS-family-spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDNVALKSNKSGRKIWEVQTDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIDGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDKVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>CP025941.1|AUS11211.1|668405_668840_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGSMGWQAHDSISAEKEEEEKHLAVGSIRELPHINAPKEYQEETKEKETEHNIINDEEETKFETAREPEEERESKRSMPLFEEEEHDDEEPELAEEARVEIIILPSDSKPAPWFSSAVKRKA
>CP025941.1|AUS11221.1|688556_689135_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVAKTKGKLIVSVVSAVFIGSFLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKADKA
>CP025941.1|AUS11222.1|689175_689697_-|GNAT-family-N-acetyltransferase
MVTVREARLDDIKDIAKVHVDSWRTTYHEIIPADYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEEHQRQGAGRALLTKGAEFLLQHGFSSMFVWVIEQNPSIIFYQSYSPERVSEDSFEIAGVRLKEAGLGWPDLSALKTLLNR
>CP025941.1|AUS11223.1|689714_691244_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRLKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRRDQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMIENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP025941.1|AUS11224.1|691264_691789_-|hypothetical-protein
MELFGVPIQTIYLYTLMIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVILLHIFVLVPLSSAEESLAYREDDLRGRVGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDISNGVLSVTPHEPI
>CP025941.1|AUS11225.1|691957_692446_+|DinB-family-protein
MSIFNEARLETWNELKGLSNEKLNQKPSADEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQNRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTATIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP025941.1|AUS11226.1|692451_693033_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTESFVTKQMDKLDFEYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTTLKEGSRILFPSGAALLCEGENDPCIQPGEVIQSYYPEQPKLAPAFVRHALGIRGIVCIVERPGAVYAGDEIEVHSFQRKVKPRKAERV
>CP025941.1|AUS14506.1|693120_694329_-|NAD-dependent-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVKELEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP025941.1|AUS11227.1|694345_695818_-|betaine-aldehyde-dehydrogenase
MSQTFYIDGEWISAEKGQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAANKDVDLISFTGGIETGKNIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCKSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP025941.1|AUS11228.1|696016_696559_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLSKEDLDKDIKNEALQLYDQLESSKAYYDWLKRLAEAVQSGEIFKFIPIETK
>CP025941.1|AUS11229.1|696756_697302_+|flagellar-hook-assembly-protein-FlgD
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTMNGNALRETQILNNGKTVRIPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP025941_1	1.1\|681450\|60\|CP025941\|CRISPRCasFinder	681450-681509	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 1.1|681450|60|CP025941|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

120946 : 157897

uncultured_Caudovirales_phage(33.33%)

terminase,capsid,holin,tail,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS10667.1\|120946_121921_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	7.7e-64	69.6
AUS10668.1\|121965_122388_-\|holin	holin	D6R405	Bacillus_phage	2.0e-48	72.9
AUS10669.1\|122433_123327_-\|portal	phage portal protein	NA	NA	NA	NA
AUS10670.1\|123413_123578_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
AUS10671.1\|123574_123910_-\|portal	phage portal protein	NA	NA	NA	NA
AUS10672.1\|123919_125020_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
AUS10673.1\|125022_125295_-	hypothetical protein	NA	NA	NA	NA
AUS10674.1\|125291_125870_-	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	4.3e-14	33.1
AUS10675.1\|125853_126900_-\|portal	phage portal protein	S6AVU3	Thermus_phage	8.3e-72	43.5
AUS10676.1\|126892_127318_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.5e-11	36.4
AUS10677.1\|127330_127594_-	DUF2577 domain-containing protein	NA	NA	NA	NA
AUS10678.1\|127590_128571_-\|portal	phage portal protein	H7BV96	unidentified_phage	1.9e-41	32.6
AUS10679.1\|128583_129243_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.1e-25	34.7
AUS10680.1\|129235_133993_-	hypothetical protein	A0A1L2JY60	Aeribacillus_phage	1.3e-44	47.2
AUS10681.1\|133995_134133_-	hypothetical protein	NA	NA	NA	NA
AUS10682.1\|134174_134624_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.7e-11	41.1
AUS10683.1\|135222_135666_-\|portal	phage portal protein	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
AUS10684.1\|135668_137069_-\|tail	phage tail sheath protein	S5MNC1	Brevibacillus_phage	4.1e-74	38.9
AUS10685.1\|137069_137261_-	hypothetical protein	NA	NA	NA	NA
AUS10686.1\|137257_137695_-\|portal	phage portal protein	NA	NA	NA	NA
AUS10687.1\|137707_138211_-\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	7.1e-37	45.7
AUS10688.1\|138207_138570_-	DUF3599 domain-containing protein	NA	NA	NA	NA
AUS10689.1\|138566_138962_-	hypothetical protein	NA	NA	NA	NA
AUS10690.1\|138966_139278_-	hypothetical protein	NA	NA	NA	NA
AUS10691.1\|139288_140224_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
AUS10692.1\|140242_141217_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.8e-58	57.5
AUS10693.1\|141232_142636_-	hypothetical protein	NA	NA	NA	NA
AUS10694.1\|142710_143610_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	6.9e-51	39.1
AUS10695.1\|143606_145139_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	2.1e-148	51.3
AUS10696.1\|145142_146438_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	6.7e-156	63.6
AUS10697.1\|146430_147225_-	hypothetical protein	A0A2H4J4R0	uncultured_Caudovirales_phage	3.0e-66	57.7
AUS10698.1\|147285_148149_-	hypothetical protein	NA	NA	NA	NA
AUS10699.1\|148417_149014_-	hypothetical protein	NA	NA	NA	NA
AUS10700.1\|149016_149208_-	hypothetical protein	NA	NA	NA	NA
AUS10701.1\|149349_149805_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	3.5e-59	73.5
AUS10702.1\|149899_150604_-	hypothetical protein	NA	NA	NA	NA
AUS10703.1\|150680_151229_-	DUF1643 domain-containing protein	NA	NA	NA	NA
AUS10704.1\|151334_151541_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.4e-20	73.1
AUS10705.1\|151625_152054_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	2.8e-42	65.7
AUS10706.1\|152148_152298_-	hypothetical protein	NA	NA	NA	NA
AUS10707.1\|152288_153230_-	ATP-binding protein	A6XMI1	Bacillus_virus	4.0e-57	51.7
AUS10708.1\|153111_153813_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.5e-05	32.2
AUS10709.1\|153865_154720_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	4.6e-113	74.8
AUS10710.1\|154722_155682_-	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	9.7e-136	73.9
AUS10711.1\|155787_155982_-	hypothetical protein	NA	NA	NA	NA
AUS10712.1\|156111_156366_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	9.1e-09	42.2
AUS10713.1\|156362_156932_-	XRE family transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
AUS10714.1\|157005_157146_-	hypothetical protein	NA	NA	NA	NA
AUS10715.1\|157148_157388_-	transcriptional regulator	NA	NA	NA	NA
AUS10716.1\|157543_157897_+	transcriptional regulator	A0A0A7RTK4	Clostridium_phage	8.0e-11	48.6

DBSCAN-SWA_2

296911 : 392137

108

Bacillus_phage(63.83%)

terminase,head,portal,protease,capsid,coat,holin,tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS10845.1\|296911_298057_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	5.8e-87	44.0
AUS10846.1\|298083_299112_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AUS10847.1\|299141_299342_-	DUF2905 domain-containing protein	NA	NA	NA	NA
AUS10848.1\|299334_300339_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	5.2e-07	29.8
AUS10849.1\|300349_300955_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AUS10850.1\|301093_301606_-	signaling peptide protein	NA	NA	NA	NA
AUS10851.1\|301653_302961_-	MFS transporter	NA	NA	NA	NA
AUS10852.1\|303031_304057_-	inositol 2-dehydrogenase	NA	NA	NA	NA
AUS10853.1\|304293_304941_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
AUS14492.1\|305504_305636_+	hypothetical protein	NA	NA	NA	NA
AUS10854.1\|305918_307373_+	alanine:cation symporter family protein	NA	NA	NA	NA
AUS10855.1\|307414_308137_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AUS10856.1\|308243_308843_-	sporulation protein	NA	NA	NA	NA
AUS10857.1\|308990_310148_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
AUS10858.1\|310263_311370_-	quinolinate synthase NadA	NA	NA	NA	NA
AUS10859.1\|311356_312226_-	nicotinate-nucleotide diphosphorylase (carboxylating)	NA	NA	NA	NA
AUS10860.1\|312179_313772_-	L-aspartate oxidase	NA	NA	NA	NA
AUS10861.1\|313874_315062_+	cysteine desulfurase	A0A141ZJV0	Faustovirus	2.3e-33	27.8
AUS10862.1\|315021_315564_+	transcription repressor NadR	NA	NA	NA	NA
AUS10863.1\|315587_316445_-	prephenate dehydratase	NA	NA	NA	NA
AUS10864.1\|316461_316905_-	ACT domain-containing protein	NA	NA	NA	NA
AUS10865.1\|316962_318249_-	GTPase ObgE	NA	NA	NA	NA
AUS10866.1\|318281_318860_-	sporulation protein	NA	NA	NA	NA
AUS10867.1\|319182_319467_-	50S ribosomal protein L27	NA	NA	NA	NA
AUS10868.1\|319479_319818_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
AUS10869.1\|319820_320129_-	50S ribosomal protein L21	NA	NA	NA	NA
AUS10870.1\|320275_321142_-	stage IV sporulation protein FB	NA	NA	NA	NA
AUS10871.1\|321134_321929_-	M23 family peptidase	NA	NA	NA	NA
AUS10872.1\|322077_322884_-	septum site-determining protein MinD	NA	NA	NA	NA
AUS10873.1\|322885_323566_-	septum site-determining protein MinC	NA	NA	NA	NA
AUS10874.1\|323618_324137_-	rod shape-determining protein MreD	NA	NA	NA	NA
AUS10875.1\|324133_325006_-	rod shape-determining protein MreC	NA	NA	NA	NA
AUS10876.1\|325036_326050_-	rod shape-determining protein	NA	NA	NA	NA
AUS14493.1\|326726_326981_-	hypothetical protein	NA	NA	NA	NA
AUS10877.1\|327082_327313_-	DNA-binding protein	NA	NA	NA	NA
AUS10878.1\|327290_327500_-	hypothetical protein	NA	NA	NA	NA
AUS10879.1\|328249_328648_+	hypothetical protein	NA	NA	NA	NA
AUS10880.1\|328683_328872_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	7.2e-11	50.0
AUS10881.1\|329030_330803_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.2e-123	55.8
AUS10882.1\|330815_331277_+	SMI1/KNR4 family protein	NA	NA	NA	NA
AUS10883.1\|331327_332296_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	3.1e-65	68.5
AUS10884.1\|332350_332614_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
AUS10885.1\|332628_332841_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
AUS10886.1\|332892_333066_-	XkdX family protein	Q9ZXD9	Bacillus_phage	5.6e-18	73.7
AUS10887.1\|333065_333434_-	hypothetical protein	Q9ZXE0	Bacillus_phage	2.7e-17	48.4
AUS10888.1\|333447_335031_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.3e-65	51.1
AUS10889.1\|335213_335522_-	hypothetical protein	NA	NA	NA	NA
AUS10890.1\|335537_337436_-	teichoic acid biosynthesis protein	A0A185AMX0	Staphylococcus_phage	9.5e-42	32.1
AUS10891.1\|337487_339191_-	alkaline phosphatase	D6R400	Bacillus_phage	8.2e-178	55.3
AUS10892.1\|339205_340045_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.9e-93	59.0
AUS10893.1\|340038_344526_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	2.0e-66	41.5
AUS10894.1\|344725_345103_-	hypothetical protein	NA	NA	NA	NA
AUS10895.1\|345167_345779_-\|tail	phage tail protein	J7KKC8	Streptococcus_phage	3.6e-11	35.1
AUS10896.1\|345793_346186_-	hypothetical protein	NA	NA	NA	NA
AUS10897.1\|346182_346581_-	hypothetical protein	NA	NA	NA	NA
AUS10898.1\|346580_346895_-\|head,tail	head-tail adaptor protein	A0A2H4JCB1	uncultured_Caudovirales_phage	2.2e-12	36.3
AUS10899.1\|346884_347187_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	2.8e-12	46.3
AUS10900.1\|347204_347666_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.0e-10	58.9
AUS10901.1\|347692_348979_-\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	2.7e-80	45.2
AUS10902.1\|349018_349756_-\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	6.9e-57	56.4
AUS10903.1\|349703_351011_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	9.3e-105	46.7
AUS10904.1\|351011_351203_-	DUF1056 domain-containing protein	NA	NA	NA	NA
AUS10905.1\|351213_352923_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	6.0e-205	62.5
AUS10906.1\|352919_353435_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.2e-33	43.4
AUS10907.1\|353663_354029_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	3.9e-29	51.7
AUS10908.1\|354389_354704_-	hypothetical protein	NA	NA	NA	NA
AUS10909.1\|354951_355230_-	hypothetical protein	NA	NA	NA	NA
AUS10910.1\|355671_356085_-	ArpU family transcriptional regulator	D6R428	Bacillus_phage	5.6e-64	97.7
AUS10911.1\|356170_356521_-	hypothetical protein	NA	NA	NA	NA
AUS10912.1\|356508_356745_-	hypothetical protein	NA	NA	NA	NA
AUS10913.1\|356737_356956_-	hypothetical protein	NA	NA	NA	NA
AUS10914.1\|356968_357370_-	hypothetical protein	M4ZR14	Bacillus_phage	3.0e-62	97.0
AUS10915.1\|357366_357549_-	hypothetical protein	NA	NA	NA	NA
AUS10916.1\|357561_357747_-	hypothetical protein	NA	NA	NA	NA
AUS10917.1\|357743_358127_-	hypothetical protein	H0USU9	Bacillus_phage	4.9e-14	59.6
AUS10918.1\|358092_358284_-	hypothetical protein	D6R426	Bacillus_phage	8.1e-18	80.4
AUS10919.1\|358284_358800_-	hypothetical protein	D6R425	Bacillus_phage	6.4e-94	95.9
AUS10920.1\|358833_359373_-	nuclease	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
AUS10921.1\|359369_359807_-	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
AUS10922.1\|360008_362426_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	89.0
AUS10923.1\|362486_362924_-	hypothetical protein	Q9ZXC5	Bacillus_phage	3.8e-79	96.6
AUS10924.1\|362947_363145_-	hypothetical protein	Q9ZXC6	Bacillus_phage	1.1e-17	87.5
AUS10925.1\|363134_364073_-	hypothetical protein	Q9ZXC7	Bacillus_phage	2.8e-164	93.2
AUS10926.1\|364076_364631_-	hypothetical protein	Q9ZXC8	Bacillus_phage	6.9e-94	96.2
AUS10927.1\|364824_365100_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.7e-21	48.3
AUS10928.1\|365320_365593_-	XRE family transcriptional regulator	D6R414	Bacillus_phage	1.4e-39	94.4
AUS10929.1\|365872_366307_+	XRE family transcriptional regulator	Q786F1	Bacillus_phage	2.6e-64	91.0
AUS10930.1\|366320_366767_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	3.5e-72	88.5
AUS10931.1\|366806_368234_+	recombinase family protein	Q9T200	Bacillus_phage	3.8e-229	84.8
AUS10932.1\|368237_368654_-	DNA repair protein RadC	NA	NA	NA	NA
AUS10933.1\|368690_369260_-	septum formation protein Maf	NA	NA	NA	NA
AUS10934.1\|369411_370410_-	SPOR domain-containing protein	NA	NA	NA	NA
AUS10935.1\|370543_371290_-	prepilin peptidase	NA	NA	NA	NA
AUS10936.1\|371429_372722_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AUS10937.1\|372781_375424_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	1.7e-161	42.8
AUS10938.1\|375871_376063_+	hypothetical protein	NA	NA	NA	NA
AUS10939.1\|376081_377107_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
AUS10940.1\|377139_378846_-	stage VI sporulation protein D	NA	NA	NA	NA
AUS10941.1\|378975_380268_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
AUS10942.1\|380297_381272_-	porphobilinogen synthase	NA	NA	NA	NA
AUS10943.1\|381268_382057_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
AUS10944.1\|382046_382991_-	hydroxymethylbilane synthase	NA	NA	NA	NA
AUS10945.1\|383023_383854_-	cytochrome C assembly protein	NA	NA	NA	NA
AUS10946.1\|383861_385229_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
AUS10947.1\|385976_386564_-	GTP-binding protein	NA	NA	NA	NA
AUS10948.1\|386560_388885_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.5
AUS10949.1\|389065_390724_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
AUS10950.1\|390874_392137_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_3

1382569 : 1486215

107

Bacillus_phage(21.43%)

protease,lysis,coat,bacteriocin,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS11853.1\|1382569_1384240_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AUS11854.1\|1384236_1384665_-	DUF1934 domain-containing protein	NA	NA	NA	NA
AUS11855.1\|1384976_1385108_+	subtilosin-A	NA	NA	NA	NA
AUS11856.1\|1385064_1385217_+\|bacteriocin	bacteriocin biosynthesis protein	NA	NA	NA	NA
AUS11857.1\|1385241_1386588_+	subtilosin maturase AlbA	NA	NA	NA	NA
AUS11858.1\|1386600_1386762_+\|bacteriocin	bacteriocin biosynthesis protein AlbB	NA	NA	NA	NA
AUS11859.1\|1386758_1387478_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-19	27.6
AUS11860.1\|1387470_1388781_+\|bacteriocin	bacteriocin biosynthesis protein AlbD	NA	NA	NA	NA
AUS14545.1\|1388770_1389931_+	insulinase family protein	NA	NA	NA	NA
AUS11861.1\|1389935_1391216_+	insulinase family protein	NA	NA	NA	NA
AUS11862.1\|1391212_1391914_+\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
AUS11863.1\|1391919_1393296_-	hypothetical protein	NA	NA	NA	NA
AUS11864.1\|1393335_1394691_-	hypothetical protein	NA	NA	NA	NA
AUS11865.1\|1394687_1394888_-	hypothetical protein	NA	NA	NA	NA
AUS11866.1\|1394920_1396066_+	aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	5.1e-83	44.8
AUS11867.1\|1396049_1396169_+	phosphatase	NA	NA	NA	NA
AUS11868.1\|1396267_1396741_+	hypothetical protein	NA	NA	NA	NA
AUS11869.1\|1396772_1397645_-	agmatinase	NA	NA	NA	NA
AUS11870.1\|1397705_1398536_-	polyamine aminopropyltransferase	NA	NA	NA	NA
AUS11871.1\|1398737_1400813_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AUS11872.1\|1401211_1401712_-	histidine kinase	NA	NA	NA	NA
AUS14546.1\|1402297_1403236_-	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	8.8e-57	45.7
AUS11873.1\|1404343_1404862_-	hypothetical protein	NA	NA	NA	NA
AUS11874.1\|1404875_1405535_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AUS11875.1\|1405643_1405832_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
AUS11876.1\|1405874_1406294_-	MarR family transcriptional regulator	NA	NA	NA	NA
AUS11877.1\|1406413_1408330_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	9.6e-143	42.7
AUS11878.1\|1408543_1408732_-	hypothetical protein	NA	NA	NA	NA
AUS11879.1\|1409179_1410580_-	MFS transporter	NA	NA	NA	NA
AUS11880.1\|1410576_1411047_-	transcriptional regulator	NA	NA	NA	NA
AUS11881.1\|1411159_1411660_-	YwgA family protein	NA	NA	NA	NA
AUS11882.1\|1411695_1412997_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	5.5e-25	28.9
AUS11883.1\|1413158_1413383_-	DUF1450 domain-containing protein	NA	NA	NA	NA
AUS11884.1\|1413596_1414376_+	Prespore-specific transcriptional regulator RsfA	NA	NA	NA	NA
AUS11885.1\|1414520_1415411_-	EamA family transporter	NA	NA	NA	NA
AUS11886.1\|1415579_1416425_-	lipoate--protein ligase family protein	NA	NA	NA	NA
AUS11887.1\|1416472_1417372_-	transcriptional regulator CynR	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
AUS11888.1\|1417517_1418489_-	phosphate acetyltransferase	NA	NA	NA	NA
AUS14547.1\|1418774_1419524_+	heme-dependent peroxidase	NA	NA	NA	NA
AUS11889.1\|1419656_1420436_+	SDR family oxidoreductase	NA	NA	NA	NA
AUS11890.1\|1420451_1421651_-	aspartate aminotransferase	NA	NA	NA	NA
AUS11891.1\|1421651_1422836_-	MFS transporter	NA	NA	NA	NA
AUS11892.1\|1422832_1424251_-	carboxylate--amine ligase	NA	NA	NA	NA
AUS11893.1\|1424268_1425036_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-21	30.5
AUS11894.1\|1425032_1425740_-	cupin domain-containing protein	NA	NA	NA	NA
AUS11895.1\|1425729_1426344_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
AUS11896.1\|1426495_1427734_-	MFS transporter	NA	NA	NA	NA
AUS11897.1\|1427941_1429354_-	amino acid permease	NA	NA	NA	NA
AUS11898.1\|1429353_1431054_-	peptidase M20	NA	NA	NA	NA
AUS11899.1\|1431127_1432675_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AUS11900.1\|1432906_1434181_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AUS11901.1\|1434356_1434821_-	hypothetical protein	NA	NA	NA	NA
AUS11902.1\|1435144_1435600_-\|coat	spore coat protein	NA	NA	NA	NA
AUS11903.1\|1435592_1436444_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.2e-38	38.4
AUS11904.1\|1436457_1437405_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.7e-71	43.5
AUS11905.1\|1437404_1438145_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.3e-49	42.3
AUS11906.1\|1438169_1439189_-\|coat	spore coat protein	NA	NA	NA	NA
AUS11907.1\|1439191_1439914_-\|coat	spore coat protein	NA	NA	NA	NA
AUS11908.1\|1439906_1441028_-\|coat	spore coat protein	NA	NA	NA	NA
AUS11909.1\|1441027_1441897_-	N-acetyltransferase	NA	NA	NA	NA
AUS11910.1\|1443086_1444511_-\|coat	spore coat protein	NA	NA	NA	NA
AUS11911.1\|1444515_1445286_-	glycosyl transferase	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
AUS11912.1\|1445251_1445458_-	hypothetical protein	NA	NA	NA	NA
AUS11913.1\|1445605_1446142_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
AUS11914.1\|1446185_1446557_-	DUF423 domain-containing protein	NA	NA	NA	NA
AUS11915.1\|1446618_1447941_-	purine permease	NA	NA	NA	NA
AUS11916.1\|1447960_1448278_-	hypothetical protein	NA	NA	NA	NA
AUS11917.1\|1448444_1449815_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AUS11918.1\|1449839_1450517_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	2.4e-48	45.7
AUS11919.1\|1450530_1451337_-	glycosyltransferase	NA	NA	NA	NA
AUS11920.1\|1451426_1451960_-	hypothetical protein	NA	NA	NA	NA
AUS11921.1\|1452007_1452643_-	hypothetical protein	NA	NA	NA	NA
AUS11922.1\|1452635_1452974_-	PadR family transcriptional regulator	NA	NA	NA	NA
AUS11923.1\|1453117_1453933_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AUS11924.1\|1454022_1454271_-	hypothetical protein	NA	NA	NA	NA
AUS11925.1\|1454364_1455804_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	5.7e-23	27.8
AUS11926.1\|1455800_1457186_-	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
AUS11927.1\|1457487_1458258_+	transporter	NA	NA	NA	NA
AUS11928.1\|1458296_1459127_-	levansucrase	NA	NA	NA	NA
AUS14548.1\|1459166_1459469_-	hypothetical protein	NA	NA	NA	NA
AUS11929.1\|1459998_1462419_+	peptidase S8	A0A217EQY2	Bacillus_phage	5.3e-21	38.2
AUS11930.1\|1462456_1463458_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
AUS11931.1\|1463631_1464381_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AUS11932.1\|1464486_1465668_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AUS11933.1\|1466164_1466428_+	germination protein	NA	NA	NA	NA
AUS11934.1\|1466469_1466844_-	quinol oxidase subunit 4	NA	NA	NA	NA
AUS11935.1\|1466845_1467460_-	Quinol oxidase subunit 3	NA	NA	NA	NA
AUS11936.1\|1467473_1469423_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
AUS14549.1\|1469450_1470416_-	quinol oxidase subunit 2	NA	NA	NA	NA
AUS14550.1\|1470929_1471175_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AUS11937.1\|1471246_1472788_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AUS11938.1\|1472791_1473964_-	galactokinase	NA	NA	NA	NA
AUS11939.1\|1474046_1474430_-	GtrA family protein	NA	NA	NA	NA
AUS11940.1\|1474447_1475119_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUS11941.1\|1475473_1475632_+	DNA-binding anti-repressor SinI	NA	NA	NA	NA
AUS11942.1\|1476075_1476384_+	DUF485 domain-containing protein	NA	NA	NA	NA
AUS11943.1\|1476380_1477922_+	cation acetate symporter	NA	NA	NA	NA
AUS11944.1\|1477950_1478553_-	DsbA family protein	NA	NA	NA	NA
AUS11945.1\|1478643_1479894_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
AUS11946.1\|1479912_1481070_-	Efem/EfeO family lipoprotein	NA	NA	NA	NA
AUS11947.1\|1481066_1482512_-	iron transporter	NA	NA	NA	NA
AUS11948.1\|1482522_1482702_-	hypothetical protein	NA	NA	NA	NA
AUS11949.1\|1482667_1483336_-	thiamine phosphate synthase	NA	NA	NA	NA
AUS11950.1\|1483332_1484151_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
AUS11951.1\|1484158_1485064_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUS11952.1\|1485169_1485556_+\|holin	holin-like protein CidA	NA	NA	NA	NA
AUS11953.1\|1485537_1486215_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA

DBSCAN-SWA_4

1935665 : 2000784

Bacillus_phage(41.86%)

terminase,integrase,capsid,tRNA,holin,tail,portal

attL 1948589:1948636|attR 2001914:2001961

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS12379.1\|1935665_1936409_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AUS12380.1\|1936570_1937008_+	50S ribosomal protein L13	NA	NA	NA	NA
AUS12381.1\|1937028_1937421_+	30S ribosomal protein S9	NA	NA	NA	NA
AUS12382.1\|1937883_1938651_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AUS12383.1\|1938835_1939279_+	DUF2521 domain-containing protein	NA	NA	NA	NA
AUS12384.1\|1939338_1940052_+	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	4.8e-15	30.5
AUS12385.1\|1940146_1941205_+	ATP-binding protein	NA	NA	NA	NA
AUS12386.1\|1941241_1941799_-	spore gernimation protein GerD	NA	NA	NA	NA
AUS12387.1\|1941908_1942505_+	KinB-signaling pathway activation protein	NA	NA	NA	NA
AUS12388.1\|1942505_1943270_-	polysaccharide deacetylase PdaB	NA	NA	NA	NA
1948589:1948636	attL	NA	NA	NA	NA
AUS12389.1\|1948741_1949926_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	1.5e-74	40.5
AUS12390.1\|1949912_1950446_-\|portal	phage portal protein	A0A2H4JA43	uncultured_Caudovirales_phage	1.8e-38	50.6
AUS12391.1\|1950526_1951132_-	hypothetical protein	O64079	Bacillus_phage	7.2e-60	75.8
AUS12392.1\|1951363_1951690_-	XRE family transcriptional regulator	O64078	Bacillus_phage	1.5e-48	91.6
AUS12393.1\|1951855_1952104_+	XRE family transcriptional regulator	A0A290G4F8	Caldibacillus_phage	4.4e-08	45.7
AUS12394.1\|1952119_1952311_+	DNA-binding protein	U5P0W4	Brevibacillus_phage	2.9e-07	44.8
AUS12395.1\|1952375_1952909_+	hypothetical protein	NA	NA	NA	NA
AUS12396.1\|1952898_1953159_+	hypothetical protein	NA	NA	NA	NA
AUS12397.1\|1953741_1953927_+	hypothetical protein	NA	NA	NA	NA
AUS12398.1\|1953923_1955897_+	hypothetical protein	A0A1L2K2K3	Aeribacillus_phage	1.7e-155	48.3
AUS12399.1\|1955896_1956121_+	hypothetical protein	NA	NA	NA	NA
AUS12400.1\|1956113_1956995_+	recombinase RecT	D7RWF9	Brochothrix_phage	2.0e-87	61.3
AUS12401.1\|1956991_1957693_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	3.2e-96	70.0
AUS12402.1\|1957897_1958662_+	hypothetical protein	U5Q085	Bacillus_phage	2.0e-11	31.9
AUS12403.1\|1958675_1958957_+	hypothetical protein	NA	NA	NA	NA
AUS12404.1\|1958931_1960230_+	replicative DNA helicase	D2XR44	Bacillus_phage	1.6e-93	42.6
AUS12405.1\|1960248_1960443_+	Fur-regulated basic protein FbpA	A0A1L2JY24	Aeribacillus_phage	4.7e-05	41.8
AUS12406.1\|1960543_1960999_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	6.0e-51	67.6
AUS12407.1\|1960971_1961664_+	hypothetical protein	NA	NA	NA	NA
AUS12408.1\|1961663_1961864_+	hypothetical protein	NA	NA	NA	NA
AUS12409.1\|1961790_1961973_+	hypothetical protein	NA	NA	NA	NA
AUS12410.1\|1962042_1962246_+	hypothetical protein	NA	NA	NA	NA
AUS12411.1\|1962286_1962766_+	hypothetical protein	A0A0M3ULE9	Bacillus_phage	4.0e-21	38.1
AUS12412.1\|1962783_1963071_+	hypothetical protein	NA	NA	NA	NA
AUS12413.1\|1963067_1963340_+	hypothetical protein	NA	NA	NA	NA
AUS12414.1\|1963373_1963976_+	hypothetical protein	NA	NA	NA	NA
AUS12415.1\|1963972_1964254_+	hypothetical protein	NA	NA	NA	NA
AUS12416.1\|1964250_1964649_+	hypothetical protein	M4ZR14	Bacillus_phage	6.8e-59	89.4
AUS12417.1\|1964730_1965117_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	4.2e-29	56.5
AUS12418.1\|1965185_1965938_+	hypothetical protein	NA	NA	NA	NA
AUS12419.1\|1966010_1966385_+	hypothetical protein	NA	NA	NA	NA
AUS12420.1\|1966694_1967039_+	structural protein	M4ZRM2	Bacillus_phage	4.8e-29	57.0
AUS12421.1\|1967106_1967580_+	hypothetical protein	NA	NA	NA	NA
AUS12422.1\|1967635_1968913_+	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	3.6e-77	40.2
AUS12423.1\|1969050_1969299_+	hypothetical protein	A8ATN7	Listeria_phage	2.7e-05	36.7
AUS12424.1\|1969428_1969959_+	hypothetical protein	NA	NA	NA	NA
AUS12425.1\|1970044_1970932_+\|terminase	terminase	A0A1L2JY44	Aeribacillus_phage	2.4e-16	70.7
AUS14567.1\|1970931_1972236_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.7e-157	63.3
AUS12426.1\|1972240_1973773_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	7.4e-154	54.4
AUS12427.1\|1973769_1974687_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.8e-55	39.9
AUS12428.1\|1974733_1975393_+	hypothetical protein	NA	NA	NA	NA
AUS12429.1\|1975444_1976632_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	5.5e-80	51.7
AUS12430.1\|1976663_1977599_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	5.1e-105	64.0
AUS12431.1\|1977610_1977964_+	hypothetical protein	NA	NA	NA	NA
AUS12432.1\|1977969_1978362_+	hypothetical protein	A0A1B1P7D6	Bacillus_phage	3.8e-14	37.7
AUS12433.1\|1978358_1978721_+	DUF3599 domain-containing protein	NA	NA	NA	NA
AUS12434.1\|1978717_1979218_+\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	3.0e-40	47.2
AUS12435.1\|1979230_1979668_+\|portal	phage portal protein	NA	NA	NA	NA
AUS12436.1\|1979664_1979856_+	hypothetical protein	NA	NA	NA	NA
AUS12437.1\|1979856_1981257_+\|tail	phage tail sheath protein	S5MNC1	Brevibacillus_phage	1.7e-75	39.3
AUS12438.1\|1981259_1981703_+\|portal	phage portal protein	A0A0K2CNG3	Brevibacillus_phage	7.1e-25	44.7
AUS12439.1\|1981977_1982064_-\|holin	putative holin-like toxin	NA	NA	NA	NA
AUS12440.1\|1982219_1982669_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.3e-10	36.6
AUS12441.1\|1982710_1982848_+	hypothetical protein	NA	NA	NA	NA
AUS12442.1\|1982850_1988193_+	hypothetical protein	A0A1L2JY60	Aeribacillus_phage	7.0e-42	45.5
AUS12443.1\|1988185_1988845_+\|portal	phage portal protein	A0A090DBR9	Clostridium_phage	6.7e-27	35.8
AUS12444.1\|1988859_1989840_+\|portal	phage portal protein	H7BV96	unidentified_phage	2.7e-40	32.3
AUS12445.1\|1989836_1990103_+\|portal	phage portal protein	NA	NA	NA	NA
AUS12446.1\|1990115_1990541_+\|portal	phage portal protein	A0A0A8WJV8	Clostridium_phage	1.1e-11	35.6
AUS12447.1\|1990533_1991580_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.8e-71	43.8
AUS12448.1\|1991563_1992142_+\|portal	phage portal protein	A0A2H4J717	uncultured_Caudovirales_phage	4.3e-14	33.8
AUS12449.1\|1992138_1992411_+	hypothetical protein	NA	NA	NA	NA
AUS12450.1\|1992414_1994172_+\|terminase	terminase	A0A1L2K2Q1	Aeribacillus_phage	2.0e-14	28.5
AUS12451.1\|1994181_1994517_+\|portal	phage portal protein	NA	NA	NA	NA
AUS12452.1\|1994513_1994678_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	69.8
AUS12453.1\|1994766_1995660_+\|portal	phage portal protein	NA	NA	NA	NA
AUS12454.1\|1995709_1996132_+\|holin	holin	D6R405	Bacillus_phage	4.8e-55	83.5
AUS12455.1\|1996174_1997146_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	7.0e-65	68.5
AUS12456.1\|1997197_1997662_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AUS12457.1\|1997680_1999444_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.4e-127	54.3
AUS12458.1\|1999653_2000784_+	aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	6.4e-70	39.8
2001914:2001961	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2534727 : 2543092

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS12915.1\|2534727_2536023_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
AUS12916.1\|2536096_2536822_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.7e-45	43.7
AUS12917.1\|2536814_2537069_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AUS12918.1\|2537065_2537749_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AUS12919.1\|2537732_2539961_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-158	40.0
AUS12920.1\|2539936_2541367_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AUS12921.1\|2541467_2542508_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.2e-64	42.0
AUS12922.1\|2542504_2543092_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-29	42.1

DBSCAN-SWA_6

3036366 : 3070477

Planktothrix_phage(20.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS14619.1\|3036366_3037359_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AUS13376.1\|3038103_3039741_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUS13377.1\|3039847_3040783_+	peptide ABC transporter permease	NA	NA	NA	NA
AUS13378.1\|3040786_3041704_+	peptide ABC transporter permease	NA	NA	NA	NA
AUS13379.1\|3041708_3042785_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
AUS13380.1\|3042786_3043704_+	peptide ABC transporter ATP-binding protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.5e-05	24.6
AUS13381.1\|3043810_3045028_+	MFS transporter	NA	NA	NA	NA
AUS13382.1\|3045191_3045770_+	N-acetyltransferase	NA	NA	NA	NA
AUS13383.1\|3045950_3046346_+	transcriptional regulator Spx	NA	NA	NA	NA
AUS13384.1\|3046600_3047257_-	hypothetical protein	A0A2R2YAT9	Pseudomonas_phage	4.2e-29	38.0
AUS13385.1\|3047533_3048190_+	adaptor protein MecA	NA	NA	NA	NA
AUS13386.1\|3048347_3049499_+	competence protein CoiA	NA	NA	NA	NA
AUS13387.1\|3049545_3051558_+	oligoendopeptidase F	NA	NA	NA	NA
AUS13388.1\|3051595_3051763_-	hypothetical protein	NA	NA	NA	NA
AUS13389.1\|3051858_3052062_-	hypothetical protein	NA	NA	NA	NA
AUS13390.1\|3052076_3052976_-	DsbA family protein	NA	NA	NA	NA
AUS13391.1\|3052972_3053371_-	thiol management oxidoreductase	NA	NA	NA	NA
AUS14620.1\|3053622_3054168_-	lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	4.8e-39	60.4
AUS13392.1\|3054371_3054944_-	CYTH domain-containing protein	NA	NA	NA	NA
AUS13393.1\|3055067_3055436_+	hypothetical protein	NA	NA	NA	NA
AUS13394.1\|3055464_3056100_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
AUS13395.1\|3056118_3056919_+	NAD(+) kinase	NA	NA	NA	NA
AUS14621.1\|3056981_3057833_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AUS13396.1\|3057844_3058579_-	hypothetical protein	A0A1V0SJW2	Klosneuvirus	8.0e-13	26.3
AUS13397.1\|3058813_3060658_+	sodium:proton antiporter	NA	NA	NA	NA
AUS13398.1\|3060907_3061618_+	thiaminase II	NA	NA	NA	NA
AUS13399.1\|3061592_3062210_+	thiamine phosphate synthase	NA	NA	NA	NA
AUS13400.1\|3062193_3063303_+	glycine oxidase ThiO	NA	NA	NA	NA
AUS14622.1\|3063302_3063503_+	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
AUS13401.1\|3063499_3064270_+	thiazole synthase	NA	NA	NA	NA
AUS13402.1\|3064266_3065277_+	thiamine biosynthesis protein MoeB	NA	NA	NA	NA
AUS13403.1\|3065295_3066111_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AUS13404.1\|3066245_3067022_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AUS13405.1\|3067122_3067806_+\|coat	spore coat protein	NA	NA	NA	NA
AUS13406.1\|3067903_3068356_-\|coat	spore coat protein	NA	NA	NA	NA
AUS13407.1\|3068483_3068972_-\|coat	spore coat protein	NA	NA	NA	NA
AUS13408.1\|3069123_3069633_-\|coat	spore coat protein	NA	NA	NA	NA
AUS13409.1\|3069727_3070051_-\|coat	spore coat protein	NA	NA	NA	NA
AUS13410.1\|3070090_3070477_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_7

3097038 : 3178877

Bacillus_phage(25.64%)

terminase,protease,coat,tRNA,holin,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS13434.1\|3097038_3097518_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AUS14625.1\|3097555_3097750_-	DUF4177 domain-containing protein	NA	NA	NA	NA
AUS13435.1\|3097806_3098139_-	DUF4306 domain-containing protein	NA	NA	NA	NA
AUS13436.1\|3098569_3098842_+	hypothetical protein	NA	NA	NA	NA
AUS13437.1\|3098860_3099823_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
AUS13438.1\|3099972_3100194_-\|coat	spore coat protein	NA	NA	NA	NA
AUS13439.1\|3100446_3101850_+	hypothetical protein	NA	NA	NA	NA
AUS13440.1\|3101888_3102362_-	DUF2690 domain-containing protein	NA	NA	NA	NA
AUS13441.1\|3102486_3102654_-	putative motility protein	NA	NA	NA	NA
AUS13442.1\|3102779_3103679_+	hypothetical protein	NA	NA	NA	NA
AUS13443.1\|3103687_3104086_-	hypothetical protein	NA	NA	NA	NA
AUS13444.1\|3104187_3104763_-	hypothetical protein	NA	NA	NA	NA
AUS13445.1\|3104908_3107866_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
AUS13446.1\|3107858_3108419_+	DUF1641 domain-containing protein	NA	NA	NA	NA
AUS13447.1\|3108617_3109262_+	DUF4352 domain-containing protein	NA	NA	NA	NA
AUS13448.1\|3109334_3109961_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AUS13449.1\|3109991_3110270_-	hypothetical protein	NA	NA	NA	NA
AUS13450.1\|3110668_3111859_+	cytochrome P450	NA	NA	NA	NA
AUS13451.1\|3111881_3113060_+	UDP-glucosyltransferase	Q8JRT0	Phthorimaea_operculella_granulovirus	2.1e-07	22.1
AUS13452.1\|3113103_3113292_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
AUS13453.1\|3113464_3114277_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
AUS13454.1\|3114322_3115075_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AUS13455.1\|3115074_3115827_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-17	31.3
AUS13456.1\|3115947_3116922_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
AUS13457.1\|3117938_3118361_+	DUF1641 domain-containing protein	NA	NA	NA	NA
AUS13458.1\|3118400_3119579_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AUS13459.1\|3119776_3121198_+	glucuronate isomerase	NA	NA	NA	NA
AUS13460.1\|3121265_3122645_+	MFS transporter	NA	NA	NA	NA
AUS13461.1\|3122750_3123764_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
AUS13462.1\|3123769_3124789_+	alcohol dehydrogenase	NA	NA	NA	NA
AUS13463.1\|3124813_3125893_+	mannonate dehydratase	NA	NA	NA	NA
AUS13464.1\|3125889_3126726_+	KR domain-containing protein	M1NMS3	Moumouvirus	2.7e-09	30.4
AUS13465.1\|3126773_3128042_+	MFS transporter	NA	NA	NA	NA
AUS13466.1\|3128129_3129131_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUS13467.1\|3129207_3130650_+	altronate oxidoreductase	NA	NA	NA	NA
AUS13468.1\|3130646_3132140_+	altronate dehydratase	NA	NA	NA	NA
AUS13469.1\|3132178_3132943_-	anion permease	NA	NA	NA	NA
AUS13470.1\|3133165_3133630_-	hypothetical protein	NA	NA	NA	NA
AUS13471.1\|3133778_3135050_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	A0A1V0SEI6	Indivirus	8.6e-15	37.1
AUS13472.1\|3135194_3136331_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.7e-94	47.6
AUS13473.1\|3136320_3136455_+	hypothetical protein	NA	NA	NA	NA
AUS13474.1\|3136485_3136740_-	hypothetical protein	NA	NA	NA	NA
AUS13475.1\|3136861_3137815_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	6.8e-65	71.7
AUS13476.1\|3137852_3138230_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
AUS13477.1\|3138334_3138937_+	hypothetical protein	F8WQ53	Bacillus_phage	1.7e-45	49.2
AUS13478.1\|3139013_3139850_+	manganese catalase	NA	NA	NA	NA
AUS13479.1\|3139893_3140490_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	6.2e-40	51.7
AUS13480.1\|3140654_3140993_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.9e-18	45.3
AUS13481.1\|3141171_3141351_+	hypothetical protein	NA	NA	NA	NA
AUS13482.1\|3141337_3142174_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.9e-23	29.7
AUS13483.1\|3142073_3142874_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	52.2
AUS13484.1\|3142873_3143041_+	hypothetical protein	NA	NA	NA	NA
AUS13485.1\|3143125_3143476_+\|portal	phage portal protein	NA	NA	NA	NA
AUS13486.1\|3143472_3143679_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
AUS13487.1\|3143793_3144303_+	DNA-directed RNA polymerase sigma-70 factor	A0A0K2CNQ1	Brevibacillus_phage	3.6e-20	39.5
AUS13488.1\|3144420_3145218_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	9.4e-60	50.2
AUS13489.1\|3145214_3146516_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	6.3e-154	60.9
AUS13490.1\|3146519_3148007_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	5.9e-140	55.5
AUS13491.1\|3148026_3148854_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	58.7
AUS13492.1\|3148879_3149815_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AUS13493.1\|3149836_3150220_+	hypothetical protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
AUS13494.1\|3150216_3150573_+	DUF3599 domain-containing protein	NA	NA	NA	NA
AUS13495.1\|3150569_3151055_+\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	8.9e-37	45.7
AUS13496.1\|3151067_3151508_+\|portal	phage portal protein	NA	NA	NA	NA
AUS13497.1\|3151511_3151730_+	hypothetical protein	NA	NA	NA	NA
AUS13498.1\|3151726_3153127_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	1.6e-78	39.3
AUS13499.1\|3153128_3153572_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
AUS13500.1\|3153698_3154103_+\|portal	phage portal protein	A0A249XXA9	Clostridium_phage	5.7e-13	36.0
AUS13501.1\|3154132_3154282_+	hypothetical protein	NA	NA	NA	NA
AUS13502.1\|3154283_3158165_+	lytic transglycosylase	A0A1L2JY60	Aeribacillus_phage	9.3e-44	45.3
AUS13503.1\|3158157_3158817_+	phage-like element PBSX protein XkdP	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
AUS13504.1\|3158832_3159810_+\|portal	phage portal protein	H7BV96	unidentified_phage	3.9e-39	32.3
AUS13505.1\|3159809_3160076_+\|portal	phage portal protein	S6C459	Thermus_phage	2.9e-05	36.4
AUS13506.1\|3160133_3160559_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	6.6e-12	37.3
AUS13507.1\|3160551_3161598_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.3e-72	44.3
AUS13508.1\|3161581_3162160_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	5.1e-15	34.2
AUS13509.1\|3162156_3162429_+	hypothetical protein	NA	NA	NA	NA
AUS13510.1\|3162431_3164873_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	5.7e-23	39.1
AUS13511.1\|3164890_3165217_+\|portal	phage portal protein	NA	NA	NA	NA
AUS13512.1\|3165213_3165378_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.0e-16	69.8
AUS13513.1\|3165422_3166262_+\|portal	phage portal protein	NA	NA	NA	NA
AUS13514.1\|3166314_3166584_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
AUS13515.1\|3166596_3166860_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
AUS13516.1\|3166872_3167766_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	8.9e-83	69.2
AUS13517.1\|3168026_3168197_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
AUS13518.1\|3168196_3168943_-	stage II sporulation protein SA	NA	NA	NA	NA
AUS13519.1\|3169052_3170054_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AUS13520.1\|3170066_3170684_-	DUF47 domain-containing protein	NA	NA	NA	NA
AUS13521.1\|3170960_3172277_-	L-methionine/branched-chain amino acid transporter	NA	NA	NA	NA
AUS13522.1\|3172664_3173615_+	ring-cleaving dioxygenase	NA	NA	NA	NA
AUS13523.1\|3173852_3176003_+	mannosyltransferase	NA	NA	NA	NA
AUS13524.1\|3176014_3176986_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
AUS13525.1\|3177506_3178877_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	3.8e-24	33.3

DBSCAN-SWA_8

3610347 : 3616905

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS13939.1\|3610347_3610740_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	1.1e-29	58.3
AUS13940.1\|3610699_3612802_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	87.0
AUS13941.1\|3612819_3613809_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	83.8
AUS13942.1\|3613857_3614478_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.0e-45	47.9
AUS13943.1\|3614541_3615309_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.6e-51	49.1
AUS13944.1\|3615936_3616905_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_9

3819915 : 3822507

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS14093.1\|3819915_3820272_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	4.2e-52	87.4
AUS14094.1\|3820600_3820912_-	hypothetical protein	NA	NA	NA	NA
AUS14095.1\|3820928_3821057_-	hypothetical protein	O64090	Bacillus_phage	8.6e-16	88.4
AUS14096.1\|3821066_3821279_-	hypothetical protein	O64089	Bacillus_phage	1.9e-23	80.3
AUS14097.1\|3821282_3821534_-	hypothetical protein	A0A1P8CWV6	Bacillus_phage	3.5e-37	98.8
AUS14653.1\|3821599_3821779_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	5.8e-26	96.4
AUS14098.1\|3821890_3822121_+	hypothetical protein	NA	NA	NA	NA
AUS14654.1\|3822129_3822507_-	hypothetical protein	O64087	Bacillus_phage	3.0e-40	74.8

DBSCAN-SWA_10

3830804 : 3837390

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS14107.1\|3830804_3830957_+	hypothetical protein	A0A1P8CWZ1	Bacillus_phage	1.2e-19	94.0
AUS14108.1\|3831395_3831575_-	hypothetical protein	NA	NA	NA	NA
AUS14109.1\|3831694_3832069_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	1.3e-27	50.4
AUS14110.1\|3832853_3832976_+	hypothetical protein	A0A1P8CWN5	Bacillus_phage	6.1e-11	89.7
AUS14111.1\|3833156_3834272_+	aspartate phosphatase	D6R410	Bacillus_phage	8.8e-96	49.2
AUS14112.1\|3834268_3834391_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
AUS14113.1\|3835683_3836016_-	YolD-like family protein	A0A1P8CWP2	Bacillus_phage	5.0e-55	98.2
AUS14114.1\|3836182_3836518_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	6.1e-53	97.3
AUS14115.1\|3836560_3836917_-	hypothetical protein	O64028	Bacillus_phage	3.6e-59	96.6
AUS14116.1\|3836922_3837390_-	DUF4879 domain-containing protein	O64027	Bacillus_phage	5.7e-81	98.7

DBSCAN-SWA_11

4053116 : 4061011

Staphylococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS14346.1\|4053116_4054265_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	5.0e-22	34.4
AUS14347.1\|4054387_4054927_-	DUF3907 domain-containing protein	NA	NA	NA	NA
AUS14348.1\|4054981_4055575_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-14	35.4
AUS14665.1\|4055564_4056320_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.9e-09	29.2
AUS14349.1\|4056533_4057058_+	DUF309 domain-containing protein	NA	NA	NA	NA
AUS14350.1\|4057071_4057446_-	N-acetyltransferase	NA	NA	NA	NA
AUS14351.1\|4057559_4058024_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AUS14352.1\|4058056_4059253_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.4e-115	55.2
AUS14353.1\|4059267_4059915_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.4e-42	45.9
AUS14354.1\|4059925_4061011_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.5e-55	35.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage