CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025500	Lactococcus lactis subsp. lactis strain G50 chromosome, complete genome	1 crisprs	cas3,DEDDh,csa3,DinG	1	2	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025500_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025500_2

1861776-1861870

Orphan

Consensus_repeat	Method
TTTATTACTGACAGACTTGTCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025500_2

>merge|CP025500|2|1861776-1861870|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGCTTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCGCTTTTTACTGACAGACTTGTCAGC

>CP025500|2|1|1861776-1861870|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGC	TTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCG
CTTTTTACTGACAGACTTGTCAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP025500.1\|AUS70212.1\|1857960_1858323_+\|hypothetical-protein	unknown	unknown	unknown
CP025500.1\|AUS70221.1\|1866602_1867928_-\|undecaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
CP025500.1\|AUS70215.1\|1859356_1860202_+\|2-nitropropane-dioxygenase	unknown	unknown	gnl\|CDD\|132195
CP025500.1\|AUS70717.1\|1862562_1863045_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
CP025500.1\|AUS70211.1\|1856827_1857976_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|273881
CP025500.1\|AUS70214.1\|1858587_1859334_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|187594
CP025500.1\|AUS70219.1\|1864263_1865520_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
CP025500.1\|AUS70222.1\|1867930_1868632_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|227199
CP025500.1\|AUS70207.1\|1853583_1853889_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226801
CP025500.1\|AUS70213.1\|1858297_1858591_+\|hypothetical-protein	unknown	unknown	unknown
CP025500.1\|AUS70224.1\|1869495_1870182_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP025500.1\|AUS70216.1\|1860342_1861755_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
CP025500.1\|AUS70217.1\|1861988_1862447_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
CP025500.1\|AUS70225.1\|1870329_1871238_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224513
CP025500.1\|AUS70220.1\|1865657_1866428_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
CP025500.1\|AUS70208.1\|1853905_1854877_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|237010
CP025500.1\|AUS70210.1\|1855596_1856838_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341288
CP025500.1\|AUS70223.1\|1868761_1869496_-\|glutamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
CP025500.1\|AUS70209.1\|1854882_1855452_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
CP025500.1\|AUS70218.1\|1863046_1864264_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034

Protein	Function_ID	Function_description	E-value
CP025500.1\|AUS70221.1\|1866602_1867928_-\|undecaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	1.28127e-85
CP025500.1\|AUS70215.1\|1859356_1860202_+\|2-nitropropane-dioxygenase	gnl\|CDD\|132195	TIGR03151, enACPred_II, putative enoyl-[acyl-carrier-protein] reductase II. This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.	4.10072e-85
CP025500.1\|AUS70717.1\|1862562_1863045_-\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	3.28577e-22
CP025500.1\|AUS70211.1\|1856827_1857976_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|273881	TIGR01930, 3-ketoacyl-CoA_thiolase, acetyl-CoA acetyltransferases. This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other].	6.69236e-158
CP025500.1\|AUS70214.1\|1858587_1859334_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|187594	cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs. This subgroup includes the Escherichai coli K12 BKR, FabG. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet) NAD(P)(H) binding region and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H) binding pattern: TGxxxGxG in classical SDRs. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P) binding motif and an altered active site motif (YXXXN). Fungal type type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P) binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr-151 and Lys-155, and well as Asn-111 (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.27642e-71
CP025500.1\|AUS70219.1\|1864263_1865520_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	1.83189e-132
CP025500.1\|AUS70222.1\|1867930_1868632_-\|adaptor-protein-MecA	gnl\|CDD\|227199	COG4862, MecA, Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion].	3.81196e-86
CP025500.1\|AUS70207.1\|1853583_1853889_-\|hypothetical-protein	gnl\|CDD\|226801	COG4357, COG4357, Zinc finger domain containing protein (CHY type) [Function unknown].	3.59649e-28
CP025500.1\|AUS70224.1\|1869495_1870182_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.09368e-76
CP025500.1\|AUS70216.1\|1860342_1861755_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
CP025500.1\|AUS70217.1\|1861988_1862447_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	9.34852e-67
CP025500.1\|AUS70225.1\|1870329_1871238_-\|transcriptional-regulator	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	1.84123e-70
CP025500.1\|AUS70220.1\|1865657_1866428_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.57723e-148
CP025500.1\|AUS70208.1\|1853905_1854877_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|237010	PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA.	2.73022e-71
CP025500.1\|AUS70210.1\|1855596_1856838_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341288	cd17633, AFD_YhfT-like, fatty acid-CoA ligase VraA. This family of acyl-CoA ligases includes Bacillus subtilis YhfT, as well as long-chain fatty acid-CoA ligase VraA, all of which are as yet to be characterized. These proteins belong to the adenylate-forming enzymes which catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain	1.12143e-66
CP025500.1\|AUS70223.1\|1868761_1869496_-\|glutamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.33413e-157
CP025500.1\|AUS70209.1\|1854882_1855452_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	1.40544e-46
CP025500.1\|AUS70218.1\|1863046_1864264_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>CP025500.1|AUS70216.1|1860342_1861755_-|Fe-S-cluster-assembly-protein-SufB
MTENSTQEVVKDLEEYKFGFHDNAELEFTTGLGLTEEVIREISETKNEPEWMLEFRLKSFEAFKKLDMPKWGPDLSGIDFNDIVYYQKPSAKAARSWEDVPQEIKDTFEKIGIPEAERSYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSGLRDYPEIFKKYFSKLVPPTDNKLAALNSAVWSGGSFVYVPKGVKCEIPIQAYFRINNEKSGQFERTLIIVEEGASIQYVEGCTAPTYSASSLHAAVVEIFVEEGGYMRYSTIQNWSDNVYNLVTKRAAAEKNATVEWIDGNLGSKVSMKYPAVHLNGPGARGTMLSIAFAGANQNQDTGAKMIHNAPNTSSSIISKSIAKNGGAVNYRGQVTFGKNSKKSASHIECDTILMDDLSKSDTVPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLTEKEATDMIVMGFIEPFTKELPMEYAVELNRLISYSMEGSIG
>CP025500.1|AUS70215.1|1859356_1860202_+|2-nitropropane-dioxygenase
MTWYHELGIKYPLFQGGMAWASNAELVAAVSNNGALGIIGSGGRTANELRRMIRKTKTLTSQPFGVNLMLLDKNIKQLLEVICEEKVSVVTTGAGSPKEIIDTIIANNIKLFPVVPNKEIALKMLKLPISGIIVEGNEAGGHVGSQNLASLLKEIAPICALPLIAAGGIYDLHTASLANILGANGVQVGTAFLLAKECQISPIYQELICKSEENGTSLISDENGHLTRLLNISSEHTSNKSLKAAVETGDLINGAFMAGSSSAYLEKIEPVETIIQRIMKK
>CP025500.1|AUS70214.1|1858587_1859334_+|3-oxoacyl-ACP-reductase
MNKRTILITGATRGIGWAIAQKAAQANHKVILTGRDPLSLKSRAEELQKKFPKTEIQAIPLDVANRSSVANAAKLIKDIDILINNAGITADSTFKKMRPEIWDDVISVNLTGVFNSTHALLDKINQGGQIITLTSKSALFGNFGQANYAASKAGIIAFTKTLAKELKKSMIRVNSVSPAAVTDMTLPVLKSLKETYGQNIPDEWKMGSSSDVANFIINDLIESEMTGKIFSVNSSEIGYWQEPTFHKL
>CP025500.1|AUS70213.1|1858297_1858591_+|hypothetical-protein
MKLYKKINKADLIDYLQSVKDTNSLHYGKNPIIPGNFLLFILEEMYQEFYSVPLSYLKVNFCSPAYLNERFCFIFNQNTFQITDRNQTLILRGEWKQ
>CP025500.1|AUS70212.1|1857960_1858323_+|hypothetical-protein
MVSKMILIAQKSLPRHFKLEGQKNFLSLLPQLWQELEGIPYSLKNGKNWLLSEEIIRYPSSNYSFDKLKLYLLSEYITRHSKKYIINLSLEITSNTKLLAKINLSLLSEDSWNEIIQKNQ
>CP025500.1|AUS70211.1|1856827_1857976_+|acetyl-CoA-C-acyltransferase
MSFKNPVGIIAANRLTIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNVTNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVESTSQANIVLDSESYQPINRFKMAPEPYEDFDMGTLADMTALKYNIPRSVQDLYALNSHKKATQAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPINDGASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIELNEAFASQAILFQNYFKLDDIKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGIATLCVAGGMGISVLIGNHWYQK
>CP025500.1|AUS70210.1|1855596_1856838_+|long-chain-fatty-acid--CoA-ligase
MEKNKFNFSKLTALFTDYPALKIDETSYSYQQINDLIQKKLTDYSHSSKTVITLINDSPLNFIIDFLAIIESGNYPLVVDKSFKKRSFEFGLIPEDTLFLASTSGTTGPPKIYYRNWESWKMGFEVCDDLFHLSNSQALATTSPLTTSLGLHTLMCALYLGKTFLAITNPSQFINIKESYVLFTVPTYLLNNLNELFALTSPEIIFLGGGTLSPKAINKVRKKLPQTQMIEFYGSSETSFISWQAVTDGKKTASVGKLFPYVELTLGPKYRLTVKSPYLFSGYLNQPYPQSWTTDDLGTLKNNQLYLFGRRSDIIEHGANKIFPEEIERMAKDLCEDCIAFGVFDERYSQKIALLLLNPIEKEKLIKILAQRLPKYKLPQIYLETPTLNFTKNQKISRKDLEKEYFRGVYHEL
>CP025500.1|AUS70209.1|1854882_1855452_-|biotin-transporter-BioY
MTKNQKVKTLTYSAFMTTFIIILGFLPGIPIGFIPVPIILQNMGIMMAGGLLGPKYGTISVGAFLTLALIGLPVLTGGNGGAASFLGPSGGYRMAWLFTPFLIGFFLKKLQITASKNWIGELIIVLVFGVIFVDLVGAIWLSIQSNIPLITSLISNLVFIPGDCIKAILTVLIVRRLRKEGGFEMYFRK
>CP025500.1|AUS70208.1|1853905_1854877_-|biotin--[acetyl-CoA-carboxylase]-ligase
MRTTKQFVLLKLLQQKGNWVSGDELAEELKLSRESIWKAINTLKRKGNQIESRKNLGYKYVGNDSLDEDTINFYSGMKFEDKIFVFDEVTSTQEFAKQYLSSHEVKQPFIFVANNQTEGHGRRGRNFYSPSDTGLYFSLILPNPSHDILKIGLLTTSTAVAVVKVLEQFYKDKNFQLKWVNDIYLGTYKVGGIITEAALDLETSSAGNFIMGIGLNLSTKDFPADLSEKAQGINPEFKIDRNQLLAEMAKEVINNFANYRKPDLIDEYRKRSLLFGKNVTLKLGTKAVNGQVEGISDDGSLILKAKSGEIQTFKSGEVVKVDW
>CP025500.1|AUS70207.1|1853583_1853889_-|hypothetical-protein
MREKIWGKVIDEEGRCTHYHQENDIVALKCSDCEKYFSCYHCHDELENHLFRATDKEDFPVLCGHCGTKLNFNDYSRGECIKCSSAFNPNCHRHWQVYFNE
>CP025500.1|AUS70217.1|1861988_1862447_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSKLDNLYRAVILDHSSNPRHAGELQTGCMVDLNNPTCGDVIRLTVEFENDVISNIAFSGHGCTISTASASMMTVAVLGKTKEEAKELATIFSAMVTGETDERQEKLGDAQFLAGVSKFPARVKCSTLAWNALKKAIDVGEAQETVIHGE
>CP025500.1|AUS70717.1|1862562_1863045_-|hypothetical-protein
MLNWVASLPLWLATTFLFVVVFFRAQCTFWLGKLSYHGILKTKWGKKLEKNSETSAGILAIQKMGWPIIPLSFLTVGFQTAVQFGAGLTNWSWYKYTLAAIPGYLAWGFIYASGGLSLFRSLVQGSIGLLILFIIIILAVVIAANLVLRYIRKNGIKTDD
>CP025500.1|AUS70218.1|1863046_1864264_-|cysteine-desulfurase
MLEGIKKDFPVLNQIVNDEPLVYLDNAATTQKPLKVLAAIKDYYENDNANVHRGVHTLAERATEKYEAAREKVRQFINAKSTKEVLFTRGTTTSINWVAQFAGQILKTGDEIVISIMEHHSNIVPWQEVAKKTGAILKFVYLKDGQLDMDDLRKKITNQTKFVSIAHVSNVLGTINPVEEITKIAHEHGAYMVVDGAQSTPHMAIDLQKMDVDFFAFSGHKMMGPTGIGVLYGKEELLNQFEPVEFGGEMIDFVYESHSTWTELPWKFEAGTPNIAGAIALGAAIDYIQELGIDQIHQHEIELIDYLMPKLQEIEGLKIYGPKDNVKRGGLIAFNIEGLHPHDVATALDMEGVAVRAGHHCAQPLLNYLETPATARASFYLYNTKADCDKLVEALKKTKEFFNLD
>CP025500.1|AUS70219.1|1864263_1865520_-|Fe-S-cluster-assembly-protein-SufD
MNQEILNFSQMHAEPAWLSDLRQKAALEFENLELPNIERVKINRWGLDDLTISENEEIGSVPTFTEIPNHPLLVQVGSQTVMEQMTPNLAEQGVIFTDFNSALTEIPELLEENFGSVVPFNESRLTAANTATFNSGLVLYVPDGVEVLEPIESILMQEGSSEVPFNKRILIIVGKNAKVDYLERLETSGEQSSKVKANIVVEVIAKAGAQVKFAAIDRLGENVTASVVRRGLIGDNATVDWSVGVMNDGNVVADFDSDLKGNGSHSQIKVVGISTGHQTQGIDTRVTNFGLNSVGHILQNGVILDKGTLTFNAIGHIIKGAKNADAQQSSHVLMLSDKGRGDANPILLIDENEVTAGHAASVGQVDEEDLFYLQSRGLDEETAKRLVIRGFLGSVVSEIPVKSVQAEFIETIERKLGM
>CP025500.1|AUS70220.1|1865657_1866428_-|Fe-S-cluster-assembly-ATPase-SufC
MATLEIKNLHVAIEDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYSVTQGEVLFDGQNVLEMSVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKRAEDDKVSVMEFIKKLDKNMEVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDIDALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETEGYVNIAEELGLEYKEEV
>CP025500.1|AUS70221.1|1866602_1867928_-|undecaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MVDTLKEIPFALKFLIVIIITFGISVILTPIMTFVSKAIGAVDKPNERRVNKKPMPSAGGLVIFIAFAIATLFILPHIVHNQPPIHSQPPVHGASHQPIQLVSYFSYIWPFIVGAGIVVLTGLIDDIKEISPKMKLLGLTVAASFIWFFTNARFDNLKIPFGGPLLIFPAWLSFIFTVFWILAITNAINLIDGLDGLASGVSIISLTTMGIVSYFFLPSPNVFLPITIFIMVAAIMGFFPYNYHPAIIYLGDTGALFLGFIISVASLQGLKNATAVAVLTPLLILGVPITDTIMAMVRRKLNRQSIATADKRHLHHRLMALGFTHRGAVLVIYGIASIFAFISILLQFSSRIGGILLVIACLFGLEIFIELVGILGENRQPVLKALKFVGNSSYRDKVLHSDEDTDENEEDIENHSMIDEEIDEPTQEFPIQNYRRSRNKK
>CP025500.1|AUS70222.1|1867930_1868632_-|adaptor-protein-MecA
MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQGVHMIVHEEAMLGEGGEIPDDPEEFEELMTGFYNKLNEIGADMARERGITDFKPGLGLPGTKKDEAEQEPDFIYYSIRYEDIMSVLTGIKNVKFADEESEFYRYDGNFYLVVLDNQKEKGKMHVESTRSRMMEYGEATKMSREFLQEYGECLIATRALDVLRKI
>CP025500.1|AUS70223.1|1868761_1869496_-|glutamine-ABC-transporter-ATP-binding-protein
MNEYLIEIKNLHKYFGKNEVLKGLDIQIKKGEVVVMIGPSGSGKSTFLRTMNLLEKPTDGQVYFEGVNIADKSVDVFKHREKMGMVFQQFNLFPNMTVLENLCLAPVKTGKMTKEEAKKTAENLLQRVGLSDKAEAYPQALSGGQQQRVAIARALAMNPDVMLFDEPTSALDPEMVGEVLAVMQELAKEGMTMVVVTHEMGFAKTVADRVLFMADGTIVEQGKPAQVFGSPKEKRTQDFLAKVL
>CP025500.1|AUS70224.1|1869495_1870182_-|amino-acid-ABC-transporter-permease
MNFDFLPKYLPYFNDGMIVTILISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGLMGSLSLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGIRPRQAMATVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEVFNGAQTVANLTYQTISPMLFVALYYFVVTFVVSRLLVLFEKKLGKGYAK
>CP025500.1|AUS70225.1|1870329_1871238_-|transcriptional-regulator
MTYYLLANPNSGAGKGARTLETLIPYLEKNNYEYRLFKTKAAGEEGALVRQILDLKNSDDHLVIIGGDGTISLVINELPEEEAFSYIPSGSGNDFARSLKLKLDPIESFEAARRGINHEIFIMNYQSKGLSGYALNNIGIGLDATIVKSANEGKLKQVLNKLKLGSFSYILTALHVLITKKPFPALIEVENQEISLENAFLMTFTKHPYFGGGVKISPEATNENADIHLVEYNKHHLLRTFSLIPSVLRGMHLKHPLFLHRVSPQFSVELAESQPVQIDGEIHELVAADRLSISTERRMIIY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP025500_1	1.1\|1208377\|18\|CP025500\|CRT	1208377-1208394	18	CP025500.1	1233251-1233268	2	0.889

1. spacer 1.1|1208377|18|CP025500|CRT matches to position: 1233251-1233268, mismatch: 2, identity: 0.889

taataccgactctgatac	CRISPR spacer
taataccgaccctaatac	Protospacer
**********.**.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43814-43843	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43826-43855	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43838-43867	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43850-43879	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43862-43891	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43874-43903	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43886-43915	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43898-43927	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43910-43939	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43922-43951	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43934-43963	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43946-43975	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43958-43987	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43970-43999	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43982-44011	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	43994-44023	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44006-44035	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44018-44047	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44030-44059	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44042-44071	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44054-44083	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44066-44095	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44078-44107	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44090-44119	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44102-44131	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44114-44143	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44126-44155	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44138-44167	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44150-44179	2	0.933
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	NC_025249	Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence	44162-44191	2	0.933
CP025500_1	1.2\|1208413\|30\|CP025500\|CRT	1208413-1208442	30	NZ_KM007160	Lactococcus garvieae strain IPLA 31405 plasmid pLG42, complete sequence	29259-29288	5	0.833
CP025500_1	1.2\|1208413\|30\|CP025500\|CRT	1208413-1208442	30	NZ_CP042421	Leuconostoc lactis strain CBA3622 plasmid unnamed1, complete sequence	29447-29476	5	0.833
CP025500_1	1.2\|1208413\|30\|CP025500\|CRT	1208413-1208442	30	NZ_CP042421	Leuconostoc lactis strain CBA3622 plasmid unnamed1, complete sequence	29351-29380	5	0.833
CP025500_1	1.2\|1208413\|30\|CP025500\|CRT	1208413-1208442	30	NZ_LN774771	Lactococcus piscium MKFS47 plasmid III, complete sequence	45748-45777	5	0.833
CP025500_1	1.2\|1208413\|30\|CP025500\|CRT	1208413-1208442	30	NZ_LN774771	Lactococcus piscium MKFS47 plasmid III, complete sequence	45856-45885	5	0.833
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	MN693027	Marine virus AFVG_117M71, complete genome	3868-3897	7	0.767
CP025500_1	1.4\|1208497\|30\|CP025500\|CRT	1208497-1208526	30	MN693700	Marine virus AFVG_250M620, complete genome	3884-3913	7	0.767

1. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

2. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

3. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

4. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

5. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

6. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

7. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

8. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

9. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

10. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

11. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

12. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

13. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

14. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

15. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

16. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

17. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

18. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

19. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

20. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

21. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

22. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

23. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

24. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

25. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

26. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

27. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

28. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

29. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
caatactgaccccaatactgaccccaatac	Protospacer
***********.************.*****

30. spacer 1.4|1208497|30|CP025500|CRT matches to NC_025249 (Lactococcus lactis subsp. cremoris MG1363 plasmid pFI430, complete sequence) position: , mismatch: 2, identity: 0.933

caatactgacctcaatactgaccctaatac	CRISPR spacer
cgatactgacctcaatactgaccccaatac	Protospacer
*.**********************.*****

31. spacer 1.2|1208413|30|CP025500|CRT matches to NZ_KM007160 (Lactococcus garvieae strain IPLA 31405 plasmid pLG42, complete sequence) position: , mismatch: 5, identity: 0.833

caatactgaccctaataccgactctgatac	CRISPR spacer
taatactgaccctaataccgacctcaatac	Protospacer
.*********************....****

32. spacer 1.2|1208413|30|CP025500|CRT matches to NZ_CP042421 (Leuconostoc lactis strain CBA3622 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

caatactgaccctaataccgactctgatac	CRISPR spacer
taatactgaccctaataccgacctcaatac	Protospacer
.*********************....****

33. spacer 1.2|1208413|30|CP025500|CRT matches to NZ_CP042421 (Leuconostoc lactis strain CBA3622 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

caatactgaccctaataccgactctgatac	CRISPR spacer
caataccgaccctaataccgacctcaatac	Protospacer
******.***************....****

34. spacer 1.2|1208413|30|CP025500|CRT matches to NZ_LN774771 (Lactococcus piscium MKFS47 plasmid III, complete sequence) position: , mismatch: 5, identity: 0.833

caatactgaccctaataccgactctgatac	CRISPR spacer
taatactgaccctaataccgacctcaatac	Protospacer
.*********************....****

35. spacer 1.2|1208413|30|CP025500|CRT matches to NZ_LN774771 (Lactococcus piscium MKFS47 plasmid III, complete sequence) position: , mismatch: 5, identity: 0.833

caatactgaccctaataccgactctgatac	CRISPR spacer
caataccgaccctaataccgacctcaatac	Protospacer
******.***************....****

36. spacer 1.4|1208497|30|CP025500|CRT matches to MN693027 (Marine virus AFVG_117M71, complete genome) position: , mismatch: 7, identity: 0.767

caatactgacctcaatactgaccctaatac	CRISPR spacer
cgataatgacctcaatgctgaccctgaact	Protospacer
*.*** **********.********.*  .

37. spacer 1.4|1208497|30|CP025500|CRT matches to MN693700 (Marine virus AFVG_250M620, complete genome) position: , mismatch: 7, identity: 0.767

caatactgacctcaatactgaccctaatac	CRISPR spacer
cgataatgacctcaatgctgaccctgaact	Protospacer
*.*** **********.********.*  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

399902 : 412031

Streptococcus_phage(40.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS68911.1\|399902_400220_+	thioredoxin	A0A0K2FIM3	Achromobacter_phage	4.5e-05	30.4
AUS68912.1\|400305_400932_+	DUF4479 domain-containing protein	NA	NA	NA	NA
AUS68913.1\|401094_402435_+	NADH oxidase	NA	NA	NA	NA
AUS68914.1\|402523_402913_+	single-stranded DNA-binding protein	A0A0K0MWE1	Streptococcus_phage	1.4e-24	45.0
AUS68915.1\|403032_403317_+	co-chaperone GroES	A0A221S386	uncultured_virus	3.1e-13	44.1
AUS68916.1\|403404_405033_+	molecular chaperone GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
AUS68917.1\|405077_405890_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	38.1
AUS68918.1\|406060_407503_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.4e-32	33.0
AUS68919.1\|407495_408197_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.2e-42	39.7
AUS68920.1\|408374_409010_+	dTMP kinase	M1PSC7	Streptococcus_phage	7.0e-74	65.0
AUS68921.1\|409142_410003_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.0e-67	45.5
AUS68922.1\|410054_410837_+	Signal peptidase	NA	NA	NA	NA
AUS68923.1\|410829_411156_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
AUS68924.1\|411155_412031_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.6e-99	65.4

DBSCAN-SWA_2

996373 : 1019827

Staphylococcus_phage(21.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS69438.1\|996373_997066_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.7e-31	34.4
AUS69439.1\|997058_997994_+	ABC transporter permease	NA	NA	NA	NA
AUS69440.1\|998096_999074_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.9e-118	66.0
AUS69441.1\|999423_1001592_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	8.6e-257	61.0
AUS69442.1\|1001727_1002150_-	protein NrdI	A0A142F1R4	Bacillus_phage	2.3e-12	37.3
AUS69443.1\|1002151_1002370_-	NrdH-redoxin	C3U2K9	Lactococcus_phage	7.6e-12	47.6
AUS69444.1\|1002543_1003185_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AUS69445.1\|1003459_1005394_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.1e-125	43.5
AUS69446.1\|1005598_1006138_+	cysteine hydrolase	NA	NA	NA	NA
AUS69447.1\|1006130_1006964_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	3.1e-21	39.4
AUS69448.1\|1006960_1007410_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUS69449.1\|1007684_1010159_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.6e-97	32.2
AUS69450.1\|1010184_1011090_-	magnesium transporter CorA family protein	NA	NA	NA	NA
AUS69451.1\|1011558_1012647_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.4e-50	38.8
AUS69452.1\|1012646_1013297_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.2e-42	44.1
AUS69453.1\|1013305_1014502_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-111	51.5
AUS69454.1\|1014529_1014994_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.8e-39	53.7
AUS69455.1\|1015096_1015549_+	lipoprotein signal peptidase	NA	NA	NA	NA
AUS69456.1\|1015609_1016515_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-11	28.2
AUS69457.1\|1016662_1017106_+	hypothetical protein	NA	NA	NA	NA
AUS69458.1\|1017245_1018868_+	hypothetical protein	NA	NA	NA	NA
AUS69459.1\|1018870_1019827_+	glycosyltransferase	I1TED8	Salmonella_phage	4.0e-49	37.5

DBSCAN-SWA_3

1504133 : 1514435

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS69876.1\|1504133_1505690_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	4.0e-70	45.6
AUS69877.1\|1505865_1506408_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.8e-09	29.9
AUS69878.1\|1506544_1507582_-	epimerase	NA	NA	NA	NA
AUS69879.1\|1507712_1508243_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUS69880.1\|1508293_1509883_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.7e-10	22.4
AUS69881.1\|1510049_1510598_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.0e-18	30.6
AUS69882.1\|1510626_1511643_-	phosphoribosylformylglycinamidine cyclo-ligase	M4QRQ6	Synechococcus_phage	6.4e-61	41.8
AUS69883.1\|1511831_1514435_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.2e-124	32.7

DBSCAN-SWA_4

1590922 : 1609849

Lactococcus_phage(70.0%)

integrase,holin

attL 1582320:1582334|attR 1606996:1607010

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1582320:1582334	attL	NA	NA	NA	NA
AUS69954.1\|1590922_1591702_-\|holin	phage holin	Q9AZW7	Lactococcus_phage	2.5e-121	93.1
AUS69955.1\|1591701_1591977_-	Holin	A0A182BQ79	Lactococcus_phage	1.6e-14	56.9
AUS69956.1\|1591989_1592211_-\|holin	holin	A0A191KBQ1	Streptococcus_virus	1.5e-20	66.7
AUS69957.1\|1592252_1592645_-	hypothetical protein	Q1RND0	Lactococcus_phage	2.3e-11	44.3
AUS69958.1\|1593256_1593988_-	hypothetical protein	Q6SEC2	Lactobacillus_prophage	4.8e-26	41.0
AUS69959.1\|1594268_1594658_-	hypothetical protein	A5GYP6	Lactococcus_phage	8.1e-65	93.0
AUS69960.1\|1594751_1595045_+	DUF3892 domain-containing protein	NA	NA	NA	NA
AUS69961.1\|1595359_1595548_-	hypothetical protein	NA	NA	NA	NA
AUS69962.1\|1595562_1595805_-	hypothetical protein	A5GZ49	Lactococcus_phage	2.5e-32	80.0
AUS69963.1\|1597122_1597923_-	recombinase RecT	Q9AZQ0	Lactococcus_phage	1.9e-76	60.5
AUS69964.1\|1597915_1598752_-	hypothetical protein	A0A1P8BKZ1	Lactococcus_phage	4.0e-93	72.8
AUS69965.1\|1598854_1599091_-	hypothetical protein	A0A1P8BMJ7	Lactococcus_phage	2.8e-36	94.9
AUS69966.1\|1599185_1599410_+	hypothetical protein	NA	NA	NA	NA
AUS69967.1\|1599640_1599979_-	hypothetical protein	A0A1B1IMQ1	Lactococcus_phage	1.9e-57	96.4
AUS69968.1\|1599992_1600793_-	phage antirepressor	Q38330	Lactococcus_phage	1.5e-94	70.3
AUS69969.1\|1600810_1601059_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUS69970.1\|1601213_1601717_+	hypothetical protein	NA	NA	NA	NA
AUS69971.1\|1602265_1602751_+	XRE family transcriptional regulator	Q9G0E8	Lactococcus_phage	3.3e-31	55.8
AUS69972.1\|1602761_1603349_+	hypothetical protein	Q9AZW4	Lactococcus_phage	1.8e-92	85.6
AUS69973.1\|1603363_1603564_+	hypothetical protein	Q9T1Z0	Lactococcus_phage	7.1e-25	93.5
AUS69974.1\|1603619_1603958_+	hypothetical protein	S5MNN8	Brevibacillus_phage	3.0e-15	66.7
AUS69975.1\|1604058_1604934_+	hypothetical protein	NA	NA	NA	NA
AUS69976.1\|1605063_1606203_+\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	6.6e-208	96.6
AUS69977.1\|1606305_1607379_-	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	2.0e-60	35.3
1606996:1607010	attR	NA	NA	NA	NA
AUS69978.1\|1607441_1608374_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	2.8e-23	30.5
AUS69979.1\|1608556_1609849_-	uracil permease	Q9KX94	Enterobacteria_phage	1.6e-61	35.9

DBSCAN-SWA_5

1657598 : 1698060

Lactococcus_phage(84.09%)

capsid,protease,integrase,head,tail,portal,terminase,holin

attL 1656137:1656152|attR 1702105:1702120

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1656137:1656152	attL	NA	NA	NA	NA
AUS70020.1\|1657598_1658003_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	7.4e-29	48.8
AUS70021.1\|1658108_1659290_-	hypothetical protein	A9YX16	Burkholderia_phage	1.6e-15	29.2
AUS70022.1\|1659369_1660149_-\|holin	phage holin	A0A1P8BKR7	Lactococcus_phage	3.4e-123	95.8
AUS70023.1\|1660148_1660424_-	Holin	A0A182BQ79	Lactococcus_phage	2.4e-15	59.7
AUS70024.1\|1660436_1660658_-\|holin	holin	A0A191KBQ1	Streptococcus_virus	4.5e-20	63.9
AUS70025.1\|1660675_1661911_-	hypothetical protein	Q1RNC2	Lactococcus_phage	3.5e-29	47.0
AUS70026.1\|1662044_1664483_-	hypothetical protein	A0A059NT86	Lactococcus_phage	0.0e+00	77.3
AUS70027.1\|1664493_1664859_-	hypothetical protein	A0A059NT91	Lactococcus_phage	2.3e-61	95.0
AUS70028.1\|1664870_1668890_-\|tail	phage tail protein	A0A059NT57	Lactococcus_phage	0.0e+00	70.5
AUS70029.1\|1668920_1669292_-	hypothetical protein	A0A172LN91	Lactococcus_phage	1.3e-43	72.4
AUS70030.1\|1669315_1669726_-	hypothetical protein	A0A182BQ86	Lactococcus_phage	7.0e-51	75.7
AUS70031.1\|1669801_1670041_-	hypothetical protein	A5GYM0	Lactococcus_phage	2.8e-07	60.3
AUS70032.1\|1670066_1670480_-\|tail	phage tail protein	A0A182BQ87	Lactococcus_phage	5.2e-62	83.1
AUS70033.1\|1670492_1670855_-	hypothetical protein	A0A182BQ88	Lactococcus_phage	7.5e-57	92.5
AUS70034.1\|1670854_1671403_-	hypothetical protein	A0A059NT55	Lactococcus_phage	1.1e-96	98.4
AUS70035.1\|1671386_1671734_-	hypothetical protein	A0A182BQ90	Lactococcus_phage	6.3e-45	82.5
AUS70036.1\|1671714_1672047_-	hypothetical protein	A0A059NT99	Lactococcus_phage	1.3e-55	100.0
AUS70037.1\|1672066_1673185_-\|capsid	major capsid protein	A0A182BQ73	Lactococcus_phage	1.5e-148	84.0
AUS70038.1\|1673196_1673823_-\|capsid	phage capsid protein	A0A059NT87	Lactococcus_phage	1.0e-72	92.8
AUS70039.1\|1673999_1674272_+	DUF3892 domain-containing protein	A0A059NT53	Lactococcus_phage	4.1e-39	98.9
AUS70040.1\|1674529_1675636_-\|head	phage head morphogenesis protein	A0A059NT80	Lactococcus_phage	5.7e-196	95.9
AUS70041.1\|1675780_1676068_-\|protease	ribosomal-processing cysteine protease Prp	A0A182BQ95	Lactococcus_phage	4.7e-46	94.7
AUS70042.1\|1676188_1677697_-\|portal	phage portal protein	A0A182BQ97	Lactococcus_phage	1.2e-244	97.8
AUS70043.1\|1677705_1678941_-\|terminase	PBSX family phage terminase large subunit	A0A182BQ98	Lactococcus_phage	2.6e-242	99.0
AUS70044.1\|1678930_1679443_-\|terminase	terminase small subunit	A0A182BQ99	Lactococcus_phage	9.3e-77	91.2
AUS70045.1\|1680651_1681074_-	hypothetical protein	A0A182BQA1	Lactococcus_phage	3.0e-57	98.6
AUS70046.1\|1681713_1681923_+	hypothetical protein	NA	NA	NA	NA
AUS70047.1\|1681973_1682195_-	hypothetical protein	A0A182BQA2	Lactococcus_phage	8.4e-35	93.2
AUS70048.1\|1682191_1682416_-	hypothetical protein	A0A1P8BMS6	Lactococcus_phage	5.6e-10	50.0
AUS70049.1\|1682563_1683232_+	GMP synthase	NA	NA	NA	NA
AUS70050.1\|1683271_1683682_-	hypothetical protein	A5GZ50	Lactococcus_phage	3.2e-72	97.0
AUS70051.1\|1683694_1683937_-	hypothetical protein	A5GZ49	Lactococcus_phage	1.7e-36	87.5
AUS70714.1\|1683929_1684775_-	prephenate dehydrogenase	A5GZ47	Lactococcus_phage	6.5e-67	65.6
AUS70052.1\|1685015_1686011_-	hypothetical protein	A0A1P8BLG1	Lactococcus_phage	1.8e-129	81.0
AUS70053.1\|1686012_1686750_-	phage recombination protein Bet	A0A1B1IMV3	Lactococcus_phage	1.6e-130	96.3
AUS70054.1\|1686873_1687089_-	hypothetical protein	Q38272	Lactococcus_phage	5.3e-34	98.6
AUS70055.1\|1687088_1687289_-	XRE family transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	1.5e-06	43.5
AUS70056.1\|1687437_1687638_+	hypothetical protein	NA	NA	NA	NA
AUS70057.1\|1687912_1688149_-	DNA-binding protein	A0A059NT59	Lactococcus_phage	4.3e-37	100.0
AUS70058.1\|1688161_1688965_-	DNA-binding protein	A0A1P8BLA9	Lactococcus_phage	1.0e-90	67.5
AUS70059.1\|1688980_1689229_-	XRE family transcriptional regulator	A0A097BYF3	Leuconostoc_phage	1.5e-11	55.7
AUS70060.1\|1689323_1690232_+	hypothetical protein	NA	NA	NA	NA
AUS70061.1\|1690213_1690411_-	hypothetical protein	NA	NA	NA	NA
AUS70062.1\|1690673_1691198_+	phage repressor protein	Q9AZW3	Lactococcus_phage	3.0e-30	50.6
AUS70063.1\|1691208_1691796_+	hypothetical protein	Q9AZW4	Lactococcus_phage	6.9e-92	83.0
AUS70064.1\|1691847_1692048_+	hypothetical protein	A0A1P8BM79	Lactococcus_phage	2.0e-27	93.8
AUS70065.1\|1692089_1693085_+	DUF3644 domain-containing protein	A0A0N9RUA4	Staphylococcus_phage	3.8e-90	51.1
AUS70066.1\|1693324_1694458_+\|integrase	site-specific integrase	A0A059NT56	Lactococcus_phage	6.0e-201	97.6
AUS70067.1\|1694651_1695626_-	D-ribose ABC transporter substrate-binding protein	NA	NA	NA	NA
AUS70068.1\|1695637_1696579_-	sugar ABC transporter permease	NA	NA	NA	NA
AUS70069.1\|1696581_1698060_-	D-xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-14	30.9
1702105:1702120	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1785336 : 1795195

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUS70143.1\|1785336_1786098_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-17	30.0
AUS70144.1\|1786263_1787073_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-10	26.5
AUS70145.1\|1787106_1788000_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AUS70146.1\|1787999_1788923_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AUS70147.1\|1789043_1789895_-	phosphate ABC transporter substrate-binding protein	E3SNT9	Prochlorococcus_phage	3.2e-05	27.5
AUS70148.1\|1790241_1791138_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	7.2e-08	32.4
AUS70149.1\|1791415_1791883_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	2.7e-43	56.6
AUS70150.1\|1791914_1792490_-	esterase	NA	NA	NA	NA
AUS70151.1\|1792576_1795195_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.2e-64	33.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage