CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP026086	Acinetobacter pittii strain WCHAP005069 plasmid pOXA58_005069, complete sequence	0 crisprs	NA	2
CP026089	Acinetobacter pittii strain WCHAP005069 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3	11
CP026087	Acinetobacter pittii strain WCHAP005069 plasmid p1_005069, complete sequence	0 crisprs	WYL	1
CP026088	Acinetobacter pittii strain WCHAP005069 plasmid p2_005069, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5142 : 70629

Escherichia_phage(29.41%)

integrase,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT32420.1\|5142_5847_-\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AUT32421.1\|6653_7514_+	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
AUT32422.1\|7526_8069_+	tunicamycin resistance protein	NA	NA	NA	NA
AUT32423.1\|8550_8742_-	hypothetical protein	NA	NA	NA	NA
AUT32424.1\|8747_8993_+	hypothetical protein	NA	NA	NA	NA
AUT32425.1\|9043_10180_+	DUF3883 domain-containing protein	NA	NA	NA	NA
AUT32426.1\|14594_15176_-	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	2.8e-53	57.5
AUT32427.1\|15525_15714_+	hypothetical protein	NA	NA	NA	NA
AUT32428.1\|15703_17329_+	SAM-dependent methyltransferase	A0A1J0F9H0	Only_Syngen_Nebraska_virus	2.1e-13	28.9
AUT32429.1\|17429_20423_-	adenine methyltransferase	A0A2R2ZGH5	Clostridioides_phage	2.0e-22	25.0
AUT32430.1\|20620_20878_-	tellurium resistance protein TerC	NA	NA	NA	NA
AUT32431.1\|20958_21399_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	2.4e-17	45.7
AUT32432.1\|21417_22122_-\|transposase	IS6 family transposase IS1006	A0A077SL39	Escherichia_phage	1.9e-120	85.8
AUT32433.1\|23046_23298_+	hypothetical protein	NA	NA	NA	NA
AUT32434.1\|23191_23494_-	phosphoglucosamine mutase	NA	NA	NA	NA
AUT32435.1\|23580_24396_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AUT32436.1\|24485_25575_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
AUT32437.1\|25772_26258_-	phenol hydroxylase	NA	NA	NA	NA
AUT32438.1\|26483_29369_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-190	39.9
AUT32439.1\|30199_31003_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AUT32440.1\|31002_31839_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AUT32441.1\|32243_33023_+	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	3.1e-31	35.5
AUT32442.1\|33334_34171_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AUT32443.1\|36478_37183_+\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AUT32444.1\|39704_40970_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AUT32445.1\|40969_41275_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUT32446.1\|42194_42452_-	hypothetical protein	NA	NA	NA	NA
AUT32447.1\|42801_43398_-	cell filamentation protein Fic	NA	NA	NA	NA
AUT32448.1\|43410_43578_-	DUF2559 domain-containing protein	NA	NA	NA	NA
AUT32449.1\|43893_44316_+	hypothetical protein	NA	NA	NA	NA
AUT32450.1\|44328_46668_+	hypothetical protein	NA	NA	NA	NA
AUT32451.1\|46672_49873_+\|integrase	integrase	NA	NA	NA	NA
AUT32452.1\|50200_50419_-	hypothetical protein	NA	NA	NA	NA
AUT32453.1\|50423_51719_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	5.3e-129	51.5
AUT32454.1\|51733_52360_-	LexA family transcriptional regulator	A0A2H4J538	uncultured_Caudovirales_phage	4.1e-26	41.6
AUT32455.1\|52471_53113_-	DUF159 family protein	A0A218MNF5	uncultured_virus	4.9e-51	52.8
AUT32456.1\|53352_54459_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	4.1e-29	26.2
AUT32457.1\|54917_56137_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.7e-76	51.9
AUT32458.1\|56302_57522_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.7e-76	51.9
AUT32459.1\|58430_59630_+	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	4.3e-40	29.3
AUT32460.1\|61302_61944_-	hypothetical protein	NA	NA	NA	NA
AUT32461.1\|61955_62402_-	hypothetical protein	NA	NA	NA	NA
AUT32462.1\|62636_63770_+	patatin	NA	NA	NA	NA
AUT32463.1\|63762_64947_+	hypothetical protein	NA	NA	NA	NA
AUT32464.1\|64943_65444_+	peptidase	NA	NA	NA	NA
AUT32465.1\|65440_67234_+	hypothetical protein	NA	NA	NA	NA
AUT32466.1\|67550_68036_+	hypothetical protein	NA	NA	NA	NA
AUT32511.1\|69180_69369_-	hypothetical protein	NA	NA	NA	NA
AUT32467.1\|69303_70629_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

95124 : 102548

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT32496.1\|95124_95418_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	2.6e-15	46.9
AUT32497.1\|95407_95653_-	type II toxin-antitoxin system antitoxin, RelB/DinJ family	A0A2H4JBG1	uncultured_Caudovirales_phage	1.9e-11	42.0
AUT32498.1\|95849_97199_-	chromate transporter	A0A219VHC2	Ochrobactrum_phage	2.8e-32	68.5
AUT32499.1\|97195_98122_-	chromate resistance protein	NA	NA	NA	NA
AUT32500.1\|98236_98803_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.1e-25	50.0
AUT32501.1\|99582_99834_-	hypothetical protein	NA	NA	NA	NA
AUT32502.1\|100276_100564_-	hypothetical protein	NA	NA	NA	NA
AUT32503.1\|100566_101205_-	chromosome partitioning protein ParA	Q2A085	Sodalis_phage	9.9e-44	45.5
AUT32504.1\|101609_102548_+	initiator RepB protein	A0A218MNI2	uncultured_virus	1.5e-43	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP026089

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026089_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026089_1

2068774-2068887

Orphan

Consensus_repeat	Method
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026089_1

>merge|CP026089|1|2068774-2068887|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

>CP026089|1|1|2068774-2068887|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAAC
CGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP026089.1\|AUT34347.1\|2060808_2062095_+\|alpha-ketoglutarate-permease	unknown	unknown	gnl\|CDD\|182433
CP026089.1\|AUT34357.1\|2071431_2072703_+\|Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
CP026089.1\|AUT34364.1\|2079616_2080579_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP026089.1\|AUT34356.1\|2070544_2071240_-\|Zn-dependent-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP026089.1\|AUT34352.1\|2065828_2066746_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP026089.1\|AUT34350.1\|2064415_2064811_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP026089.1\|AUT34353.1\|2066779_2067784_-\|homoserine-dehydrogenase	unknown	unknown	gnl\|CDD\|168683
CP026089.1\|AUT34351.1\|2064807_2065662_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP026089.1\|AUT34365.1\|2080941_2081928_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP026089.1\|AUT34360.1\|2074820_2075606_-\|diacetyl-reductase	unknown	unknown	gnl\|CDD\|187624
CP026089.1\|AUT34349.1\|2063711_2064320_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
CP026089.1\|AUT34348.1\|2062278_2063628_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|273350
CP026089.1\|AUT34354.1\|2067893_2068685_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP026089.1\|AUT34346.1\|2058087_2060292_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
CP026089.1\|AUT34361.1\|2075632_2077036_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP026089.1\|AUT34345.1\|2056614_2058033_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
CP026089.1\|AUT34359.1\|2073732_2074791_-\|butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP026089.1\|AUT34363.1\|2078583_2079603_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP026089.1\|AUT34362.1\|2077046_2078582_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP026089.1\|AUT34358.1\|2072772_2073684_+\|bestrophin	unknown	unknown	gnl\|CDD\|376448

Protein	Function_ID	Function_description	E-value
CP026089.1\|AUT34347.1\|2060808_2062095_+\|alpha-ketoglutarate-permease	gnl\|CDD\|182433	PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional.	6.94672e-167
CP026089.1\|AUT34357.1\|2071431_2072703_+\|Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.04762e-122
CP026089.1\|AUT34364.1\|2079616_2080579_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP026089.1\|AUT34356.1\|2070544_2071240_-\|Zn-dependent-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.56698e-86
CP026089.1\|AUT34352.1\|2065828_2066746_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	6.73638e-15
CP026089.1\|AUT34350.1\|2064415_2064811_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
CP026089.1\|AUT34353.1\|2066779_2067784_-\|homoserine-dehydrogenase	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	2.12235e-76
CP026089.1\|AUT34351.1\|2064807_2065662_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
CP026089.1\|AUT34365.1\|2080941_2081928_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP026089.1\|AUT34360.1\|2074820_2075606_-\|diacetyl-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.5012e-113
CP026089.1\|AUT34349.1\|2063711_2064320_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	1.57248e-84
CP026089.1\|AUT34348.1\|2062278_2063628_+\|chromate-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	7.57664e-60
CP026089.1\|AUT34354.1\|2067893_2068685_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	7.30352e-23
CP026089.1\|AUT34346.1\|2058087_2060292_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.33284e-104
CP026089.1\|AUT34361.1\|2075632_2077036_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP026089.1\|AUT34345.1\|2056614_2058033_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
CP026089.1\|AUT34359.1\|2073732_2074791_-\|butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP026089.1\|AUT34363.1\|2078583_2079603_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	7.15262e-167
CP026089.1\|AUT34362.1\|2077046_2078582_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	3.94652e-113
CP026089.1\|AUT34358.1\|2072772_2073684_+\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	2.35864e-81

>CP026089.1|AUT34354.1|2067893_2068685_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>CP026089.1|AUT34353.1|2066779_2067784_-|homoserine-dehydrogenase
MKRVNLAICGFGRIGQQIAELLLNRTTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLEQVQADVIIETGPSDYVTGGKGLFYLDYALTHSMNAIAVSKGALVVDGKKLVNLAPQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIEGVFTGTTNFILNDMLQHECAFAESLEKAQAKGIAEPDSSFEVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTADHIRDWKKENVIPRLVGFIHIKNQQIQTGVELRLVSANHPFAHLQGSNKCIRALTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>CP026089.1|AUT34352.1|2065828_2066746_+|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAAILGLIGIVLLFWHDLVNSQFNAQLLMGIGLCAVGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVILSLALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYVWALNAVFGILLILLGNYLMFSKLEIGKKLFNSQKNCEKQA
>CP026089.1|AUT34351.1|2064807_2065662_-|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>CP026089.1|AUT34350.1|2064415_2064811_+|transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>CP026089.1|AUT34349.1|2063711_2064320_-|FMN-dependent-NADH-azoreductase
MELLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEIAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>CP026089.1|AUT34348.1|2062278_2063628_+|chromate-transporter
MENEKSPLPESIIQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWFVAIAAFLAIFVLKLPFPLIVLSAGIAGYLTSKKYPELFSSAAGHKSSQKDYGSAFIDDDTPPPEHAKFHWPRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGFEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAAFITVGAFIALFRFNVNVLYVIFASALVGLAVTFFS
>CP026089.1|AUT34347.1|2060808_2062095_+|alpha-ketoglutarate-permease
MTYTQEEKRSRIRGIVGAASGNLVEWFDFYIYAVFAAYFTQALTAPDMDSTTKSIYVWGVFAASFFMRPIGSWVFGRIADRHGRKKSMVISICLMALSSFLFAALPTYDQVGLFAPFLLLVVRLLQGLSVGGEYGAVATYMSELGLKGQRGFYSSFQYVTLSGGQLLASLLGVILLTFLSEQQLHDGGWRIPFVIGGIAAILSLLARSRLEETLSHQDSERKESGSLRELFKKHWKTFLLVVGYTSAGSLTFYVETVYSKTYLTNLGMDGKTVGYIMTFALFVYMCAQPVFGAISDRIGRRSSMLAFSLLSAIFIYPVMVIGMRAYIDSPIIIALLLIFMMMLLSFYTSISGLVKAEMFPPHVRALGVGFSYAVGNALFGGSAPSVALQFKAAGIENTFFIYVIVMLIICFLCSLALPKKPDYLEHDH
>CP026089.1|AUT34346.1|2058087_2060292_-|TonB-dependent-siderophore-receptor
MHGMAGSYSMERRSINLHFMTCSKTALASSIALITSVVYANEAEVSQLPTITVNATQNNDALYTSKKVNLSGFQTDDLKKVPASITTITSERIEDQHAKTLTDVIKNDSSLGDGYAAIGYYPNFVARGFALDLGSSYLINGHTIRGEQNVALENKEQVEILKGISAIQSGMSTPGGVVNYVTKRPADVKNIAVDANSEGGYTLATDVGGFINDSFGYRINLAHESIHPNVHHANGKREFGSVALDWKINERSKLLFDIEAQHQSQRSVPGYQLLDGQEVPTNVDQDRLLGYQSWSKPVVNNSVNASLKYQYAFNDQWNGTLSASQSRVVIDDNSAFPWGCYNDICEYSGLGNTFDKHGNYDIYDFRSPDDTRITNQFAAGLNGQFNTANIQHQIAFELQRTYKTLKHHTPLNVVVGTGNIYEDTIDYSPSSESLGDRYKALESDQTAFTISDRVQFNDQWSTLLGGKLIHLDEQTYNSDGQQSRDTDLNKFLPQLALMYSPTAGTNLYASYAKGLSDGGEAPWFANNALEVLSPKNSEQYEIGIKQQIRNFLVTAAIFDLKQDNQYSKVNAEGTFDFVSQGEQHNQGIELGLTGALTDKLDVSSGITYTKSRLVDIDNDSYKGHQTQNVPKVRATAQLSYKVPSVEGLRLLSGMQYSSSKYANKEGTAKVGGYSVFNIGAAYKTNFAGHDTTFRFNIDNLFNKKYWRDVGAFMGDDYLFLGNPRTAQFSTTFSF
>CP026089.1|AUT34345.1|2056614_2058033_+|aspartate-ammonia-lyase
MMNAEITTRIEKDLIGYREINNNDYYGVQTLRALENFNLTQSKVGNFPHLIKALAMVKLACAEANYNLKSLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHAKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFRNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALAKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQSKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQMLDDILSINNMVKPKMSA
>CP026089.1|AUT34356.1|2070544_2071240_-|Zn-dependent-hydrolase
MFFKQFFEKESSTYTYMLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITHGCMLKVGNLSIEARYTPGHTNACTSYLVENMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHRQLFSLPDDTIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>CP026089.1|AUT34357.1|2071431_2072703_+|Fis-family-transcriptional-regulator
MAKLNFESEQDFFILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENMAALIQDHHNQYLEINTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIADQGELTEQLEDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLNAEDYVKLPETNTELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>CP026089.1|AUT34358.1|2072772_2073684_+|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLTNEQREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKILKDGEISDIIYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>CP026089.1|AUT34359.1|2073732_2074791_-|butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGKGVDDIEIGQHVVVEPYIVSDDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHEETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP026089.1|AUT34360.1|2074820_2075606_-|diacetyl-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDQLNDVQQEIQALGVNASIFIANVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASNDSDYITGQSILTDGGIVYR
>CP026089.1|AUT34361.1|2075632_2077036_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHSGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNHVTVFNGRAQLTAKEKIEVTDAQGKSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEDLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIVNGQVHCVIETANDVQTIVFDRVLSAIGVQPNATGLGLEHLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAQNLPIRIGKFSLTANGKALAIGDASGFVKTVIHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP026089.1|AUT34362.1|2077046_2078582_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEISDAEIEQFIASLGGSAAKAPETPSEQSKAETFAPVTEKAEQPQPVAASASVPVKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP026089.1|AUT34363.1|2078583_2079603_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENELEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDAAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP026089.1|AUT34364.1|2079616_2080579_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP026089.1|AUT34365.1|2080941_2081928_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEINRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVKNLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLELLKRFKAYCPDIKTKSGLMVGLGEIEAEVLALLNDLKDYQVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTRHGKRLGFKNIWSGPMVRSSYFADRQYFGEEVPKPFSRQDVLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

936641 : 973392

Acinetobacter_phage(92.45%)

plate,terminase,transposase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT33363.1\|936641_936932_+	co-chaperone GroES	A0A221S322	uncultured_virus	9.7e-15	43.5
AUT33364.1\|936990_938625_+	chaperonin GroEL	A0A219YK78	uncultured_virus	8.1e-175	60.8
AUT33365.1\|938763_938988_-	hypothetical protein	A0A0P0J067	Acinetobacter_phage	9.8e-07	44.1
AUT33366.1\|938988_939330_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	5.8e-35	63.3
AUT33367.1\|939326_939722_-	hypothetical protein	NA	NA	NA	NA
AUT33368.1\|939714_940125_-	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	6.4e-12	96.9
AUT33369.1\|940128_940374_-	hypothetical protein	A0A0P0I475	Acinetobacter_phage	5.7e-40	97.5
AUT33370.1\|940375_941371_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.6e-75	51.2
AUT33371.1\|941385_942153_-	hypothetical protein	NA	NA	NA	NA
AUT33372.1\|942164_942488_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.5e-56	97.2
AUT33373.1\|942490_942931_-	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	2.0e-72	95.9
AUT33374.1\|943298_943571_-	hypothetical protein	NA	NA	NA	NA
AUT33375.1\|943621_943837_-	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	7.9e-30	97.2
AUT33376.1\|943851_944616_-	phage repressor protein	A0A0P0J076	Acinetobacter_phage	1.1e-142	97.2
AUT33377.1\|944724_944976_+	hypothetical protein	A0A0N7IRE1	Acinetobacter_phage	2.4e-38	95.2
AUT33378.1\|944986_945307_+	transcriptional regulator	A0A0P0HSE9	Acinetobacter_phage	3.2e-43	88.7
AUT33379.1\|945362_945641_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	7.3e-36	94.3
AUT33380.1\|945637_945934_+	hypothetical protein	A0A0D4DCL5	Acinetobacter_phage	1.8e-48	99.0
AUT33381.1\|945930_946275_+	hypothetical protein	A0A0P0IVS7	Acinetobacter_phage	3.4e-51	96.4
AUT33382.1\|946346_947234_+	hypothetical protein	A0A0D4DBT2	Acinetobacter_phage	1.3e-147	92.6
AUT33383.1\|947230_948001_+	DNA replication protein	A0A0D4DBZ2	Acinetobacter_phage	9.2e-145	98.0
AUT33384.1\|947997_948465_+	adenine methyltransferase	S5MUL8	Brevibacillus_phage	1.1e-47	59.4
AUT33385.1\|948582_948906_+	hypothetical protein	A0A0P0I8A5	Acinetobacter_phage	1.2e-29	84.0
AUT33386.1\|949068_949275_+	hypothetical protein	NA	NA	NA	NA
AUT33387.1\|949264_949588_+	hypothetical protein	NA	NA	NA	NA
AUT33388.1\|949587_949983_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	4.4e-66	95.4
AUT33389.1\|949979_950480_+	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	2.9e-91	97.6
AUT33390.1\|950562_951327_+	hypothetical protein	A0A0P0IKQ5	Acinetobacter_phage	7.3e-86	91.8
AUT33391.1\|951557_952316_+	hypothetical protein	A0A0P0J0C5	Acinetobacter_phage	5.2e-116	80.2
AUT36117.1\|952410_953058_+\|transposase	transposase	A0A0N7IRF1	Acinetobacter_phage	4.7e-126	97.7
AUT33392.1\|953105_953621_+	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	2.7e-84	94.2
AUT33393.1\|953617_955276_+\|terminase	terminase	A0A0P0IVT4	Acinetobacter_phage	0.0e+00	98.7
AUT33394.1\|955286_956699_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	2.1e-256	97.2
AUT33395.1\|956769_957357_+\|head	phage head morphogenesis protein	A0A0P0IKX5	Acinetobacter_phage	8.1e-101	95.3
AUT33396.1\|957402_958716_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	8.4e-207	97.3
AUT33397.1\|958719_959196_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	3.0e-85	100.0
AUT36118.1\|959261_960287_+	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	8.4e-194	99.7
AUT33398.1\|960296_960728_+	hypothetical protein	A0A0P0IYA6	Acinetobacter_phage	8.1e-58	100.0
AUT33399.1\|960731_961118_+	DUF4054 domain-containing protein	A0A0P0IKR4	Acinetobacter_phage	3.3e-66	98.4
AUT33400.1\|961114_961675_+	hypothetical protein	A0A0P0J0D1	Acinetobacter_phage	2.0e-85	88.7
AUT33401.1\|961661_962030_+	hypothetical protein	A0A0P0HSK8	Acinetobacter_phage	1.9e-63	97.5
AUT33402.1\|962032_962572_+	hypothetical protein	A0A0P0IVT9	Acinetobacter_phage	7.7e-98	97.2
AUT33403.1\|962575_964051_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	8.4e-272	98.2
AUT33404.1\|964066_964510_+	DUF3277 domain-containing protein	A0A0P0IKY2	Acinetobacter_phage	3.3e-78	100.0
AUT33405.1\|964509_964971_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	2.0e-78	99.3
AUT36119.1\|964946_965159_+	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	6.0e-06	51.0
AUT33406.1\|965166_967191_+	hypothetical protein	A0A0P0IE11	Acinetobacter_phage	0.0e+00	99.1
AUT33407.1\|967187_967544_-	DUF1311 domain-containing protein	A0A0P0IRF2	Acinetobacter_phage	4.5e-62	100.0
AUT33408.1\|967543_967771_-	hypothetical protein	A0A0P0I8G2	Acinetobacter_phage	1.5e-31	100.0
AUT33409.1\|967775_967964_+	hypothetical protein	A0A0P0IYB4	Acinetobacter_phage	6.5e-28	100.0
AUT33410.1\|968130_968724_+	hypothetical protein	A0A0P0IKS1	Acinetobacter_phage	1.4e-89	92.4
AUT33411.1\|968725_969019_+	hypothetical protein	A0A0P0J0D9	Acinetobacter_phage	3.4e-47	94.8
AUT33412.1\|969019_969979_+	hypothetical protein	A0A0P0HSL6	Acinetobacter_phage	1.5e-173	94.7
AUT33413.1\|969980_970643_+	hypothetical protein	A0A0N7IRF4	Acinetobacter_phage	2.9e-123	95.5
AUT33414.1\|970678_971032_+	hypothetical protein	A0A0P0IVU6	Acinetobacter_phage	1.1e-57	90.6
AUT33415.1\|971034_972219_+\|plate	phage baseplate protein	A0A0P0I499	Acinetobacter_phage	2.0e-207	93.1
AUT33416.1\|972218_972809_+	DUF2612 domain-containing protein	A0A0P0IKZ0	Acinetobacter_phage	2.9e-98	87.8
AUT33417.1\|972801_973392_+	TetR family transcriptional regulator	A0A0P0IE19	Acinetobacter_phage	5.8e-22	96.1

DBSCAN-SWA_2

1262717 : 1286411

Acinetobacter_phage(73.68%)

portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT33646.1\|1262717_1265450_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	95.6
AUT33647.1\|1265528_1268228_+	aminopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	97.4
AUT33648.1\|1268324_1268909_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	3.3e-110	98.5
AUT33649.1\|1269023_1269293_-	hypothetical protein	A0A0P0J067	Acinetobacter_phage	8.7e-42	100.0
AUT33650.1\|1269293_1269629_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	3.7e-34	62.4
AUT33651.1\|1269625_1270021_-	hypothetical protein	NA	NA	NA	NA
AUT36145.1\|1270017_1270395_-	hypothetical protein	NA	NA	NA	NA
AUT33652.1\|1270625_1270871_-	hypothetical protein	A0A0P0I475	Acinetobacter_phage	1.1e-40	98.8
AUT33653.1\|1270872_1271868_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.6e-75	51.2
AUT33654.1\|1271882_1272650_-	hypothetical protein	NA	NA	NA	NA
AUT33655.1\|1272661_1272985_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	3.6e-42	78.5
AUT33656.1\|1272977_1273427_-	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	2.6e-75	98.6
AUT33657.1\|1273634_1274384_-	XRE family transcriptional regulator	H1ZZB6	Pseudomonas_virus	6.4e-10	31.4
AUT33658.1\|1274517_1274781_+	transcriptional regulator	NA	NA	NA	NA
AUT33659.1\|1274841_1275342_+	hypothetical protein	NA	NA	NA	NA
AUT33660.1\|1275393_1275720_+	hypothetical protein	NA	NA	NA	NA
AUT33661.1\|1275716_1276673_+	helix-turn-helix domain-containing protein	A0A1V0E8B1	Vibrio_phage	1.4e-17	41.3
AUT33662.1\|1276785_1277055_+	hypothetical protein	NA	NA	NA	NA
AUT33663.1\|1277047_1277416_+	hypothetical protein	NA	NA	NA	NA
AUT33664.1\|1277408_1277666_+	hypothetical protein	NA	NA	NA	NA
AUT33665.1\|1277678_1278095_+	hypothetical protein	A0A0R6PIZ9	Moraxella_phage	3.4e-21	49.1
AUT33666.1\|1278104_1278389_+	hypothetical protein	NA	NA	NA	NA
AUT33667.1\|1278411_1278978_+	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	1.4e-46	52.5
AUT33668.1\|1279361_1279547_+	hypothetical protein	NA	NA	NA	NA
AUT33669.1\|1279991_1280462_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	1.3e-48	63.2
AUT33670.1\|1280421_1281063_+	hypothetical protein	J7I4N9	Acinetobacter_phage	2.3e-104	82.2
AUT33671.1\|1281121_1281592_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	7.7e-70	80.1
AUT33672.1\|1281581_1283075_+\|terminase	terminase	A0A0D4DCE6	Acinetobacter_phage	2.6e-220	78.4
AUT33673.1\|1283050_1285201_+\|portal	phage portal protein	I3VYW9	Thermoanaerobacterium_phage	3.3e-59	33.8
AUT33674.1\|1285259_1286411_+	hypothetical protein	I3VYW8	Thermoanaerobacterium_phage	1.7e-17	36.1

DBSCAN-SWA_3

1300757 : 1311013

Acinetobacter_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT33687.1\|1300757_1303247_+	hypothetical protein	A0A1I9L2F3	Xanthomonas_phage	1.1e-05	21.9
AUT33688.1\|1303310_1303700_+	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	2.6e-63	95.3
AUT33689.1\|1303742_1304288_+	hypothetical protein	J7I0Y1	Acinetobacter_phage	4.3e-96	93.4
AUT33690.1\|1304394_1305324_-	FRG domain-containing protein	NA	NA	NA	NA
AUT33691.1\|1305974_1307171_-	DUF4102 domain-containing protein	A0A0P0IRB7	Acinetobacter_phage	1.6e-225	99.7
AUT33692.1\|1307654_1309457_-	Xaa-Pro aminopeptidase	A0A0P0I8D7	Acinetobacter_phage	0.0e+00	91.7
AUT33693.1\|1309453_1311013_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	6.6e-259	87.9

DBSCAN-SWA_4

1564814 : 1608758

Pseudomonas_phage(27.27%)

tail,transposase,head,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT33909.1\|1564814_1566353_-\|tail	phage tail protein	NA	NA	NA	NA
AUT33910.1\|1566349_1566886_-	DUF2313 domain-containing protein	NA	NA	NA	NA
AUT33911.1\|1566882_1567929_-	hypothetical protein	A0A0M3LQN4	Mannheimia_phage	1.6e-27	27.6
AUT33912.1\|1567930_1568293_-	hypothetical protein	NA	NA	NA	NA
AUT33913.1\|1568295_1568775_-\|plate	baseplate assembly protein	F6MIL4	Haemophilus_phage	1.6e-14	42.0
AUT33914.1\|1568771_1569827_-	hypothetical protein	NA	NA	NA	NA
AUT33915.1\|1569816_1570989_-	multidrug DMT transporter	NA	NA	NA	NA
AUT33916.1\|1572226_1572703_-	phage morphogenesis protein	F8TVC6	EBPR_siphovirus	2.1e-14	37.9
AUT33917.1\|1572699_1573959_-\|head	phage head morphogenesis protein	I6PBD2	Pseudomonas_phage	3.3e-75	36.9
AUT33918.1\|1573958_1575572_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.8e-110	41.7
AUT33919.1\|1575848_1576580_+	hypothetical protein	NA	NA	NA	NA
AUT33920.1\|1576580_1578218_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	1.1e-115	45.3
AUT33921.1\|1578217_1578784_-	hypothetical protein	J9SH37	Pseudomonas_phage	1.3e-18	37.9
AUT33922.1\|1578791_1579085_-	hypothetical protein	J9SNG3	Pseudomonas_phage	2.7e-20	52.6
AUT33923.1\|1579091_1579373_-	DUF2730 domain-containing protein	NA	NA	NA	NA
AUT33924.1\|1579365_1579746_-	hypothetical protein	NA	NA	NA	NA
AUT33925.1\|1579742_1580243_-	hypothetical protein	A0A0M3LSH2	Mannheimia_phage	3.0e-56	66.5
AUT33926.1\|1580321_1580951_-	hypothetical protein	NA	NA	NA	NA
AUT33927.1\|1580947_1581673_-	hypothetical protein	NA	NA	NA	NA
AUT33928.1\|1581690_1582167_-	Cro/Cl family transcriptional regulator	NA	NA	NA	NA
AUT33929.1\|1582259_1582466_+	DNA-binding protein	A0A0S4L0D0	Pseudomonas_phage	9.6e-09	52.7
AUT33930.1\|1582671_1582968_+	MarR family transcriptional regulator	Q5ZR02	Pseudomonas_phage	3.8e-14	45.6
AUT33931.1\|1582980_1583865_+	DUF3102 domain-containing protein	Q6QID9	Burkholderia_phage	1.2e-28	34.5
AUT33932.1\|1583867_1585619_+\|transposase	transposase	Q5ZR04	Pseudomonas_phage	3.2e-100	36.5
AUT33933.1\|1585628_1586906_+\|transposase	transposase	Q6QIE1	Burkholderia_phage	5.1e-92	47.0
AUT33934.1\|1587000_1587219_+	conjugal transfer protein TraR	NA	NA	NA	NA
AUT33935.1\|1587215_1587452_+	hypothetical protein	NA	NA	NA	NA
AUT33936.1\|1587452_1588124_+	DUF2752 domain-containing protein	A0A2H4JFV8	uncultured_Caudovirales_phage	1.6e-28	47.2
AUT33937.1\|1588123_1588627_+	hypothetical protein	A0A2K9VGT9	Faecalibacterium_phage	2.9e-14	32.9
AUT33938.1\|1588821_1589094_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.3e-21	62.2
AUT33939.1\|1589093_1589273_+	hypothetical protein	NA	NA	NA	NA
AUT33940.1\|1589309_1589594_+	hypothetical protein	NA	NA	NA	NA
AUT33941.1\|1590182_1590407_+	hypothetical protein	NA	NA	NA	NA
AUT33942.1\|1590408_1590621_+	hypothetical protein	K4IBU9	Acinetobacter_phage	1.6e-06	59.5
AUT33943.1\|1590607_1591045_+	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	2.0e-11	32.6
AUT33944.1\|1591165_1591615_+	transcriptional regulator	NA	NA	NA	NA
AUT33945.1\|1592599_1593520_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUT33946.1\|1593580_1594033_-	DUF441 domain-containing protein	NA	NA	NA	NA
AUT33947.1\|1594282_1594501_+	hypothetical protein	NA	NA	NA	NA
AUT33948.1\|1594602_1595307_+	16S rRNA pseudouridine(516) synthase	NA	NA	NA	NA
AUT33949.1\|1595299_1595743_-	N-acetyltransferase	NA	NA	NA	NA
AUT33950.1\|1595841_1596150_-	type II toxin-antitoxin system antitoxin, RelB/DinJ family	NA	NA	NA	NA
AUT33951.1\|1596260_1597139_-	Rlu family pseudouridine synthase	NA	NA	NA	NA
AUT36161.1\|1597289_1597763_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AUT33952.1\|1597755_1599705_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.7e-83	32.7
AUT33953.1\|1599711_1600656_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AUT33954.1\|1600738_1601263_+	RNA chaperone Hfq	NA	NA	NA	NA
AUT33955.1\|1601403_1602261_+	EamA/RhaT family transporter	NA	NA	NA	NA
AUT33956.1\|1602300_1602954_-	oxygen-insensitive NAD(P)H nitroreductase	NA	NA	NA	NA
AUT33957.1\|1603089_1603320_+	hypothetical protein	NA	NA	NA	NA
AUT33958.1\|1603327_1604047_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
AUT33959.1\|1604062_1604572_-	cyclophilin	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-13	34.7
AUT33960.1\|1604739_1606467_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	7.5e-187	57.2
AUT33961.1\|1606893_1607616_-	GMP synthase	NA	NA	NA	NA
AUT33962.1\|1607732_1608758_-\|transposase	IS30-like element ISAba125 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

2195974 : 2224076

Acinetobacter_phage(41.18%)

tail,transposase,head,integrase,terminase

attL 2208928:2208941|attR 2219351:2219364

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT34462.1\|2195974_2196997_-	hypothetical protein	Q775C7	Bordetella_phage	1.6e-88	50.0
AUT34463.1\|2197008_2197656_-	hypothetical protein	A0A2I7RHR0	Vibrio_phage	7.0e-13	39.6
AUT34464.1\|2197624_2197954_-	hypothetical protein	NA	NA	NA	NA
AUT34465.1\|2197950_2199642_-\|head,tail	phage head-tail adapter protein	G9L6C2	Escherichia_phage	2.4e-68	32.2
AUT34466.1\|2199643_2199898_-	hypothetical protein	NA	NA	NA	NA
AUT34467.1\|2199975_2201598_-\|terminase	terminase	Q775B9	Bordetella_phage	1.4e-187	60.7
AUT34468.1\|2201581_2201854_-	hypothetical protein	NA	NA	NA	NA
AUT34469.1\|2201957_2203166_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
AUT34470.1\|2203399_2203609_-	hypothetical protein	NA	NA	NA	NA
AUT34471.1\|2203601_2204342_-\|terminase	terminase small subunit	A0A1Y0SUQ3	Pseudomonas_phage	3.7e-50	48.6
AUT34472.1\|2204342_2204552_-	hypothetical protein	NA	NA	NA	NA
AUT34473.1\|2204563_2204992_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	1.6e-50	73.4
AUT34474.1\|2204984_2205737_-	DNA replication protein	A0A0D4DBZ2	Acinetobacter_phage	2.2e-58	50.8
AUT34475.1\|2205738_2206620_-	DUF1376 domain-containing protein	NA	NA	NA	NA
AUT34476.1\|2206616_2206982_-	hypothetical protein	NA	NA	NA	NA
AUT34477.1\|2206978_2207557_-	hypothetical protein	NA	NA	NA	NA
AUT34478.1\|2207553_2208411_-	hypothetical protein	NA	NA	NA	NA
AUT34479.1\|2208407_2208629_-	hypothetical protein	NA	NA	NA	NA
AUT34480.1\|2208687_2209044_-	transcriptional regulator	J7I452	Acinetobacter_phage	4.2e-44	79.7
2208928:2208941	attL	NA	NA	NA	NA
AUT34481.1\|2209052_2209241_-	hypothetical protein	NA	NA	NA	NA
AUT34482.1\|2209344_2210070_+	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	4.9e-63	51.3
AUT34483.1\|2210072_2210378_+	hypothetical protein	NA	NA	NA	NA
AUT34484.1\|2210540_2210915_+	hypothetical protein	NA	NA	NA	NA
AUT34485.1\|2210982_2211861_+	DUF2303 domain-containing protein	I6NVL7	Burkholderia_virus	1.8e-27	34.2
AUT34486.1\|2211990_2212563_+	hypothetical protein	NA	NA	NA	NA
AUT34487.1\|2212564_2212819_+	hypothetical protein	NA	NA	NA	NA
AUT34488.1\|2212827_2213808_+	recombinase	A0A0A7RWR9	Clostridium_phage	2.7e-48	36.0
AUT34489.1\|2213819_2214752_+	transcriptional regulator	A0A2H4J6I3	uncultured_Caudovirales_phage	1.3e-52	66.0
AUT34490.1\|2214824_2216306_+	ATP-dependent helicase	A0A075DXT4	Acinetobacter_phage	6.7e-67	34.9
AUT34491.1\|2216302_2216536_+	protein ninH	NA	NA	NA	NA
AUT34492.1\|2216532_2216913_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	1.4e-05	44.9
AUT34493.1\|2216909_2217257_+	hypothetical protein	NA	NA	NA	NA
AUT34494.1\|2217253_2217457_+	hypothetical protein	NA	NA	NA	NA
AUT34495.1\|2217477_2217729_+	hypothetical protein	NA	NA	NA	NA
AUT34496.1\|2217694_2218654_-\|integrase	integrase	A0A1B1P9F9	Acinetobacter_phage	6.5e-47	35.3
AUT34497.1\|2218831_2219974_-	cell division protein ZapE	NA	NA	NA	NA
2219351:2219364	attR	NA	NA	NA	NA
AUT36206.1\|2220051_2221032_-	AraC family transcriptional regulator	NA	NA	NA	NA
AUT34498.1\|2221195_2222743_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AUT34499.1\|2222867_2224076_+\|transposase	IS256 family transposase ISAba26	A0A218MNI5	uncultured_virus	3.1e-46	46.5

DBSCAN-SWA_6

2615288 : 2625277

Acinetobacter_phage(37.5%)

integrase,tRNA

attL 2607360:2607375|attR 2633440:2633455

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2607360:2607375	attL	NA	NA	NA	NA
AUT34849.1\|2615288_2616266_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	7.3e-38	31.7
AUT34850.1\|2616479_2617901_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-55	30.8
AUT34851.1\|2618254_2619268_+\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	3.8e-66	40.3
AUT34852.1\|2619296_2619491_-	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	1.7e-23	85.5
AUT34853.1\|2619553_2620144_+	hypothetical protein	NA	NA	NA	NA
AUT34854.1\|2620408_2621125_+	hypothetical protein	NA	NA	NA	NA
AUT34855.1\|2621325_2621868_-	hypothetical protein	A0A0N7IRF5	Acinetobacter_phage	1.6e-95	93.3
AUT34856.1\|2621910_2622300_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
AUT34857.1\|2622364_2624854_-	hypothetical protein	A0A1I9L2F3	Xanthomonas_phage	1.0e-06	26.1
AUT34858.1\|2624854_2625277_-	hypothetical protein	A0A0B5A615	Paracoccus_phage	4.4e-08	33.3
2633440:2633455	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2639509 : 2656436

Acinetobacter_phage(76.19%)

portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT34869.1\|2639509_2640661_-	hypothetical protein	I3VYW8	Thermoanaerobacterium_phage	1.7e-17	36.1
AUT34870.1\|2640719_2642870_-\|portal	phage portal protein	I3VYW9	Thermoanaerobacterium_phage	1.7e-58	33.6
AUT34871.1\|2642845_2644339_-\|terminase	terminase	A0A0D4DCE6	Acinetobacter_phage	1.1e-218	78.2
AUT34872.1\|2644328_2644793_-	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	1.1e-57	73.7
AUT34873.1\|2644851_2645493_-	hypothetical protein	J7I4N9	Acinetobacter_phage	4.0e-109	84.5
AUT34874.1\|2645461_2645929_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.7e-65	82.2
AUT34875.1\|2645941_2646133_-	hypothetical protein	J7I0V8	Acinetobacter_phage	2.6e-24	85.7
AUT34876.1\|2646255_2646552_-	hypothetical protein	J7I457	Acinetobacter_phage	1.0e-56	96.9
AUT34877.1\|2646674_2647409_-	hypothetical protein	J7HXD9	Acinetobacter_phage	5.1e-137	100.0
AUT34878.1\|2647471_2647930_-	hypothetical protein	G3EN88	Psychrobacter_phage	2.4e-23	40.5
AUT34879.1\|2647935_2648253_-	hypothetical protein	NA	NA	NA	NA
AUT34880.1\|2648242_2648422_-	hypothetical protein	NA	NA	NA	NA
AUT34881.1\|2648414_2648816_-	HNH endonuclease	K7P7B7	Enterobacteria_phage	7.6e-26	49.2
AUT34882.1\|2648812_2649220_-	hypothetical protein	NA	NA	NA	NA
AUT36232.1\|2649216_2649615_-	hypothetical protein	NA	NA	NA	NA
AUT34883.1\|2649727_2650690_-	helix-turn-helix domain-containing protein	A0A0P0HSN8	Acinetobacter_phage	4.4e-19	54.4
AUT36233.1\|2650686_2651016_-	hypothetical protein	NA	NA	NA	NA
AUT34884.1\|2651076_2651433_-	hypothetical protein	A0A0P0IKQ0	Acinetobacter_phage	1.0e-58	94.1
AUT34885.1\|2651443_2651692_-	hypothetical protein	NA	NA	NA	NA
AUT34886.1\|2651809_2652508_+	phage repressor protein	A0A2H4JAJ5	uncultured_Caudovirales_phage	1.9e-32	43.0
AUT34887.1\|2652524_2652827_+	hypothetical protein	A0A0D4DCL0	Acinetobacter_phage	6.5e-38	86.7
AUT34888.1\|2653052_2653493_+	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	1.3e-47	67.3
AUT34889.1\|2653495_2653819_+	hypothetical protein	A0A0P0IRC4	Acinetobacter_phage	3.5e-53	93.5
AUT34890.1\|2653830_2654598_+	hypothetical protein	NA	NA	NA	NA
AUT34891.1\|2654612_2655572_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	6.0e-162	91.2
AUT34892.1\|2655573_2655819_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
AUT34893.1\|2655822_2656230_+	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	3.7e-12	94.1
AUT34894.1\|2656226_2656436_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	6.3e-32	94.2

DBSCAN-SWA_8

2746370 : 2788976

Acinetobacter_phage(72.73%)

tail,coat,transposase,terminase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT34983.1\|2746370_2749007_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.7e-76	38.4
AUT34984.1\|2749293_2750499_+	DUF4102 domain-containing protein	A0A0R6PHZ3	Moraxella_phage	7.2e-104	50.5
AUT34985.1\|2750660_2751155_+	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	4.8e-46	61.5
AUT34986.1\|2751158_2752457_+	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	1.5e-155	60.8
AUT34987.1\|2752534_2753281_+\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.8e-12	33.3
AUT34988.1\|2753418_2754582_-	glutathione-dependent formaldehyde dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	5.5e-08	26.5
AUT34989.1\|2755023_2755440_+	hypothetical protein	NA	NA	NA	NA
AUT34990.1\|2755552_2756023_-	hypothetical protein	NA	NA	NA	NA
AUT34991.1\|2756036_2756462_+	hypothetical protein	NA	NA	NA	NA
AUT34992.1\|2756458_2757484_-\|transposase	DDE transposase	NA	NA	NA	NA
AUT34993.1\|2757604_2757823_+	hypothetical protein	NA	NA	NA	NA
AUT36238.1\|2758378_2759686_+	site-specific DNA-methyltransferase	A0A2R3ZYF2	Campylobacter_phage	4.8e-45	35.2
AUT34994.1\|2759678_2762516_+	type III deoxyribonuclease	NA	NA	NA	NA
AUT34995.1\|2762917_2763463_-	hypothetical protein	A0A0P0IW03	Acinetobacter_phage	6.6e-97	96.1
AUT34996.1\|2763505_2763895_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	8.6e-67	99.2
AUT34997.1\|2763962_2767388_-	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	94.7
AUT34998.1\|2767380_2767743_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	6.2e-51	79.2
AUT34999.1\|2767739_2768246_-	hypothetical protein	J7HXQ5	Acinetobacter_phage	8.6e-91	97.6
AUT35000.1\|2768245_2768644_-	hypothetical protein	J7I0X8	Acinetobacter_phage	2.4e-72	98.5
AUT35001.1\|2769374_2773709_-\|tail	phage tail tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	70.2
AUT35002.1\|2773839_2774103_-	hypothetical protein	NA	NA	NA	NA
AUT35003.1\|2774104_2774785_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
AUT35004.1\|2774883_2775288_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
AUT35005.1\|2775380_2775563_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
AUT36239.1\|2775888_2776404_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.8e-73	96.4
AUT35006.1\|2776474_2777392_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.9e-166	97.7
AUT35007.1\|2777444_2778773_-	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-86	49.1
AUT35008.1\|2778772_2779126_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	1.5e-57	94.0
AUT35009.1\|2779194_2779593_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	1.2e-68	94.7
AUT35010.1\|2779594_2779963_-	hypothetical protein	A0A0P0IDX0	Acinetobacter_phage	1.1e-55	98.1
AUT35011.1\|2779934_2780339_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.9e-61	88.1
AUT35012.1\|2781076_2781445_-	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	7.2e-63	95.9
AUT35013.1\|2781444_2781825_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	8.2e-54	84.9
AUT35014.1\|2781828_2782359_-	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	4.2e-40	91.7
AUT35015.1\|2782401_2783373_-\|coat	phage coat protein	A0A2H4JIE6	uncultured_Caudovirales_phage	4.4e-136	72.7
AUT35016.1\|2784287_2785580_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	4.9e-215	86.3
AUT35017.1\|2785539_2786055_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
AUT35018.1\|2786113_2786755_-	hypothetical protein	J7I4N9	Acinetobacter_phage	2.2e-123	96.2
AUT35019.1\|2786723_2787158_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.4e-78	97.9
AUT35020.1\|2787217_2787673_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
AUT35021.1\|2787950_2788976_-\|transposase	IS30-like element ISAba125 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2792721 : 2802552

Acinetobacter_phage(54.55%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT35027.1\|2792721_2793198_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
AUT35028.1\|2793194_2793596_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	8.1e-68	98.5
AUT36241.1\|2793756_2794731_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	4.3e-147	82.1
AUT35029.1\|2794732_2794978_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
AUT35030.1\|2794981_2795431_+	DUF551 domain-containing protein	A0A0P0HSE1	Acinetobacter_phage	3.4e-83	97.2
AUT35031.1\|2795427_2795712_+	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	2.2e-43	94.7
AUT35032.1\|2795715_2795973_+	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	1.2e-40	88.1
AUT35033.1\|2795974_2796190_+	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
AUT35034.1\|2796399_2797680_+	aspartate kinase	NA	NA	NA	NA
AUT35035.1\|2797926_2798181_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
AUT35036.1\|2798248_2798815_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.4e-25	43.1
AUT36242.1\|2798885_2799326_-	hypothetical protein	NA	NA	NA	NA
AUT35037.1\|2799515_2800073_+	cytochrome b	NA	NA	NA	NA
AUT35038.1\|2800117_2801116_-	adenosine deaminase	NA	NA	NA	NA
AUT35039.1\|2801232_2802552_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.1e-60	36.0

DBSCAN-SWA_10

3035614 : 3068972

Vibrio_phage(50.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT35226.1\|3035614_3037681_-\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	8.0e-18	25.7
AUT35227.1\|3037802_3039425_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	7.1e-22	25.9
AUT35228.1\|3039677_3040313_+	transcriptional regulator BetI	NA	NA	NA	NA
AUT35229.1\|3040305_3041778_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
AUT35230.1\|3041873_3043532_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.1e-57	31.5
AUT35231.1\|3044042_3045683_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
AUT35232.1\|3045774_3046245_+	hypothetical protein	NA	NA	NA	NA
AUT35233.1\|3046461_3047340_+	homocysteine S-methyltransferase	NA	NA	NA	NA
AUT35234.1\|3047345_3048680_+	arginine:ornithine antiporter	NA	NA	NA	NA
AUT36265.1\|3048735_3050613_-	alpha/beta hydrolase	NA	NA	NA	NA
AUT35235.1\|3050797_3051505_-	DUF1275 domain-containing protein	NA	NA	NA	NA
AUT35236.1\|3051696_3053385_-	DUF2235 domain-containing protein	NA	NA	NA	NA
AUT35237.1\|3053398_3053815_-	hypothetical protein	NA	NA	NA	NA
AUT35238.1\|3053988_3055014_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AUT35239.1\|3055106_3055550_-	hypothetical protein	NA	NA	NA	NA
AUT35240.1\|3055558_3056464_-	DUF4123 domain-containing protein	NA	NA	NA	NA
AUT35241.1\|3056464_3059092_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.6e-252	51.9
AUT35242.1\|3059504_3059780_+	hypothetical protein	NA	NA	NA	NA
AUT35243.1\|3059793_3060684_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUT35244.1\|3060871_3061816_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
AUT35245.1\|3061988_3063374_+	MFS transporter	NA	NA	NA	NA
AUT35246.1\|3063452_3064799_+	outer membrane porin, OprD family	NA	NA	NA	NA
AUT35247.1\|3065470_3066496_+\|transposase	IS30-like element ISAba125 family transposase	NA	NA	NA	NA
AUT35248.1\|3066525_3066810_+	hypothetical protein	NA	NA	NA	NA
AUT36266.1\|3067082_3067568_-	hypothetical protein	NA	NA	NA	NA
AUT35249.1\|3067641_3067890_-	hypothetical protein	NA	NA	NA	NA
AUT35250.1\|3067946_3068972_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

3406468 : 3414671

uncultured_Caudovirales_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT35532.1\|3406468_3407692_-	ImmA/IrrE family metallo-endopeptidase	A0A222YXG1	Escherichia_phage	4.1e-22	47.1
AUT35533.1\|3407681_3407954_-	hypothetical protein	NA	NA	NA	NA
AUT35534.1\|3408361_3409180_-	hypothetical protein	NA	NA	NA	NA
AUT35535.1\|3409476_3410544_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	4.6e-94	59.2
AUT35536.1\|3410648_3411602_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.2e-61	42.8
AUT35537.1\|3411620_3412325_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-92	72.5
AUT35538.1\|3412329_3413370_-	arsenical-resistance protein	NA	NA	NA	NA
AUT35539.1\|3413377_3413851_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.6e-36	51.3
AUT35540.1\|3413857_3414181_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.2e-21	61.0
AUT35541.1\|3414236_3414671_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-41	62.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP026087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5339 : 70363

Acinetobacter_phage(27.78%)

transposase,protease,integrase

attL 5288:5303|attR 39137:39152

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5288:5303	attL	NA	NA	NA	NA
AUT32517.1\|5339_6272_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	8.4e-60	41.8
AUT32518.1\|6408_7386_+	oxidoreductase	NA	NA	NA	NA
AUT32582.1\|8746_11413_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-157	34.7
AUT32519.1\|12641_13814_-	RepB family plasmid replication initiator protein	A0A1V0E006	Clostridioides_phage	9.8e-05	29.4
AUT32520.1\|13841_14021_+	hypothetical protein	NA	NA	NA	NA
AUT32521.1\|14727_15504_+	partitioning protein	Q8JL10	Natrialba_phage	1.8e-18	36.6
AUT32522.1\|15522_16422_+	partitioning protein	S5VTK0	Leptospira_phage	3.0e-14	37.4
AUT32523.1\|16570_17425_+	alkaline phosphatase	NA	NA	NA	NA
AUT32524.1\|19181_19487_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUT32525.1\|22081_22504_+	hypothetical protein	NA	NA	NA	NA
AUT32526.1\|22516_24856_+	hypothetical protein	NA	NA	NA	NA
AUT32527.1\|24860_28061_+\|integrase	integrase	NA	NA	NA	NA
AUT32528.1\|28276_28747_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	8.3e-56	66.4
AUT32529.1\|29159_29396_+	hypothetical protein	NA	NA	NA	NA
AUT32530.1\|29519_30545_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
AUT32531.1\|31147_31603_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	4.7e-80	95.4
AUT32532.1\|31663_32125_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.0e-55	73.8
AUT32533.1\|32093_32735_+	hypothetical protein	A0A0P0I8J9	Acinetobacter_phage	3.2e-111	85.0
AUT32583.1\|34313_34520_+	hypothetical protein	NA	NA	NA	NA
AUT32534.1\|34591_34768_+	hypothetical protein	A0A0R6PIB1	Moraxella_phage	1.1e-08	57.7
AUT32535.1\|35508_35697_+	hypothetical protein	NA	NA	NA	NA
AUT32536.1\|35733_36021_-	transcriptional regulator	A0A088CD40	Shigella_phage	3.3e-15	48.4
AUT32537.1\|36007_36337_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.9e-23	64.6
AUT32538.1\|36391_36661_-	transcriptional regulator	NA	NA	NA	NA
AUT32539.1\|36867_37470_+	hypothetical protein	A0A0P0J0J1	Acinetobacter_phage	3.2e-36	62.2
AUT32540.1\|37526_37745_+	hypothetical protein	A0A0R6PIC9	Moraxella_phage	4.0e-21	77.4
AUT32541.1\|37837_38035_+	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	7.5e-11	57.1
AUT32542.1\|38165_39098_-\|transposase	IS5/IS1182 family transposase	A0A1V0E8E1	Vibrio_phage	3.9e-57	41.0
AUT32543.1\|39264_39450_+	hypothetical protein	NA	NA	NA	NA
39137:39152	attR	NA	NA	NA	NA
AUT32544.1\|39452_39965_+	hypothetical protein	NA	NA	NA	NA
AUT32545.1\|40760_41627_+	WYL domain-containing protein	NA	NA	NA	NA
AUT32546.1\|41637_42249_+	DUF1819 domain-containing protein	NA	NA	NA	NA
AUT32547.1\|42265_42841_+	DUF1788 domain-containing protein	NA	NA	NA	NA
AUT32548.1\|42881_46562_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
AUT32549.1\|46608_50142_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	A0A2R2ZGH5	Clostridioides_phage	4.4e-08	19.2
AUT32550.1\|50138_51509_+	hypothetical protein	NA	NA	NA	NA
AUT32551.1\|51505_54130_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
AUT32552.1\|54159_56199_+\|protease	BREX system Lon protease-like protein BrxL	NA	NA	NA	NA
AUT32553.1\|56262_60993_+	DNA helicase	NA	NA	NA	NA
AUT32554.1\|62415_64371_+	AAA family ATPase	NA	NA	NA	NA
AUT32555.1\|64641_64962_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AUT32556.1\|65937_66621_-	hypothetical protein	NA	NA	NA	NA
AUT32557.1\|67178_67535_+	addiction module toxin RelE	NA	NA	NA	NA
AUT32558.1\|67527_67788_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUT32559.1\|68182_68380_+	hypothetical protein	NA	NA	NA	NA
AUT32560.1\|68596_68824_+	hypothetical protein	NA	NA	NA	NA
AUT32561.1\|69037_70363_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP026089

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP026087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection