CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP026128	Acinetobacter baumannii strain ABNIH28 plasmid pABA-1fe1, complete sequence	0 crisprs	DEDDh	0	2
CP026126	Acinetobacter baumannii strain ABNIH28 plasmid pABA-6973, complete sequence	0 crisprs	NA	0	0
CP026127	Acinetobacter baumannii strain ABNIH28 plasmid pNDM-0285, complete sequence	0 crisprs	NA	0	3
CP026125	Acinetobacter baumannii strain ABNIH28 chromosome, complete genome	2 crisprs	DEDDh,RT,csa3,cas3,WYL,TnsE_C	1	11
CP026129	Acinetobacter baumannii strain ABNIH28 plasmid pABA-2f10, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 80730

Salmonella_phage(31.58%)

terminase,capsid,transposase,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT40036.1\|8922_9501_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	2.5e-25	35.6
AUT40037.1\|9494_10244_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	7.8e-48	40.5
AUT40038.1\|10240_10936_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	2.8e-60	47.3
AUT40039.1\|10935_11262_-\|tail	phage tail protein	D6PGG4	uncultured_phage	9.0e-09	31.1
AUT40040.1\|11334_16923_-\|tail	tail length tape measure protein	NA	NA	NA	NA
AUT40041.1\|16925_17222_-	hypothetical protein	NA	NA	NA	NA
AUT40042.1\|17278_17632_-	hypothetical protein	NA	NA	NA	NA
AUT40043.1\|17726_18272_-	hypothetical protein	A0A2H4P707	Pseudomonas_phage	6.3e-39	52.2
AUT40044.1\|18356_18854_-	hypothetical protein	NA	NA	NA	NA
AUT40045.1\|18853_19240_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.6e-12	32.8
AUT40046.1\|19236_19587_-	hypothetical protein	J9Q7F6	Salmonella_phage	4.3e-09	35.1
AUT40047.1\|19573_20212_-	hypothetical protein	NA	NA	NA	NA
AUT40048.1\|20270_21041_-	hypothetical protein	NA	NA	NA	NA
AUT40049.1\|21047_21542_-	hypothetical protein	L7TKJ9	Rhizobium_phage	6.8e-08	28.7
AUT40050.1\|21680_22583_-\|capsid	phage major capsid protein	A0A2H4P701	Pseudomonas_phage	6.9e-91	58.3
AUT40051.1\|22718_23597_-	hypothetical protein	A0A2H4P6Z8	Pseudomonas_phage	7.3e-13	29.4
AUT40052.1\|23640_25311_-	hypothetical protein	J9Q7R1	Salmonella_phage	8.1e-146	51.9
AUT40053.1\|25356_26601_-\|terminase	terminase	A0A2H4P6Z9	Pseudomonas_phage	1.3e-151	62.4
AUT40054.1\|26610_27216_-	DNA-binding protein	J9Q6D4	Salmonella_phage	4.0e-18	34.3
AUT40055.1\|27368_27770_-	hypothetical protein	NA	NA	NA	NA
AUT40056.1\|27881_28376_-	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	7.0e-05	33.0
AUT40057.1\|28344_28668_-	hypothetical protein	NA	NA	NA	NA
AUT40058.1\|28658_29612_-	hypothetical protein	A0A2H4P6X5	Pseudomonas_phage	4.6e-61	42.1
AUT40059.1\|29650_30073_-	thioredoxin	NA	NA	NA	NA
AUT40060.1\|30069_30726_-	ABC transporter	L7TNS9	Rhizobium_phage	5.9e-60	54.8
AUT40061.1\|30725_31376_-	chromosome partitioning protein ParB	L7TMF9	Rhizobium_phage	3.8e-35	41.9
AUT40062.1\|31372_31975_-	hypothetical protein	NA	NA	NA	NA
AUT40063.1\|32003_32642_-	chromosome partitioning protein ParB	L7TL04	Rhizobium_phage	1.0e-48	46.1
AUT40064.1\|32720_34430_+	ATP-dependent helicase	L7TNS5	Rhizobium_phage	9.8e-131	46.2
AUT40065.1\|34555_34849_+	hypothetical protein	NA	NA	NA	NA
AUT40066.1\|34912_35191_-	hypothetical protein	NA	NA	NA	NA
AUT40067.1\|35225_35795_-	LysM domain-containing protein	NA	NA	NA	NA
AUT40068.1\|36188_36989_-	hypothetical protein	NA	NA	NA	NA
AUT40069.1\|37428_37854_-	hypothetical protein	NA	NA	NA	NA
AUT40070.1\|38492_38858_-	hypothetical protein	NA	NA	NA	NA
AUT40071.1\|40178_40514_+	hypothetical protein	NA	NA	NA	NA
AUT40072.1\|40577_40796_+	hypothetical protein	NA	NA	NA	NA
AUT40073.1\|41305_41554_+	transcriptional regulator	A0A0M3LSW2	Mannheimia_phage	1.3e-07	44.8
AUT40074.1\|41591_42107_-	hypothetical protein	NA	NA	NA	NA
AUT40075.1\|42631_42883_-	hypothetical protein	NA	NA	NA	NA
AUT40076.1\|43010_43232_-	hypothetical protein	NA	NA	NA	NA
AUT40077.1\|43646_45215_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.1e-163	56.5
AUT40078.1\|45214_46462_+	restriction endonuclease subunit S	NA	NA	NA	NA
AUT40079.1\|46471_47383_+	hypothetical protein	NA	NA	NA	NA
AUT40080.1\|47411_50291_+	deoxyribonuclease HsdR	NA	NA	NA	NA
AUT40081.1\|50909_51197_-	hypothetical protein	NA	NA	NA	NA
AUT40082.1\|51523_52384_-	hypothetical protein	A0A2H4P788	Pseudomonas_phage	8.7e-11	28.1
AUT40083.1\|52517_53030_-	hypothetical protein	NA	NA	NA	NA
AUT40084.1\|53029_53314_-	hypothetical protein	NA	NA	NA	NA
AUT40085.1\|53306_53729_-	hypothetical protein	NA	NA	NA	NA
AUT40086.1\|53782_54559_-	hypothetical protein	NA	NA	NA	NA
AUT40087.1\|54845_55325_-	hypothetical protein	NA	NA	NA	NA
AUT40088.1\|55299_55620_-	hypothetical protein	NA	NA	NA	NA
AUT40089.1\|55616_55859_-	hypothetical protein	NA	NA	NA	NA
AUT40090.1\|55855_56395_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	8.9e-38	48.9
AUT40091.1\|56964_58941_+	alkyl/aryl-sulfatase	A0A2P0VMX1	Tetraselmis_virus	3.8e-126	40.1
AUT40092.1\|59381_60314_-\|transposase	IS5-like element IS17 family transposase	A0A1V0E8E1	Vibrio_phage	6.9e-62	42.6
AUT40093.1\|60376_60604_-	hypothetical protein	NA	NA	NA	NA
AUT40094.1\|60603_60888_-	hypothetical protein	NA	NA	NA	NA
AUT40095.1\|60891_61803_-	hypothetical protein	A0A0K2FHE7	Achromobacter_phage	3.5e-66	44.8
AUT40142.1\|61815_62805_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	2.5e-54	38.4
AUT40096.1\|62902_65275_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	3.1e-207	50.7
AUT40097.1\|65296_65677_-	hypothetical protein	NA	NA	NA	NA
AUT40098.1\|65750_66353_-	hypothetical protein	J9Q7Z7	Salmonella_phage	2.4e-31	42.2
AUT40099.1\|66484_67321_-	hypothetical protein	NA	NA	NA	NA
AUT40100.1\|67412_69353_-	recombinase RecF	L7TNH6	Rhizobium_phage	4.1e-117	42.5
AUT40101.1\|69352_70468_-	serine/threonine protein phosphatase	A0A2H4P756	Pseudomonas_phage	8.6e-59	38.1
AUT40102.1\|70501_70723_-	hypothetical protein	NA	NA	NA	NA
AUT40103.1\|71191_71653_-	hypothetical protein	NA	NA	NA	NA
AUT40104.1\|71649_72009_-	hypothetical protein	NA	NA	NA	NA
AUT40105.1\|72096_74295_-	recombinase RecA	J9Q736	Salmonella_phage	3.6e-53	50.7
AUT40106.1\|74297_75335_-	5'-3' exonuclease	J9Q7S6	Salmonella_phage	2.3e-50	36.9
AUT40107.1\|75397_76258_-	hypothetical protein	A0A2H4P7I7	Pseudomonas_phage	1.9e-29	31.5
AUT40108.1\|76400_77489_-	hypothetical protein	A0A2H4P749	Pseudomonas_phage	5.0e-11	35.3
AUT40109.1\|77578_78844_-	hypothetical protein	A0A2H4P750	Pseudomonas_phage	5.9e-72	38.1
AUT40110.1\|78840_79416_-	hypothetical protein	A0A0K0N6H6	Gordonia_phage	1.6e-24	51.3
AUT40143.1\|79464_80730_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	6.2e-114	51.5

DBSCAN-SWA_2

84574 : 105698

Rhizobium_phage(25.0%)

transposase,integrase

attL 76368:76384|attR 99700:99716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
76368:76384	attL	NA	NA	NA	NA
AUT40114.1\|84574_85819_-	porphyrin biosynthesis protein	L7TKP0	Rhizobium_phage	1.6e-85	41.5
AUT40115.1\|85963_87886_-	cobalamin biosynthesis protein CobT	A0A2H4P735	Pseudomonas_phage	1.5e-74	43.0
AUT40116.1\|88126_88321_-	hypothetical protein	NA	NA	NA	NA
AUT40117.1\|88742_89162_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUT40118.1\|89501_90086_+\|integrase	site-specific integrase	A0A0A8WF93	Clostridium_phage	8.9e-07	29.3
AUT40119.1\|90082_90499_-	hypothetical protein	NA	NA	NA	NA
AUT40120.1\|90701_91379_+	partition protein	E5FFJ3	Burkholderia_phage	2.8e-12	26.4
AUT40121.1\|91375_91804_+	hypothetical protein	NA	NA	NA	NA
AUT40122.1\|91791_92412_-	hypothetical protein	NA	NA	NA	NA
AUT40123.1\|92484_93057_-	guanylate kinase	A0A218KC48	Bacillus_phage	9.3e-09	28.5
AUT40124.1\|93533_94742_+\|transposase	IS256 family transposase ISAba26	A0A218MNI5	uncultured_virus	3.1e-46	46.5
AUT40125.1\|94901_96317_-	DNA ligase	A0A2H4P729	Pseudomonas_phage	4.2e-87	40.0
AUT40126.1\|96329_96839_-	hypothetical protein	NA	NA	NA	NA
AUT40127.1\|96835_97444_-	hypothetical protein	NA	NA	NA	NA
AUT40128.1\|97437_97929_-	hypothetical protein	NA	NA	NA	NA
AUT40129.1\|97928_98483_-	hypothetical protein	NA	NA	NA	NA
AUT40130.1\|98546_99641_-	DNA primase	A0A2H4P738	Pseudomonas_phage	1.1e-87	43.7
AUT40131.1\|99728_101132_-	DNA helicase	L7TS87	Rhizobium_phage	1.5e-84	39.0
99700:99716	attR	NA	NA	NA	NA
AUT40132.1\|101168_101600_-	hypothetical protein	NA	NA	NA	NA
AUT40133.1\|101687_102419_-	hypothetical protein	L7TM14	Rhizobium_phage	2.9e-15	26.6
AUT40134.1\|102535_103657_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
AUT40135.1\|104667_105306_-	lysozyme	A0A075DXC6	Acinetobacter_phage	2.2e-67	63.1
AUT40136.1\|105305_105698_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	1.1e-32	55.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP026127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3425

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT39991.1\|933_2451_+	conjugal transfer protein TraM	NA	NA	NA	NA
AUT39992.1\|2469_2670_+	hypothetical protein	NA	NA	NA	NA
AUT39993.1\|2714_3425_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	6.9e-30	50.8

DBSCAN-SWA_2

7813 : 24576

Moraxella_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT39998.1\|7813_8296_+	chromosome partitioning protein ParB	A0A0R6PHV6	Moraxella_phage	3.6e-22	38.0
AUT39999.1\|8292_10005_-	zeta toxin family protein	NA	NA	NA	NA
AUT40000.1\|10188_10413_-	hypothetical protein	NA	NA	NA	NA
AUT40001.1\|10564_11212_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	2.6e-15	31.4
AUT40002.1\|11641_12007_-	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
AUT40003.1\|12010_12823_-	subclass B1 metallo-beta-lactamase NDM-1	NA	NA	NA	NA
AUT40004.1\|12923_13949_-\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
AUT40005.1\|14100_14880_-	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	6.9e-31	34.7
AUT40006.1\|14985_16130_-\|transposase	IS3-like element ISAba14 family transposase	S5WIU1	Leptospira_phage	2.3e-14	28.1
AUT40007.1\|16180_16663_+	hypothetical protein	NA	NA	NA	NA
AUT40008.1\|16724_17177_-	hypothetical protein	NA	NA	NA	NA
AUT40009.1\|17187_18432_-	DUF1173 domain-containing protein	NA	NA	NA	NA
AUT40010.1\|18446_21359_-	conjugal transfer protein TraA	A0A2P0VMS9	Tetraselmis_virus	4.4e-06	23.9
AUT40011.1\|21890_22427_+	conjugal transfer protein TraD	NA	NA	NA	NA
AUT40012.1\|22650_22881_-	hypothetical protein	NA	NA	NA	NA
AUT40013.1\|22867_23290_-	hypothetical protein	NA	NA	NA	NA
AUT40014.1\|23450_23687_-	hypothetical protein	NA	NA	NA	NA
AUT40015.1\|23748_24576_-	conjugal transfer protein TraC	H7BV66	unidentified_phage	2.5e-15	32.8

DBSCAN-SWA_3

29801 : 30491

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT40024.1\|29801_30491_-	cobyrinic acid a,c-diamide synthase	W0LIU2	Mycobacterium_phage	8.0e-15	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP026125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026125_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026125_3

976469-976580

Orphan

Consensus_repeat	Method
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026125_3

>merge|CP026125|3|976469-976580|CRISPRCasFinder
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGAGCTGTGCTCGAGTGGAAGAGGATAAACAAAGCAACGCTTTGCCGTGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA

>CP026125|3|3|976469-976580|CRISPRCasFinder
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA	GCTGTGCTCGAGTGGAAGAGGATAAACAAAGCAACGCTTTGCCG
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA

Protein	Signature genes	Signature genes Name	Protein_function
CP026125.1\|AUT37405.1\|970479_971538_+\|butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP026125.1\|AUT37414.1\|980515_980911_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP026125.1\|AUT37418.1\|985297_986230_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
CP026125.1\|AUT37407.1\|972566_973838_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
CP026125.1\|AUT37408.1\|974029_974725_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP026125.1\|AUT37410.1\|976643_977435_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP026125.1\|AUT37416.1\|981698_983048_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|273350
CP026125.1\|AUT37400.1\|964700_965663_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP026125.1\|AUT37411.1\|977543_978548_+\|homoserine-dehydrogenase	unknown	unknown	gnl\|CDD\|168683
CP026125.1\|AUT37404.1\|969664_970450_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|187624
CP026125.1\|AUT37415.1\|981006_981615_+\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
CP026125.1\|AUT37406.1\|971585_972497_-\|bestrophin	unknown	unknown	gnl\|CDD\|376448
CP026125.1\|AUT37401.1\|965676_966696_+\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP026125.1\|AUT37409.1\|974734_976390_+\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|350353
CP026125.1\|AUT37403.1\|968234_969638_+\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP026125.1\|AUT37419.1\|986237_987686_-\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
CP026125.1\|AUT37413.1\|979664_980519_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP026125.1\|AUT37412.1\|978580_979498_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP026125.1\|AUT37402.1\|966697_968224_+\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP026125.1\|AUT37417.1\|983289_984033_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099

Protein	Function_ID	Function_description	E-value
CP026125.1\|AUT37405.1\|970479_971538_+\|butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP026125.1\|AUT37414.1\|980515_980911_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
CP026125.1\|AUT37418.1\|985297_986230_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	2.14462e-50
CP026125.1\|AUT37407.1\|972566_973838_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	8.09636e-122
CP026125.1\|AUT37408.1\|974029_974725_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	5.85405e-90
CP026125.1\|AUT37410.1\|976643_977435_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.21456e-23
CP026125.1\|AUT37416.1\|981698_983048_-\|chromate-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	2.04051e-60
CP026125.1\|AUT37400.1\|964700_965663_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP026125.1\|AUT37411.1\|977543_978548_+\|homoserine-dehydrogenase	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	9.58995e-79
CP026125.1\|AUT37404.1\|969664_970450_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.17932e-115
CP026125.1\|AUT37415.1\|981006_981615_+\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	5.30462e-86
CP026125.1\|AUT37406.1\|971585_972497_-\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	8.96989e-82
CP026125.1\|AUT37401.1\|965676_966696_+\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	3.26675e-168
CP026125.1\|AUT37409.1\|974734_976390_+\|TIGR01244-family-phosphatase	gnl\|CDD\|350353	cd14503, PTP-bact, bacterial tyrosine-protein phosphataseS similar to Neisseria NMA1982. This subfamily is composed of bacterial tyrosine-protein phosphatases similar to Neisseria meningitidis NMA1982, which displays phosphatase activity but whose biological function is still unknown.	1.86933e-37
CP026125.1\|AUT37403.1\|968234_969638_+\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP026125.1\|AUT37419.1\|986237_987686_-\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
CP026125.1\|AUT37413.1\|979664_980519_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
CP026125.1\|AUT37412.1\|978580_979498_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.91074e-15
CP026125.1\|AUT37402.1\|966697_968224_+\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	5.34065e-113
CP026125.1\|AUT37417.1\|983289_984033_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.95412e-75

>CP026125.1|AUT37409.1|974734_976390_+|TIGR01244-family-phosphatase
MELKRVNQDFYVAGQITANDIVKIADQGIKTLICNRPDGEGADQPNVIEIEEAAQRHGLNVIYQPVISGKVTDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPSDAALLVESGNKLGFNLKGLVPRILKRDHEPATIPCYSVVIVGAGAAGISVASSLLCREPHLDIVIIDPADTHYYQPGWTMVGGGIFKPQVTARSMASVIPSKVKWMKAAVAGFDPEHNQVILEGCQPIQYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNGGKAIFTQPPMPIKCAGAPQKAMYLSADYWLKQGKLKDISIHFYNTGAVLFGVKEYVPALMQYVEKYGSELHFNHQLVKVDGPAKKAWFKVVNDENAALVETDFDMLHVVPPQQAPDFIRASTLTDEAGWVSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARAQAPIVAVNVLAQLNGEQNFCEYNGYGSCPLTVERGKIVLAEFGYGGKLLPSFPKWIIDGQKPSRLAWLLKEQILPPIYWQGMLKGREWMVKPERG
>CP026125.1|AUT37408.1|974029_974725_+|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETREAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAANLLRERFHCKSVLHRNSEVSCGDILITDGCMIKVGNLSIEARYTPGHTNACTSYLVGNMIFTGDALLIDGCGRTDFQQGNAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSSTIGYERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>CP026125.1|AUT37407.1|972566_973838_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFESEQDFFILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENMAALTQDHHNQYLEVNTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIVDEVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAWRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEIEDLPNELLNAEDYVKLPETNAELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>CP026125.1|AUT37406.1|971585_972497_-|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEQREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYGTLTRHIVELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>CP026125.1|AUT37405.1|970479_971538_+|butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGEGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP026125.1|AUT37404.1|969664_970450_+|3-oxoacyl-ACP-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP026125.1|AUT37403.1|968234_969638_+|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFSGRAQLTAKEKIEVTDAQGNSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVKNVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDTSGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP026125.1|AUT37402.1|966697_968224_+|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIERFIASLGGSAAQAPSEQSKAETSAPVAEKAEQPQTVAVSASAPVKVAKDDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTPVNEQPLQCATQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEDLQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP026125.1|AUT37401.1|965676_966696_+|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENQLEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP026125.1|AUT37400.1|964700_965663_+|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP026125.1|AUT37410.1|976643_977435_+|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYIVIKIVNLTNI
>CP026125.1|AUT37411.1|977543_978548_+|homoserine-dehydrogenase
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTKYQVGLTEQKFLEQVQAEVIIETGPSDYMTGGKGLFYLNYALTHSMNAIAVSKGALVVDGKKLINLAHQQNKKLFFSGATAAALPTVDLFEYNLAGCQILEVEGVFTGTTNFILNDMLQHECAFTESLEKAQAKGIAEPDSSFDVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTTEHIRDWKKENVIPRLVGFIHIKNLQIQTGVELRLVPANHPFAHLQGSNKCIRVLTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>CP026125.1|AUT37412.1|978580_979498_-|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCVIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKNCEKQA
>CP026125.1|AUT37413.1|979664_980519_+|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>CP026125.1|AUT37414.1|980515_980911_-|transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>CP026125.1|AUT37415.1|981006_981615_+|FMN-dependent-NADH-azoreductase
MKLLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNETAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>CP026125.1|AUT37416.1|981698_983048_-|chromate-transporter
MQQKQLNTPDDSVEQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWVVAIAAFFAIFVLKLPFPLIVLSAGIAGYLTSKKYPELFSSAAGHKASQKDYGPAYIDDDTPTPEHAKFHWSRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFIFIFAGAPIIESTHNEIKFTAPLTAITSAVVGVILNLALFFSYHVLWPQGFSGHFDIVAALITVAAFIALFRFNINVLYVIFASALVGLAVTFF
>CP026125.1|AUT37417.1|983289_984033_+|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQIPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLPEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>CP026125.1|AUT37418.1|985297_986230_-|IS5-family-transposase
MNKPASKIYRTTNWSSYNRALINRGNISIWLDPKTQWYAQSQGKQGRNQTYSDTAIQCCLMIKLLFRLSLRMVTGFVQSLIKLSGLDWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLVDSTGLKFLGEGEWKRKKHGAEYRRQWRKLHIAIDAKTLQIRAVQLTTNNVSDSQVIEDLLAQIPLDEPIDSVYTDGAYDTKHCRQVILDRDAHAIIPPRKNAKPWKDQQARSIERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIKLLGDKLTARSFPSQVNEIHARMAVLNKFTELGRPHTQVVS
>CP026125.1|AUT37419.1|986237_987686_-|aspartate-ammonia-lyase
MMNADITTRIEKDLIGHREINNDHYYGVQTLRALENFNLTNSKVGNFPNLIKALAMVKLACAEANYNLKNLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHSKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFLNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALGKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQTKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQVLDDILSINNMVKRLCCTNLASKAYSAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026125_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026125_4

1256917-1257058

Orphan

Consensus_repeat	Method
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026125_4

>merge|CP026125|4|1256917-1257058|CRISPRCasFinder
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACTATGTTCATCTTGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACT

>CP026125|4|4|1256917-1257058|CRISPRCasFinder
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACT	ATGTTCATCTTGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGT
TTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACT

Protein	Signature genes	Signature genes Name	Protein_function
CP026125.1\|AUT37644.1\|1256086_1256446_-\|hypothetical-protein	unknown	unknown	unknown
CP026125.1\|AUT37649.1\|1258327_1259536_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056
CP026125.1\|AUT37650.1\|1259763_1260105_+\|monothiol-glutaredoxin,-Grx4-family	unknown	unknown	gnl\|CDD\|188046
CP026125.1\|AUT37638.1\|1251854_1252154_+\|cytochrome-bd-biosynthesis-protein	unknown	unknown	gnl\|CDD\|370577
CP026125.1\|AUT37653.1\|1261672_1262467_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
CP026125.1\|AUT37642.1\|1254445_1255552_-\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
CP026125.1\|AUT37639.1\|1252166_1252691_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP026125.1\|AUT37641.1\|1253660_1254257_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226090
CP026125.1\|AUT37652.1\|1260718_1261621_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
CP026125.1\|AUT37636.1\|1250593_1251739_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
CP026125.1\|AUT37646.1\|1257067_1257256_+\|hypothetical-protein	unknown	unknown	unknown
CP026125.1\|AUT37640.1\|1252763_1253435_-\|DUF2057-domain-containing-protein	unknown	unknown	gnl\|CDD\|378258
CP026125.1\|AUT37637.1\|1251752_1251854_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
CP026125.1\|AUT37643.1\|1255659_1255986_-\|hypothetical-protein	unknown	unknown	unknown
CP026125.1\|AUT37648.1\|1257844_1258276_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391
CP026125.1\|AUT37647.1\|1257278_1257704_+\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
CP026125.1\|AUT37654.1\|1262819_1264121_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331
CP026125.1\|AUT37645.1\|1256661_1256895_+\|hypothetical-protein	unknown	unknown	unknown
CP026125.1\|AUT37651.1\|1260151_1260475_-\|hypothetical-protein	unknown	unknown	unknown
CP026125.1\|AUT37655.1\|1264312_1264732_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225734

Protein	Function_ID	Function_description	E-value
CP026125.1\|AUT37649.1\|1258327_1259536_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0
CP026125.1\|AUT37650.1\|1259763_1260105_+\|monothiol-glutaredoxin,-Grx4-family	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
CP026125.1\|AUT37638.1\|1251854_1252154_+\|cytochrome-bd-biosynthesis-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
CP026125.1\|AUT37653.1\|1261672_1262467_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	7.03372e-151
CP026125.1\|AUT37642.1\|1254445_1255552_-\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	4.65167e-180
CP026125.1\|AUT37639.1\|1252166_1252691_-\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.5551e-05
CP026125.1\|AUT37641.1\|1253660_1254257_-\|oxidoreductase	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
CP026125.1\|AUT37636.1\|1250593_1251739_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	5.17683e-149
CP026125.1\|AUT37640.1\|1252763_1253435_-\|DUF2057-domain-containing-protein	gnl\|CDD\|378258	pfam09829, DUF2057, Uncharacterized protein conserved in bacteria (DUF2057). This domain, found in various prokaryotic proteins, has no known function.	7.85362e-29
CP026125.1\|AUT37637.1\|1251752_1251854_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06
CP026125.1\|AUT37652.1\|1260718_1261621_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.95489e-97
CP026125.1\|AUT37648.1\|1257844_1258276_+\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56
CP026125.1\|AUT37647.1\|1257278_1257704_+\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	2.46415e-20
CP026125.1\|AUT37654.1\|1262819_1264121_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	7.47656e-171
CP026125.1\|AUT37655.1\|1264312_1264732_+\|hypothetical-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	5.66012e-31

>CP026125.1|AUT37645.1|1256661_1256895_+|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>CP026125.1|AUT37644.1|1256086_1256446_-|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>CP026125.1|AUT37643.1|1255659_1255986_-|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLRPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHNHIKQYPALAQEDTQ
>CP026125.1|AUT37642.1|1254445_1255552_-|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEASPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETEK
>CP026125.1|AUT37641.1|1253660_1254257_-|oxidoreductase
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>CP026125.1|AUT37640.1|1252763_1253435_-|DUF2057-domain-containing-protein
MTLRLSVAAMGLLLSGSVFSAVTITVPEEIVILAVNGQEVNSGLFRSSKNNYKVDAGETSLSVRYQEYFEHLSGEHDIVKSGVVTIQTPALKDGQTYKLAMVDAPKQFEQAKKYAEQPTVALYNSNNELIVQQTGANNEARPWFASGLLGKVTDFTTKSSKQQPDAVYAAAKPTTTQANAPVATTMPATGVAQTNDQRLAEIWKKSSKAERQKFMAWLAEQSN
>CP026125.1|AUT37639.1|1252166_1252691_-|N-acetyltransferase
MIKLNFRLAEFSDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRSVLEYAEQFALYKLPELDSAIMYVLNVRSELIAYYERRGYIKTGNHEPYPLDANVGLPLIPIKLIEMKKDLK
>CP026125.1|AUT37638.1|1251854_1252154_+|cytochrome-bd-biosynthesis-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>CP026125.1|AUT37637.1|1251752_1251854_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>CP026125.1|AUT37636.1|1250593_1251739_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYSVAFSGMYWALLLVLFALFLRPVGFDYRSKLENAQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFLALLNPFALVCGIVSLSMLCAHGGAWLMLRTDGDLKQRSAKATQIMAAIFLVCFLVIGVWLYFGQVPGYSYAAAVDSNAALNPLAKEVVTNNNPGWMNNYSSYPITKVAPVLAILGAIIAFFTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>CP026125.1|AUT37646.1|1257067_1257256_+|hypothetical-protein
MRFAKALAALSCSGGIFLYLYKTKITYLSKALLRHFSRDLESPPYPAFICIDISTHQYLFTI
>CP026125.1|AUT37647.1|1257278_1257704_+|DUF2750-domain-containing-protein
MWFSYNKQDKLKTFKFKMNSLSNLQPVSKDLMIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>CP026125.1|AUT37648.1|1257844_1258276_+|CBS-domain-containing-protein
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>CP026125.1|AUT37649.1|1258327_1259536_-|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYTQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTQQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEGFVRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQICNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENSAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGIQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>CP026125.1|AUT37650.1|1259763_1260105_+|monothiol-glutaredoxin,-Grx4-family
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>CP026125.1|AUT37651.1|1260151_1260475_-|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEEVMNQNVDELHEDPNINIFDAITTTPYKNLTILKADLGVDGLFRYVGISDC
>CP026125.1|AUT37652.1|1260718_1261621_+|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVCLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>CP026125.1|AUT37653.1|1261672_1262467_-|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHAVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>CP026125.1|AUT37654.1|1262819_1264121_+|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFMTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPAPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACMVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>CP026125.1|AUT37655.1|1264312_1264732_+|hypothetical-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQSS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	AP013861	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15H-MedDCM-OCT-S40-C106, * SEQUENCING IN PROGRESS *	15391-15415	3	0.88
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	NC_010630	Nostoc punctiforme PCC 73102 plasmid pNPUN03, complete sequence	18448-18472	3	0.88
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	MN856032	Bacteriophage sp. isolate 242, complete genome	4970-4994	4	0.84
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	NC_015937	Thermus phage TMA, complete genome	130919-130943	4	0.84
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	MN693192	Marine virus AFVG_25M42, complete genome	30603-30627	4	0.84
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	GU071095	Synechococcus phage S-SM2, complete genome	177140-177164	4	0.84
CP026125_1	1.2\|637955\|25\|CP026125\|CRISPRCasFinder	637955-637979	25	AP011617	Thermus phage TMA DNA, complete genome	130919-130943	4	0.84

1. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to AP013861 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15H-MedDCM-OCT-S40-C106, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.88

ctggttattttgttgctgttgatta	CRISPR spacer
ctggtaattttgttactgttgattt	Protospacer
***** ********.*********

2. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to NC_010630 (Nostoc punctiforme PCC 73102 plasmid pNPUN03, complete sequence) position: , mismatch: 3, identity: 0.88

ctggttattttgttgctgttgatta	CRISPR spacer
caggctattttgttgctgctgatta	Protospacer
* **.*************.******

3. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to MN856032 (Bacteriophage sp. isolate 242, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
tggtttattttgttgctgttgaata	Protospacer
. * ****************** **

4. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to NC_015937 (Thermus phage TMA, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caaattattttgttgcttttgatta	Protospacer
* ..************* *******

5. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to MN693192 (Marine virus AFVG_25M42, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
gtggttcttttgttgcttttgattc	Protospacer
 ***** ********** ******

6. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to GU071095 (Synechococcus phage S-SM2, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caccttattttgttgctattgatta	Protospacer
*   *************.*******

7. spacer 1.2|637955|25|CP026125|CRISPRCasFinder matches to AP011617 (Thermus phage TMA DNA, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caaattattttgttgcttttgatta	Protospacer
* ..************* *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

89879 : 157255

Escherichia_phage(19.05%)

terminase,transposase,integrase

attL 118659:118677|attR 143710:143728

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT36599.1\|89879_91871_+\|terminase	terminase	A0A077SK57	Escherichia_phage	3.6e-07	54.9
AUT36600.1\|91943_93545_+	sperm-activating peptide	NA	NA	NA	NA
AUT36601.1\|93559_93838_+	hypothetical protein	NA	NA	NA	NA
AUT36602.1\|93839_94970_+	hypothetical protein	A0A222YXT1	Escherichia_phage	1.3e-22	35.2
AUT36603.1\|94959_95508_+	hypothetical protein	NA	NA	NA	NA
AUT36604.1\|95504_95807_+	hypothetical protein	NA	NA	NA	NA
AUT36605.1\|95961_97740_+	hypothetical protein	NA	NA	NA	NA
AUT36606.1\|97803_98430_+	hypothetical protein	NA	NA	NA	NA
AUT36607.1\|98434_98722_+	hypothetical protein	NA	NA	NA	NA
AUT36608.1\|98840_100136_+	hypothetical protein	NA	NA	NA	NA
AUT36609.1\|100157_100925_+	hypothetical protein	NA	NA	NA	NA
AUT36610.1\|100986_101265_+	hypothetical protein	NA	NA	NA	NA
AUT36611.1\|101350_102247_-	hypothetical protein	A5VW58	Enterobacteria_phage	7.4e-45	42.0
AUT36612.1\|102453_102705_+	transcriptional regulator	NA	NA	NA	NA
AUT36613.1\|103250_103526_+	antitoxin	NA	NA	NA	NA
AUT36614.1\|103488_103755_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	5.2e-15	51.2
AUT36615.1\|103881_104526_+	hypothetical protein	NA	NA	NA	NA
AUT36616.1\|104525_104975_+	hypothetical protein	NA	NA	NA	NA
AUT36617.1\|104974_105868_+	hypothetical protein	NA	NA	NA	NA
AUT36618.1\|105877_115456_+	hypothetical protein	A0A126DKX0	Acinetobacter_phage	1.0e-128	31.3
AUT36619.1\|115456_115855_+	hypothetical protein	G4WT78	Acinetobacter_phage	7.8e-47	69.7
AUT36620.1\|115854_116625_+	hypothetical protein	G4WT79	Acinetobacter_phage	3.2e-81	79.5
AUT36621.1\|116652_116847_-	hypothetical protein	NA	NA	NA	NA
AUT36622.1\|117006_118542_+	hypothetical protein	A0A222YXQ7	Escherichia_phage	1.2e-31	26.2
AUT36623.1\|118541_119195_+	hypothetical protein	NA	NA	NA	NA
118659:118677	attL	NA	NA	NA	NA
AUT36624.1\|119268_121221_+	hypothetical protein	NA	NA	NA	NA
AUT36625.1\|121220_122732_+	hypothetical protein	A0A222YY44	Escherichia_phage	6.8e-83	42.8
AUT36626.1\|122807_126638_+	methyltransferase type 11	A0A1Y0T2N3	Pseudomonas_phage	1.4e-198	43.0
AUT36627.1\|126763_127213_+	hypothetical protein	NA	NA	NA	NA
AUT36628.1\|127287_128100_+	hypothetical protein	NA	NA	NA	NA
AUT36629.1\|128099_128795_+	hypothetical protein	NA	NA	NA	NA
AUT36630.1\|128787_129006_+	hypothetical protein	NA	NA	NA	NA
AUT36631.1\|129127_129415_+	hypothetical protein	NA	NA	NA	NA
AUT36632.1\|129411_130182_+	TIGR02594 family protein	A0A0B5L5G5	Acinetobacter_phage	1.7e-151	98.4
AUT36633.1\|130307_130667_-	hypothetical protein	NA	NA	NA	NA
AUT36634.1\|131050_131749_-	hypothetical protein	NA	NA	NA	NA
AUT36635.1\|131902_133201_-	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	2.3e-156	62.4
AUT36636.1\|133197_133698_-	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	6.3e-46	57.8
AUT36637.1\|133839_134475_-	DUF159 family protein	A0A218MNF5	uncultured_virus	3.0e-69	57.4
AUT36638.1\|134623_135289_+	hypothetical protein	NA	NA	NA	NA
AUT36639.1\|135666_137019_+\|integrase	integrase	A0A2H4JAT5	uncultured_Caudovirales_phage	5.7e-73	39.0
AUT36640.1\|137194_138418_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.2e-43	44.3
AUT36641.1\|138552_139917_-	DUF3987 domain-containing protein	NA	NA	NA	NA
AUT36642.1\|139918_140113_-	hypothetical protein	NA	NA	NA	NA
AUT36643.1\|140231_141128_-	hypothetical protein	NA	NA	NA	NA
AUT36644.1\|141235_141748_-	hypothetical protein	NA	NA	NA	NA
AUT36645.1\|141829_144709_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
143710:143728	attR	NA	NA	NA	NA
AUT36646.1\|145559_145913_-	restriction endonuclease subunit S	NA	NA	NA	NA
AUT36647.1\|146010_146421_+	hypothetical protein	NA	NA	NA	NA
AUT36648.1\|146853_147636_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	5.5e-20	32.4
AUT36649.1\|147635_149204_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.4e-162	56.4
AUT36650.1\|149320_150067_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT36651.1\|150316_151321_-	hypothetical protein	NA	NA	NA	NA
AUT36652.1\|153191_153914_+	TIR domain-containing protein	NA	NA	NA	NA
AUT36653.1\|154294_154750_+	hypothetical protein	NA	NA	NA	NA
AUT36654.1\|154860_155049_+	hypothetical protein	NA	NA	NA	NA
AUT36655.1\|155315_156248_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	4.5e-61	42.3
AUT36656.1\|156508_157255_-\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9

DBSCAN-SWA_2

231587 : 293270

Planktothrix_phage(16.67%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT36717.1\|231587_232205_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AUT36718.1\|232362_233001_+	Fe-S biogenesis protein NfuA	NA	NA	NA	NA
AUT36719.1\|233170_235435_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
AUT36720.1\|235457_236465_-	hypothetical protein	NA	NA	NA	NA
AUT36721.1\|237793_238408_+	carbonate dehydratase	NA	NA	NA	NA
AUT36722.1\|238440_239064_-	arylesterase	NA	NA	NA	NA
AUT36723.1\|239108_239801_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-31	37.5
AUT36724.1\|239804_242264_+	ABC transporter permease	NA	NA	NA	NA
AUT36725.1\|242265_243075_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AUT36726.1\|243151_243829_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AUT36727.1\|243933_246012_+	polyphosphate kinase 1	NA	NA	NA	NA
AUT36728.1\|246065_246194_-	hypothetical protein	NA	NA	NA	NA
AUT36729.1\|246251_246842_+	cell division protein	NA	NA	NA	NA
AUT36730.1\|246872_247781_-	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
AUT39822.1\|247787_248687_-	alpha/beta hydrolase	NA	NA	NA	NA
AUT36731.1\|248786_249968_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AUT36732.1\|250060_250225_-	rubredoxin	NA	NA	NA	NA
AUT36733.1\|250668_251106_+	SRPBCC domain-containing protein	NA	NA	NA	NA
AUT36734.1\|251175_251664_-	esterase	NA	NA	NA	NA
AUT39823.1\|251920_253450_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	7.1e-88	38.0
AUT36735.1\|253639_255082_+	capsule assembly Wzi family protein	NA	NA	NA	NA
AUT36736.1\|255340_255469_+	hypothetical protein	NA	NA	NA	NA
AUT36737.1\|255465_256374_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
AUT36738.1\|256404_258018_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	2.6e-40	27.2
AUT36739.1\|258069_258618_-	DUF2239 domain-containing protein	NA	NA	NA	NA
AUT36740.1\|258839_259352_+	hypothetical protein	NA	NA	NA	NA
AUT36741.1\|259398_260736_-	citrate transporter	NA	NA	NA	NA
AUT36742.1\|261289_262615_-	HlyC/CorC family transporter	NA	NA	NA	NA
AUT36743.1\|262738_263728_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUT36744.1\|264316_265921_+	isocitrate lyase	NA	NA	NA	NA
AUT36745.1\|265983_266463_-	copper resistance protein NlpE	NA	NA	NA	NA
AUT39824.1\|266666_266975_-	hypothetical protein	NA	NA	NA	NA
AUT36746.1\|267184_268060_+	urease accessory protein UreD	NA	NA	NA	NA
AUT36747.1\|268161_268464_+	urease subunit gamma	NA	NA	NA	NA
AUT36748.1\|268475_268796_+	urease subunit beta	NA	NA	NA	NA
AUT39825.1\|268785_269244_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUT36749.1\|269256_270957_+	urease subunit alpha	NA	NA	NA	NA
AUT36750.1\|271026_271509_+	urease accessory protein UreE	NA	NA	NA	NA
AUT36751.1\|271495_272161_+	urease accessory protein	NA	NA	NA	NA
AUT36752.1\|272187_272802_+	urease accessory protein UreG	NA	NA	NA	NA
AUT36753.1\|272811_273381_+	urease accessory protein	NA	NA	NA	NA
AUT36754.1\|273422_273974_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AUT36755.1\|273973_275992_-	penicillin-binding protein 2	NA	NA	NA	NA
AUT36756.1\|276228_276747_+	hypothetical protein	NA	NA	NA	NA
AUT36757.1\|276808_278122_+	hypothetical protein	NA	NA	NA	NA
AUT36758.1\|278208_278862_+	adenylate kinase	NA	NA	NA	NA
AUT39826.1\|279100_279778_-	endonuclease III	NA	NA	NA	NA
AUT36759.1\|279793_280585_-	iron-sulfur protein	NA	NA	NA	NA
AUT36760.1\|280856_282260_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
AUT36761.1\|282315_283425_-	META domain-containing protein	NA	NA	NA	NA
AUT36762.1\|283594_284371_-	dioxygenase	NA	NA	NA	NA
AUT36763.1\|284483_284963_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AUT36764.1\|285262_287692_-\|protease	Lon protease	A0A0R6PGP8	Moraxella_phage	8.4e-277	62.7
AUT36765.1\|288164_288987_-\|transposase	IS5 family transposase ISAba27	NA	NA	NA	NA
AUT36766.1\|289249_290182_-\|transposase	IS5/IS1182 family transposase	Q1MVF0	Enterobacteria_phage	1.7e-60	42.0
AUT36767.1\|292061_293270_-\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	6.9e-46	46.5

DBSCAN-SWA_3

339217 : 424347

101

Acinetobacter_phage(60.32%)

terminase,integrase,capsid,head,lysis,transposase,tail,tRNA

attL 371920:371940|attR 421626:421646

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT36801.1\|339217_340150_-\|transposase	IS5 family transposase ISAba13	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6
AUT36802.1\|341003_341882_+	NLPA lipoprotein	NA	NA	NA	NA
AUT36803.1\|342345_343107_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-67	53.1
AUT36804.1\|343776_343959_-	hypothetical protein	NA	NA	NA	NA
AUT36805.1\|344043_344691_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUT36806.1\|344822_345293_-	hypothetical protein	NA	NA	NA	NA
AUT36807.1\|345592_346264_+	hypothetical protein	NA	NA	NA	NA
AUT36808.1\|346281_346650_+	DUF4810 domain-containing protein	NA	NA	NA	NA
AUT36809.1\|346646_347324_+	hypothetical protein	NA	NA	NA	NA
AUT36810.1\|347467_347827_-	hypothetical protein	NA	NA	NA	NA
AUT36811.1\|348208_349567_-	amino acid permease	NA	NA	NA	NA
AUT36812.1\|349712_351158_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AUT36813.1\|351177_352509_-	amino acid permease	NA	NA	NA	NA
AUT36814.1\|352704_353412_-	histidine kinase	NA	NA	NA	NA
AUT36815.1\|353477_354197_-	FCD domain-containing protein	NA	NA	NA	NA
AUT36816.1\|354256_355027_-	polyketide cyclase	NA	NA	NA	NA
AUT36817.1\|355055_356486_-	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
AUT39833.1\|356804_357227_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AUT36818.1\|357362_358598_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.2e-23	28.4
AUT36819.1\|359038_359971_+\|transposase	IS5 family transposase ISAba13	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6
AUT36820.1\|360008_360938_+	metal-dependent hydrolase	NA	NA	NA	NA
AUT36821.1\|361003_361834_+	KR domain-containing protein	NA	NA	NA	NA
AUT36822.1\|361857_363408_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AUT36823.1\|363776_364004_+	hypothetical protein	NA	NA	NA	NA
AUT36824.1\|364327_365647_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.8e-59	35.8
AUT36825.1\|365758_366757_+	adenosine deaminase	NA	NA	NA	NA
AUT36826.1\|366807_368186_-\|transposase	transposase	A0A1B1P773	Bacillus_phage	1.8e-74	51.5
AUT36827.1\|368268_368826_-	cytochrome b	NA	NA	NA	NA
AUT36828.1\|369066_369456_+	hypothetical protein	NA	NA	NA	NA
AUT36829.1\|369521_370088_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.4e-25	42.4
AUT36830.1\|370157_370412_-	carbon storage regulator	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
AUT36831.1\|370658_371939_-	aspartate kinase	NA	NA	NA	NA
371920:371940	attL	NA	NA	NA	NA
AUT36832.1\|372148_372364_-	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
AUT36833.1\|372365_372623_-	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	2.2e-42	90.5
AUT36834.1\|372626_372911_-	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	7.5e-44	95.7
AUT36835.1\|372907_373117_-	hypothetical protein	A0A0P0IVS1	Acinetobacter_phage	6.3e-32	98.6
AUT36836.1\|373119_373365_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	3.3e-40	98.8
AUT36837.1\|373366_374368_-	hypothetical protein	A0A0P0IKV7	Acinetobacter_phage	6.5e-175	92.2
AUT36838.1\|374364_375486_-	AAA family ATPase	A0A0N7IRE0	Acinetobacter_phage	5.7e-212	99.7
AUT36839.1\|375497_375821_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	2.1e-42	77.6
AUT36840.1\|375813_376104_-	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	1.6e-49	99.0
AUT36841.1\|376103_376544_-	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	2.3e-76	100.0
AUT36842.1\|376771_377563_-	helix-turn-helix domain-containing protein	A0A0R6PH50	Moraxella_phage	1.4e-10	52.1
AUT36843.1\|377565_377814_+	Cro/Cl family transcriptional regulator	A0A0R6PH31	Moraxella_phage	8.0e-18	58.6
AUT36844.1\|377868_378369_+	hypothetical protein	NA	NA	NA	NA
AUT39834.1\|378418_378691_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	1.7e-37	95.5
AUT36845.1\|378687_378984_+	hypothetical protein	A0A0D4DCL5	Acinetobacter_phage	4.0e-48	98.0
AUT36846.1\|378980_379343_+	hypothetical protein	A0A0D4DBI9	Acinetobacter_phage	9.2e-55	98.3
AUT36847.1\|379335_380265_+	hypothetical protein	A0A0P0I481	Acinetobacter_phage	3.7e-172	99.4
AUT36848.1\|380257_381007_+	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	1.2e-136	98.4
AUT36849.1\|381125_381533_+	HNH endonuclease	K7P7B7	Enterobacteria_phage	2.3e-25	48.8
AUT39835.1\|381628_381847_+	hypothetical protein	A0A0P0IY41	Acinetobacter_phage	1.7e-19	90.7
AUT36850.1\|381843_382248_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.6e-21	50.0
AUT36851.1\|382250_382664_+	antitermination protein	NA	NA	NA	NA
AUT39836.1\|382961_383498_+	hypothetical protein	NA	NA	NA	NA
AUT36852.1\|383608_384774_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.6e-164	99.6
AUT36853.1\|384976_385618_+	hypothetical protein	J7I4N9	Acinetobacter_phage	1.3e-123	97.7
AUT36854.1\|385676_386147_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	3.0e-82	100.0
AUT36855.1\|386136_387564_+\|terminase	terminase	A0A0D4DCE6	Acinetobacter_phage	3.6e-259	90.5
AUT36856.1\|387560_389006_+	hypothetical protein	A0A0D4DCP1	Acinetobacter_phage	2.2e-256	89.8
AUT36857.1\|389012_390116_+\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	1.3e-205	99.5
AUT36858.1\|390124_390553_+	hypothetical protein	J7I4P3	Acinetobacter_phage	3.4e-72	99.3
AUT36859.1\|390651_390894_+	hypothetical protein	A0A0P0IY55	Acinetobacter_phage	2.1e-39	100.0
AUT36860.1\|391111_391303_+	hypothetical protein	A0A0P0IKM2	Acinetobacter_phage	1.7e-28	100.0
AUT36861.1\|391416_392184_+	hypothetical protein	J7I0W4	Acinetobacter_phage	2.1e-117	89.8
AUT36862.1\|392211_393165_+\|capsid	phage capsid protein	A0A0D4DBM4	Acinetobacter_phage	1.2e-167	94.0
AUT36863.1\|393229_393895_+	stress-responsive nuclear envelope protein	J7I4P7	Acinetobacter_phage	5.2e-80	72.4
AUT36864.1\|393899_394289_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	6.2e-65	96.9
AUT36865.1\|394245_394659_+	glutamate 5-kinase	J7I467	Acinetobacter_phage	1.5e-53	73.0
AUT36866.1\|394667_395042_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.2e-57	88.6
AUT36867.1\|395043_395271_+	hypothetical protein	NA	NA	NA	NA
AUT36868.1\|395236_395605_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	3.3e-52	81.1
AUT36869.1\|395606_396005_+	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	1.1e-48	65.9
AUT36870.1\|396122_397058_+	hypothetical protein	A0A059VG08	Pseudomonas_phage	9.1e-54	38.8
AUT36871.1\|397107_397641_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	4.0e-46	61.9
AUT36872.1\|397661_397901_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	7.7e-26	75.0
AUT36873.1\|397969_398152_+	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	1.8e-27	95.0
AUT36874.1\|398216_398621_+	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	1.3e-62	89.6
AUT36875.1\|398703_399051_+	hypothetical protein	NA	NA	NA	NA
AUT39837.1\|399491_399680_+	hypothetical protein	NA	NA	NA	NA
AUT36876.1\|399843_403917_+\|tail	phage tail tape measure protein	A0A0D4DC37	Acinetobacter_phage	2.5e-249	47.9
AUT36877.1\|403919_404183_+	hypothetical protein	NA	NA	NA	NA
AUT36878.1\|404403_404745_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	2.6e-11	39.4
AUT36879.1\|404798_405971_+	hypothetical protein	G3ENB2	Psychrobacter_phage	3.4e-50	41.7
AUT36880.1\|405957_406764_+\|tail	phage minor tail protein L	A0A0R6PGU8	Moraxella_phage	1.2e-91	62.7
AUT36881.1\|406770_407520_+\|tail	phage tail protein	A0A0R6PIM4	Moraxella_phage	4.8e-82	55.3
AUT36882.1\|407525_407864_+	hypothetical protein	NA	NA	NA	NA
AUT36883.1\|407933_408599_+\|tail	phage tail protein	A0A0R6PIW1	Moraxella_phage	1.3e-43	48.6
AUT36884.1\|408655_413101_+\|tail	phage tail protein	A0A0R6PIC9	Moraxella_phage	0.0e+00	65.5
AUT36885.1\|413113_413473_+	hypothetical protein	NA	NA	NA	NA
AUT36886.1\|413453_414305_+	hypothetical protein	NA	NA	NA	NA
AUT36887.1\|414393_414687_+\|lysis	lysis protein	NA	NA	NA	NA
AUT36888.1\|414667_414892_+	hypothetical protein	NA	NA	NA	NA
AUT36889.1\|414949_415495_+	hypothetical protein	A0A0N7IRE7	Acinetobacter_phage	1.9e-96	93.4
AUT36890.1\|416240_416462_-	hypothetical protein	NA	NA	NA	NA
AUT36891.1\|416544_417843_-	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	1.4e-153	60.5
AUT36892.1\|417846_418341_-	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	6.9e-45	60.3
AUT36893.1\|418455_419100_-	DUF159 family protein	A0A218MNF5	uncultured_virus	1.6e-57	49.3
AUT36894.1\|419140_420139_-	hypothetical protein	NA	NA	NA	NA
AUT36895.1\|420212_421424_-\|integrase	integrase	A0A0R6PDI8	Moraxella_phage	8.6e-105	51.0
AUT36896.1\|421710_424347_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.8e-75	38.6
421626:421646	attR	NA	NA	NA	NA

DBSCAN-SWA_4

447204 : 510520

Acinetobacter_phage(28.57%)

head,transposase,integrase,tRNA

attL 475023:475038|attR 513444:513459

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT36918.1\|447204_448137_-\|transposase	IS5 family transposase ISAba13	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6
AUT36919.1\|450110_450827_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
AUT36920.1\|450972_453411_+	nuclease	NA	NA	NA	NA
AUT36921.1\|453639_454572_+\|transposase	IS5-like element IS17 family transposase	Q1MVF0	Enterobacteria_phage	9.3e-59	41.2
AUT36922.1\|454666_455278_+	glutathione S-transferase	NA	NA	NA	NA
AUT36923.1\|455342_455687_-	hypothetical protein	NA	NA	NA	NA
AUT36924.1\|455860_457426_-	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	1.3e-25	30.8
AUT36925.1\|457688_457907_+	DUF1653 domain-containing protein	NA	NA	NA	NA
AUT36926.1\|457943_458531_+	DUF1442 domain-containing protein	NA	NA	NA	NA
AUT36927.1\|458595_458811_-	KTSC domain-containing protein	NA	NA	NA	NA
AUT36928.1\|459003_459567_-	peroxiredoxin	NA	NA	NA	NA
AUT36929.1\|459919_463777_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	6.4e-45	28.1
AUT36930.1\|463872_464979_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
AUT36931.1\|465079_466342_-	outer membrane porin, OprD family	NA	NA	NA	NA
AUT36932.1\|466386_467745_-	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
AUT36933.1\|468210_469404_-	benzoate transporter	NA	NA	NA	NA
AUT36934.1\|469461_470247_-	KR domain-containing protein	NA	NA	NA	NA
AUT36935.1\|470265_471282_-	NADH oxidase	NA	NA	NA	NA
AUT36936.1\|471354_471855_-	benzoate 1,2-dioxygenase small subunit	NA	NA	NA	NA
AUT36937.1\|471851_473234_-	benzoate 1,2-dioxygenase large subunit	NA	NA	NA	NA
AUT36938.1\|473517_474477_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUT36939.1\|474525_474726_-	copper chaperone	NA	NA	NA	NA
AUT36940.1\|474892_477364_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.3e-96	34.5
475023:475038	attL	NA	NA	NA	NA
AUT36941.1\|477439_477841_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
AUT36942.1\|477869_478277_+	GFA family protein	NA	NA	NA	NA
AUT36943.1\|478869_479226_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
AUT36944.1\|479705_480035_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	5.8e-32	62.9
AUT36945.1\|480061_480244_+	hypothetical protein	NA	NA	NA	NA
AUT36946.1\|480475_481069_+	multidrug transporter MatE	NA	NA	NA	NA
AUT36947.1\|481119_481344_+	hypothetical protein	NA	NA	NA	NA
AUT36948.1\|481569_481764_-	exodeoxyribonuclease VII	NA	NA	NA	NA
AUT36949.1\|481756_483019_-	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.9e-14	24.0
AUT36950.1\|483524_483758_+\|transposase	transposase	NA	NA	NA	NA
AUT36951.1\|483909_484581_-	helix-turn-helix domain-containing protein	A0A1B1P9J5	Acinetobacter_phage	1.1e-64	56.6
AUT36952.1\|485181_485571_+	hypothetical protein	A0A0P0IVR6	Acinetobacter_phage	1.1e-48	74.4
AUT36953.1\|485608_486154_+	hypothetical protein	A0A0N7IRF5	Acinetobacter_phage	1.6e-74	73.5
AUT36954.1\|486220_486838_-	LysE family translocator	NA	NA	NA	NA
AUT36955.1\|487355_487571_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	7.7e-17	65.0
AUT36956.1\|487774_487999_+	hypothetical protein	NA	NA	NA	NA
AUT36957.1\|488278_489094_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AUT36958.1\|489250_489370_-	hypothetical protein	NA	NA	NA	NA
AUT36959.1\|489855_490314_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.7e-27	45.8
AUT36960.1\|490606_490951_+	hypothetical protein	NA	NA	NA	NA
AUT36961.1\|491048_492155_+\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	2.0e-145	67.1
AUT36962.1\|492149_493364_-	MFS transporter	NA	NA	NA	NA
AUT36963.1\|493475_493922_+	transcriptional regulator	NA	NA	NA	NA
AUT39838.1\|494071_494338_+	hypothetical protein	NA	NA	NA	NA
AUT36964.1\|494984_495578_+	DUF4142 domain-containing protein	NA	NA	NA	NA
AUT36965.1\|495961_496591_+	hypothetical protein	NA	NA	NA	NA
AUT39839.1\|496875_496998_-\|integrase	integrase	NA	NA	NA	NA
AUT36966.1\|497263_498685_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.5e-55	30.8
AUT36967.1\|498898_499876_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.6e-37	31.7
AUT36968.1\|499879_500419_+	3-deoxy-D-manno-octulosonate 8-phosphate phosphatase	NA	NA	NA	NA
AUT36969.1\|500456_501005_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AUT36970.1\|500988_501537_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AUT36971.1\|501536_502283_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-20	25.9
AUT36972.1\|502364_503111_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT36973.1\|503435_504902_+	RND transporter	NA	NA	NA	NA
AUT36974.1\|504898_507040_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-29	24.7
AUT36975.1\|507036_508227_+	secretion protein HlyD	NA	NA	NA	NA
AUT36976.1\|508318_508918_+	DUF1949 domain-containing protein	A0A1X9I5T8	Streptococcus_phage	5.0e-21	36.6
AUT36977.1\|508910_509522_+	chloramphenicol acetyltransferase CAT	M1HKK6	Paramecium_bursaria_Chlorella_virus	3.6e-11	54.0
AUT36978.1\|509677_510520_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	2.6e-36	33.9
513444:513459	attR	NA	NA	NA	NA

DBSCAN-SWA_5

744795 : 794405

Paenibacillus_phage(33.33%)

integrase,transposase,holin,tRNA

attL 744714:744773|attR 787083:787950

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
744714:744773	attL	NA	NA	NA	NA
AUT37188.1\|744795_745542_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT37189.1\|746184_747018_-	methionine transporter	NA	NA	NA	NA
AUT37190.1\|747031_747862_-	methionine transporter	NA	NA	NA	NA
AUT37191.1\|747876_749289_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
AUT37192.1\|749288_750512_-	SfnB family sulfur acquisition oxidoreductase	NA	NA	NA	NA
AUT37193.1\|750524_751760_-	SfnB family sulfur acquisition oxidoreductase	NA	NA	NA	NA
AUT37194.1\|752105_752870_+	glutathione S-transferase	NA	NA	NA	NA
AUT37195.1\|753406_754300_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AUT37196.1\|754394_755237_+	amino acid ABC transporter permease	NA	NA	NA	NA
AUT37197.1\|755239_755917_+	amino acid ABC transporter permease	NA	NA	NA	NA
AUT37198.1\|755930_756674_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-29	38.2
AUT37199.1\|756724_758056_-	DcaP-like protein	NA	NA	NA	NA
AUT37200.1\|758387_758858_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AUT37201.1\|758888_759638_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AUT37202.1\|759800_760346_-	acyltransferase	NA	NA	NA	NA
AUT37203.1\|760530_761091_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AUT37204.1\|761366_762230_+	hypothetical protein	NA	NA	NA	NA
AUT37205.1\|762661_763894_+\|integrase	integrase	A0A0R6PHM8	Moraxella_phage	1.1e-83	42.6
AUT37206.1\|764476_765376_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUT37207.1\|765465_765903_+	hypothetical protein	NA	NA	NA	NA
AUT37208.1\|765959_767375_-	cytosine permease	NA	NA	NA	NA
AUT37209.1\|767627_768092_-	hypothetical protein	NA	NA	NA	NA
AUT37210.1\|768204_769134_-	EamA/RhaT family transporter	NA	NA	NA	NA
AUT37211.1\|769228_770080_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUT37212.1\|770120_770747_-	hypothetical protein	NA	NA	NA	NA
AUT37213.1\|770850_771846_-	AraC family transcriptional regulator	NA	NA	NA	NA
AUT37214.1\|772689_773709_-	fimbrial protein	NA	NA	NA	NA
AUT37215.1\|774609_775104_-\|transposase	transposase	NA	NA	NA	NA
AUT37216.1\|775151_775457_-\|transposase	transposase	A0A218MNC9	uncultured_virus	3.4e-18	52.5
AUT37217.1\|777182_777923_-	pilus assembly protein	NA	NA	NA	NA
AUT37218.1\|777993_778530_-	ferrous iron transporter B	NA	NA	NA	NA
AUT37219.1\|778975_779326_+	hypothetical protein	NA	NA	NA	NA
AUT37220.1\|779389_779602_+	hypothetical protein	NA	NA	NA	NA
AUT37221.1\|779648_780638_-	biotin synthase	NA	NA	NA	NA
AUT37222.1\|780737_781826_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
AUT37223.1\|781854_783315_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AUT37224.1\|783319_783865_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AUT37225.1\|784094_784688_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUT37226.1\|784684_785230_+	N-acetyltransferase	NA	NA	NA	NA
AUT37227.1\|785299_786124_-	OXA-51 family carbapenem-hydrolyzing class D beta-lactamase OXA-51	NA	NA	NA	NA
AUT37228.1\|786522_787083_+	FxsA protein	NA	NA	NA	NA
AUT37229.1\|787164_787911_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT37230.1\|788006_788192_-	hypothetical protein	NA	NA	NA	NA
787083:787950	attR	NA	NA	NA	NA
AUT37231.1\|788450_788699_+	hypothetical protein	NA	NA	NA	NA
AUT37232.1\|788822_789989_-	S-adenosylmethionine synthase	A0A2H4PQS6	Staphylococcus_phage	1.4e-125	61.6
AUT37233.1\|790513_792502_+	transketolase	NA	NA	NA	NA
AUT37234.1\|792556_792964_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AUT37235.1\|793178_793769_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AUT37236.1\|793814_794405_-\|holin	phosphatidylcholine--retinol O-acyltransferase	NA	NA	NA	NA

DBSCAN-SWA_6

1697629 : 1711803

Acinetobacter_phage(72.73%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT38032.1\|1697629_1698795_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.1e-165	100.0
AUT38033.1\|1699075_1700617_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.9e-288	100.0
AUT38034.1\|1700613_1702416_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	0.0e+00	97.7
AUT38035.1\|1702904_1704101_+	DUF4102 domain-containing protein	A0A0D4DBR3	Acinetobacter_phage	5.5e-221	97.7
AUT38036.1\|1704237_1704732_+	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	1.2e-44	58.3
AUT38037.1\|1704735_1706034_+	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	1.7e-159	61.9
AUT39891.1\|1706133_1706733_+	hypothetical protein	NA	NA	NA	NA
AUT38038.1\|1706969_1707512_-	hypothetical protein	A0A0N7IRE7	Acinetobacter_phage	2.5e-96	95.5
AUT38039.1\|1707573_1707753_-	hypothetical protein	A0A0D4DCA7	Acinetobacter_phage	9.2e-24	100.0
AUT38040.1\|1707778_1708321_-	hypothetical protein	A0A0D4DBW7	Acinetobacter_phage	5.7e-101	100.0
AUT38041.1\|1708432_1708822_-	hypothetical protein	J7I481	Acinetobacter_phage	7.3e-66	98.4
AUT38042.1\|1708885_1711375_-	hypothetical protein	NA	NA	NA	NA
AUT38043.1\|1711374_1711803_-	hypothetical protein	A0A0B5A615	Paracoccus_phage	4.5e-08	34.6

DBSCAN-SWA_7

1724006 : 1760858

Acinetobacter_phage(73.53%)

head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT38059.1\|1724006_1724981_-	DUF2184 domain-containing protein	M4SQD1	Psychrobacter_phage	2.0e-51	37.5
AUT38060.1\|1724986_1725457_-	hypothetical protein	NA	NA	NA	NA
AUT38061.1\|1725470_1726667_-	DUF2213 domain-containing protein	H9C194	Pectobacterium_phage	2.5e-24	33.9
AUT38062.1\|1726720_1727020_-	hypothetical protein	NA	NA	NA	NA
AUT38063.1\|1727044_1727362_-	hypothetical protein	NA	NA	NA	NA
AUT38064.1\|1727354_1728167_-\|head	phage head morphogenesis protein	M4T3R2	Psychrobacter_phage	1.3e-51	41.8
AUT38065.1\|1728111_1729446_-	hypothetical protein	M4SN90	Psychrobacter_phage	2.2e-85	38.9
AUT38066.1\|1729454_1730981_-	helicase	I3PGT7	Xanthomonas_phage	1.6e-92	42.0
AUT38067.1\|1730958_1731435_-	hypothetical protein	A0A0P0HSK4	Acinetobacter_phage	8.5e-32	47.7
AUT38068.1\|1731480_1732113_-	hypothetical protein	A0A1B1P9K3	Acinetobacter_phage	7.5e-60	55.5
AUT38069.1\|1732109_1732301_-	hypothetical protein	J7I0V8	Acinetobacter_phage	4.0e-25	87.3
AUT38070.1\|1732357_1732603_-	hypothetical protein	NA	NA	NA	NA
AUT38071.1\|1733279_1734032_-	hypothetical protein	A0A0P0J081	Acinetobacter_phage	1.1e-129	92.8
AUT38072.1\|1734045_1734444_-	hypothetical protein	A0A0P0IKL1	Acinetobacter_phage	6.3e-65	92.4
AUT38073.1\|1734443_1734767_-	hypothetical protein	NA	NA	NA	NA
AUT38074.1\|1734756_1734963_-	hypothetical protein	NA	NA	NA	NA
AUT38075.1\|1734955_1735234_-	DUF3850 domain-containing protein	A0A059T7N3	Listeria_phage	2.2e-11	46.5
AUT38076.1\|1735226_1735598_-	hypothetical protein	A0A0P0IKW4	Acinetobacter_phage	5.0e-32	60.6
AUT38077.1\|1735754_1736162_-	hypothetical protein	NA	NA	NA	NA
AUT38078.1\|1736158_1736908_-	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	9.9e-136	97.6
AUT38079.1\|1736900_1737851_-	DUF1376 domain-containing protein	A0A0P0I481	Acinetobacter_phage	1.5e-99	63.9
AUT38080.1\|1737847_1739401_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	3.2e-136	41.3
AUT38081.1\|1739397_1739718_-	hypothetical protein	NA	NA	NA	NA
AUT38082.1\|1739767_1740268_-	hypothetical protein	NA	NA	NA	NA
AUT38083.1\|1740328_1740592_-	transcriptional regulator	NA	NA	NA	NA
AUT38084.1\|1740725_1741475_+	XRE family transcriptional regulator	H1ZZB6	Pseudomonas_virus	6.4e-10	31.4
AUT38085.1\|1741679_1742129_+	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	1.9e-73	95.9
AUT38086.1\|1742121_1742445_+	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	1.5e-43	79.4
AUT38087.1\|1742455_1743577_+	AAA family ATPase	A0A0D4DBX7	Acinetobacter_phage	2.6e-212	100.0
AUT38088.1\|1743573_1744533_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	5.1e-161	91.2
AUT38089.1\|1744534_1744786_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	3.2e-38	98.7
AUT38090.1\|1744786_1745176_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	5.7e-10	53.0
AUT38091.1\|1745172_1745475_+	hypothetical protein	A0A2I7QNA8	Vibrio_phage	7.8e-07	35.7
AUT38092.1\|1745471_1745666_+	hypothetical protein	NA	NA	NA	NA
AUT38093.1\|1745666_1745936_+	hypothetical protein	A0A0P0J067	Acinetobacter_phage	8.7e-42	100.0
AUT38094.1\|1746050_1746635_+	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.6e-109	98.5
AUT38095.1\|1746731_1749503_-	M1 family peptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	97.9
AUT38096.1\|1749510_1752243_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.2
AUT39892.1\|1752599_1753649_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
AUT38097.1\|1753658_1754465_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.9e-145	98.9
AUT38098.1\|1754474_1755170_+	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
AUT38099.1\|1755180_1756164_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.1e-182	96.0
AUT38100.1\|1756170_1758546_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	98.6
AUT38101.1\|1758547_1760047_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.2e-275	95.4
AUT38102.1\|1760303_1760858_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.7e-98	100.0

DBSCAN-SWA_8

2017562 : 2054210

Bacillus_phage(22.22%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT38319.1\|2017562_2018324_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-67	53.1
AUT38320.1\|2019265_2020216_+	hypothetical protein	NA	NA	NA	NA
AUT38321.1\|2020648_2021059_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
AUT38322.1\|2021117_2021489_+	hypothetical protein	NA	NA	NA	NA
AUT38323.1\|2021641_2022574_+\|transposase	IS5/IS1182 family transposase	Q1MVF0	Enterobacteria_phage	1.7e-60	41.6
AUT38324.1\|2022728_2023403_+	hypothetical protein	NA	NA	NA	NA
AUT38325.1\|2023645_2027644_-	peptide synthetase	A0A2K9KZV5	Tupanvirus	6.6e-69	33.3
AUT38326.1\|2028250_2028781_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AUT38327.1\|2029039_2029534_-	transcription elongation factor GreB	NA	NA	NA	NA
AUT38328.1\|2029906_2031019_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AUT38329.1\|2031110_2031494_-	SCP-2 sterol transfer family protein	NA	NA	NA	NA
AUT38330.1\|2031700_2032606_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.4e-91	64.2
AUT38331.1\|2033109_2033973_+	transglycosylase	A0A0H3V0Q1	Geobacillus_virus	2.7e-36	53.6
AUT38332.1\|2034230_2035136_+\|protease	protease HtpX	NA	NA	NA	NA
AUT38333.1\|2035185_2035761_-	DUF4112 domain-containing protein	NA	NA	NA	NA
AUT38334.1\|2035833_2038929_-	hydrophobe/amphiphile efflux-1 family RND transporter	NA	NA	NA	NA
AUT38335.1\|2039192_2040335_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
AUT38336.1\|2041179_2041926_-\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT38337.1\|2042306_2042681_+	diacylglycerol kinase	NA	NA	NA	NA
AUT38338.1\|2042855_2044490_-	molecular chaperone GroEL	A0A219YK78	uncultured_virus	8.1e-175	60.9
AUT38339.1\|2044548_2044839_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	2.3e-16	51.1
AUT38340.1\|2045024_2045783_-	3',5'-cyclic-nucleotide phosphodiesterase	NA	NA	NA	NA
AUT38341.1\|2045763_2046702_-	diacylglycerol kinase	NA	NA	NA	NA
AUT38342.1\|2047093_2048926_+	phosphoenolpyruvate carboxykinase	NA	NA	NA	NA
AUT38343.1\|2048967_2050485_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AUT38344.1\|2050639_2052148_-	glycerol kinase	NA	NA	NA	NA
AUT38345.1\|2052825_2053335_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUT38346.1\|2053448_2054210_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-67	53.1

DBSCAN-SWA_9

2272949 : 2334263

Enterobacteria_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT38532.1\|2272949_2273700_+\|transposase	DDE transposase	A0A0N9SHJ4	Paenibacillus_phage	3.5e-24	44.9
AUT38533.1\|2274095_2275166_-	cell division protein	NA	NA	NA	NA
AUT38534.1\|2275156_2276443_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
AUT38535.1\|2276439_2277336_-	acetyl-CoA carboxylase carboxyl transferase subunit beta	NA	NA	NA	NA
AUT38536.1\|2277332_2278136_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
AUT38537.1\|2278565_2279498_-\|transposase	IS5/IS1182 family transposase	Q1MVF0	Enterobacteria_phage	7.6e-61	42.3
AUT38538.1\|2280099_2281095_-	DUF2804 domain-containing protein	NA	NA	NA	NA
AUT38539.1\|2281132_2281645_-	DUF1543 domain-containing protein	NA	NA	NA	NA
AUT38540.1\|2281654_2282884_-	tryptophan synthase subunit beta	NA	NA	NA	NA
AUT38541.1\|2282867_2283527_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AUT38542.1\|2283883_2285734_+	TonB-dependent receptor	NA	NA	NA	NA
AUT38543.1\|2285831_2286410_+	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AUT38544.1\|2286482_2287196_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
AUT38545.1\|2287224_2287755_-	META domain-containing protein	NA	NA	NA	NA
AUT38546.1\|2287963_2289136_+	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	2.5e-32	32.3
AUT38547.1\|2289249_2290692_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.6e-44	31.9
AUT38548.1\|2290755_2291442_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.5e-29	33.8
AUT39911.1\|2291461_2293120_-	sensor histidine kinase efflux regulator BaeS	NA	NA	NA	NA
AUT38549.1\|2293214_2294147_+\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	1.3e-55	39.6
AUT38550.1\|2294299_2294680_+	hypothetical protein	NA	NA	NA	NA
AUT38551.1\|2294969_2296772_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUT38552.1\|2296939_2298721_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AUT38553.1\|2298840_2299323_+	protein PsiE	NA	NA	NA	NA
AUT38554.1\|2299360_2299744_-	hypothetical protein	NA	NA	NA	NA
AUT38555.1\|2299908_2300355_+	hypothetical protein	NA	NA	NA	NA
AUT38556.1\|2300669_2302133_-	phospholipase	NA	NA	NA	NA
AUT38557.1\|2302208_2304290_-	TonB-dependent receptor	NA	NA	NA	NA
AUT38558.1\|2304425_2305190_+	DUF4184 domain-containing protein	NA	NA	NA	NA
AUT38559.1\|2305360_2307139_+\|tRNA	aspartate--tRNA ligase	A0A2K9KZX5	Tupanvirus	1.4e-18	21.7
AUT38560.1\|2307280_2307499_+	hypothetical protein	NA	NA	NA	NA
AUT38561.1\|2307498_2308437_+	glycosyltransferase	NA	NA	NA	NA
AUT38562.1\|2308474_2309494_+	glycosyl transferase	A0A1V0SAH6	Catovirus	7.9e-11	33.9
AUT38563.1\|2309521_2310073_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.7e-47	52.4
AUT38564.1\|2310062_2310953_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	1.0e-110	66.6
AUT38565.1\|2310949_2311843_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AUT38566.1\|2311845_2312913_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.2e-99	52.1
AUT38567.1\|2313048_2314092_-	hypothetical protein	NA	NA	NA	NA
AUT38568.1\|2314104_2315088_-	glycosyltransferase	NA	NA	NA	NA
AUT38569.1\|2315090_2315900_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
AUT38570.1\|2315913_2316801_-	nucleoside-diphosphate sugar epimerase	NA	NA	NA	NA
AUT38571.1\|2316868_2317795_-	branched-chain amino acid transaminase	NA	NA	NA	NA
AUT38572.1\|2317819_2320570_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
AUT38573.1\|2320638_2321907_-	two-component sensor histidine kinase	NA	NA	NA	NA
AUT38574.1\|2322709_2323747_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AUT38575.1\|2323900_2324929_+	hypothetical protein	NA	NA	NA	NA
AUT38576.1\|2325013_2325583_+	LemA family protein	NA	NA	NA	NA
AUT38577.1\|2325826_2326960_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-94	48.2
AUT38578.1\|2327058_2327388_+	preprotein translocase subunit YajC	NA	NA	NA	NA
AUT38579.1\|2327439_2329341_+	protein translocase subunit SecD	NA	NA	NA	NA
AUT38580.1\|2329349_2330315_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-31	33.1
AUT38581.1\|2330405_2331735_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.5e-70	50.8
AUT38582.1\|2331783_2333002_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
AUT38583.1\|2333124_2334263_-\|transposase	transposase	U5P429	Shigella_phage	7.9e-84	59.0

DBSCAN-SWA_10

2617707 : 2678992

Escherichia_phage(13.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT38843.1\|2617707_2618927_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
AUT38844.1\|2619491_2620595_-	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	5.0e-27	37.0
AUT38845.1\|2620826_2621270_+	hypothetical protein	NA	NA	NA	NA
AUT38846.1\|2621325_2623203_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	8.7e-72	32.9
AUT38847.1\|2623477_2624050_-	hypothetical protein	NA	NA	NA	NA
AUT38848.1\|2624101_2624881_-	hypothetical protein	NA	NA	NA	NA
AUT38849.1\|2625025_2625583_-	NAD(P)H oxidoreductase	NA	NA	NA	NA
AUT38850.1\|2626313_2626823_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUT38851.1\|2626936_2627698_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-67	53.1
AUT38852.1\|2628467_2629370_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUT38853.1\|2629481_2630483_+	aldo/keto reductase	NA	NA	NA	NA
AUT38854.1\|2630529_2630922_-	hypothetical protein	NA	NA	NA	NA
AUT38855.1\|2630941_2631685_-	hypothetical protein	NA	NA	NA	NA
AUT38856.1\|2631872_2632619_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
AUT38857.1\|2632773_2633721_+	EamA/RhaT family transporter	NA	NA	NA	NA
AUT38858.1\|2633656_2634577_-	transcriptional regulator	NA	NA	NA	NA
AUT38859.1\|2634715_2635960_+	MFS transporter	NA	NA	NA	NA
AUT38860.1\|2636681_2637017_+	hypothetical protein	NA	NA	NA	NA
AUT38861.1\|2637017_2637311_-	hypothetical protein	NA	NA	NA	NA
AUT38862.1\|2637484_2637712_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUT38863.1\|2637743_2637998_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUT38864.1\|2638116_2638656_+	hypothetical protein	NA	NA	NA	NA
AUT38865.1\|2638718_2639045_+	hypothetical protein	NA	NA	NA	NA
AUT38866.1\|2640482_2641647_+\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.1e-165	100.0
AUT38867.1\|2641742_2642570_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AUT38868.1\|2642602_2642932_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUT38869.1\|2643260_2643440_+	hypothetical protein	A0A192Y6A8	Salmonella_phage	2.5e-13	55.9
AUT38870.1\|2643512_2643755_+	hypothetical protein	NA	NA	NA	NA
AUT38871.1\|2644070_2645289_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
AUT38872.1\|2646227_2646512_-	hypothetical protein	NA	NA	NA	NA
AUT38873.1\|2646956_2648420_+	DUF2813 domain-containing protein	NA	NA	NA	NA
AUT38874.1\|2648541_2648829_-	hypothetical protein	NA	NA	NA	NA
AUT38875.1\|2649839_2650262_-	aldehyde-activating protein	NA	NA	NA	NA
AUT38876.1\|2650270_2651098_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AUT38877.1\|2651102_2652440_-	FAD-binding protein	NA	NA	NA	NA
AUT38878.1\|2652840_2653713_-	quercetin 2,3-dioxygenase	NA	NA	NA	NA
AUT38879.1\|2653990_2654617_+	hydrolase	NA	NA	NA	NA
AUT38880.1\|2654637_2655612_+	LysR family transcriptional regulator	NA	NA	NA	NA
AUT38881.1\|2655718_2657167_-	succinate-semialdehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
AUT38882.1\|2657163_2658456_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	4.2e-25	26.7
AUT38883.1\|2658567_2660112_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	3.9e-17	26.7
AUT38884.1\|2660172_2661615_-	amino acid permease	NA	NA	NA	NA
AUT38885.1\|2661920_2662469_-	XRE family transcriptional regulator	NA	NA	NA	NA
AUT38886.1\|2662537_2663233_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AUT38887.1\|2663229_2663553_+	AzlD domain-containing protein	NA	NA	NA	NA
AUT38888.1\|2663593_2664175_-	single-stranded DNA-binding protein	A0A1B0VAF5	Salmonella_phage	9.6e-38	57.6
AUT38889.1\|2664226_2665591_-	MFS transporter	NA	NA	NA	NA
AUT38890.1\|2665737_2666820_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	2.6e-89	51.2
AUT38891.1\|2667082_2667757_+	thiaminase II	NA	NA	NA	NA
AUT38892.1\|2667806_2668148_-	GlpM family protein	NA	NA	NA	NA
AUT38893.1\|2668200_2668554_-	DUF1304 domain-containing protein	NA	NA	NA	NA
AUT38894.1\|2668619_2669597_-	NADPH:quinone oxidoreductase	NA	NA	NA	NA
AUT38895.1\|2669600_2670203_-	TetR family transcriptional regulator	NA	NA	NA	NA
AUT38896.1\|2670499_2673334_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	56.5
AUT38897.1\|2673367_2675074_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	2.9e-13	31.9
AUT38898.1\|2676066_2676966_+	carbapenem susceptibility porin CarO	NA	NA	NA	NA
AUT38899.1\|2677024_2678992_-\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	7.6e-26	27.2

DBSCAN-SWA_11

3107155 : 3162907

uncultured_Caudovirales_phage(14.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUT39243.1\|3107155_3107725_-\|tRNA	tRNA threonylcarbamoyladenosine biosynthesis protein RimN	S4VW33	Pandoravirus	3.9e-07	27.1
AUT39941.1\|3107775_3108906_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	8.2e-25	39.5
AUT39244.1\|3108926_3110081_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
AUT39245.1\|3110203_3110734_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.8e-17	42.6
AUT39246.1\|3110770_3111199_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AUT39247.1\|3111271_3113386_+	TonB-dependent copper receptor	NA	NA	NA	NA
AUT39248.1\|3113439_3113646_+	hypothetical protein	NA	NA	NA	NA
AUT39249.1\|3113715_3114930_-	DUF2236 domain-containing protein	NA	NA	NA	NA
AUT39250.1\|3115017_3115614_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUT39251.1\|3121624_3122167_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUT39252.1\|3122373_3123372_+	cysteine synthase A	A0A1W6JHY1	Lactococcus_phage	6.5e-74	52.4
AUT39253.1\|3123427_3124036_-	transglycosylase	NA	NA	NA	NA
AUT39254.1\|3124344_3124911_-	flavodoxin family protein	NA	NA	NA	NA
AUT39255.1\|3124927_3125413_-	DUF2938 domain-containing protein	NA	NA	NA	NA
AUT39256.1\|3125494_3125899_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AUT39257.1\|3126046_3127306_+	phytase esterase	NA	NA	NA	NA
AUT39258.1\|3127520_3129899_+	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	2.8e-115	79.2
AUT39259.1\|3130212_3130713_+	DUF2726 domain-containing protein	NA	NA	NA	NA
AUT39260.1\|3130858_3131212_-	RidA family protein	NA	NA	NA	NA
AUT39261.1\|3131532_3132588_-	DNA polymerase IV	NA	NA	NA	NA
AUT39262.1\|3132589_3133348_-	lysozyme	NA	NA	NA	NA
AUT39263.1\|3133447_3133753_+\|transposase	transposase	A0A218MNC9	uncultured_virus	3.4e-18	52.5
AUT39264.1\|3133800_3134295_+\|transposase	transposase	NA	NA	NA	NA
AUT39265.1\|3134313_3135705_-	MFS transporter	NA	NA	NA	NA
AUT39942.1\|3135902_3136508_-	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	2.5e-12	27.8
AUT39266.1\|3136852_3138445_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.8e-41	43.1
AUT39267.1\|3138516_3138984_+	hypothetical protein	NA	NA	NA	NA
AUT39268.1\|3139029_3139674_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
AUT39269.1\|3139756_3141076_+	MFS transporter	NA	NA	NA	NA
AUT39270.1\|3141229_3143449_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.2e-81	33.9
AUT39271.1\|3143746_3145426_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	27.1
AUT39272.1\|3145465_3145849_-	hypothetical protein	NA	NA	NA	NA
AUT39273.1\|3145943_3146354_+	hypothetical protein	A0A2H4J146	uncultured_Caudovirales_phage	2.4e-14	43.8
AUT39274.1\|3146481_3147009_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.6e-61	62.2
AUT39275.1\|3147115_3148432_-	outer membrane porin, OprD family	NA	NA	NA	NA
AUT39276.1\|3149341_3150169_+	hypothetical protein	NA	NA	NA	NA
AUT39277.1\|3150211_3151090_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
AUT39278.1\|3151105_3151882_-	aldolase	NA	NA	NA	NA
AUT39279.1\|3151993_3153406_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AUT39280.1\|3153442_3154069_-	ATP-binding protein	NA	NA	NA	NA
AUT39281.1\|3154207_3154906_+\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
AUT39282.1\|3154898_3156788_+\|transposase	transposase	NA	NA	NA	NA
AUT39283.1\|3157224_3158390_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.1e-165	100.0
AUT39284.1\|3158929_3160021_+	hypothetical protein	NA	NA	NA	NA
AUT39943.1\|3160035_3161478_+	hypothetical protein	NA	NA	NA	NA
AUT39285.1\|3161687_3162907_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP026129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13020 : 68846

Acinetobacter_phage(25.0%)

transposase,integrase,protease

attL 12972:13031|attR 74994:76501

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
12972:13031	attL	NA	NA	NA	NA
AUT40153.1\|13020_14346_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AUT40154.1\|14274_14523_+	hypothetical protein	NA	NA	NA	NA
AUT40155.1\|14519_15032_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AUT40156.1\|15710_16229_+	sel1 repeat family protein	NA	NA	NA	NA
AUT40157.1\|16787_17144_+	addiction module toxin RelE	NA	NA	NA	NA
AUT40158.1\|17136_17439_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUT40159.1\|17431_17617_+	hypothetical protein	NA	NA	NA	NA
AUT40160.1\|17653_18873_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	4.8e-79	53.2
AUT40161.1\|19060_19288_-	hypothetical protein	NA	NA	NA	NA
AUT40162.1\|19505_19703_-	hypothetical protein	NA	NA	NA	NA
AUT40163.1\|20519_20909_-	AAA family ATPase	NA	NA	NA	NA
AUT40164.1\|21096_21417_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AUT40165.1\|21693_21882_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	4.1e-14	69.6
AUT40166.1\|21868_22156_+	XRE family transcriptional regulator	A0A088CD40	Shigella_phage	7.4e-15	48.4
AUT40167.1\|22234_22489_-	hypothetical protein	NA	NA	NA	NA
AUT40168.1\|22439_22664_-	hypothetical protein	A0A0P0IYG9	Acinetobacter_phage	2.9e-06	46.6
AUT40169.1\|22684_23116_-	hypothetical protein	A0A0P0IDW1	Acinetobacter_phage	2.1e-66	90.6
AUT40170.1\|25791_26259_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	5.3e-55	70.3
AUT40171.1\|26320_26776_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	5.5e-81	96.0
AUT40172.1\|27437_27674_-	hypothetical protein	NA	NA	NA	NA
AUT40173.1\|27866_28049_-	hypothetical protein	NA	NA	NA	NA
AUT40174.1\|28115_28568_-	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	3.7e-53	66.4
AUT40175.1\|28751_31952_-\|integrase	site-specific integrase	NA	NA	NA	NA
AUT40176.1\|31956_34293_-	hypothetical protein	NA	NA	NA	NA
AUT40243.1\|34279_34729_-	hypothetical protein	NA	NA	NA	NA
AUT40177.1\|35346_35820_+	cell filamentation protein Fic	NA	NA	NA	NA
AUT40244.1\|35874_36075_-	AlpA family phage regulatory protein	NA	NA	NA	NA
AUT40178.1\|37923_38472_-	hypothetical protein	A0A2K9L662	Tupanvirus	2.2e-23	38.9
AUT40245.1\|38641_39409_-	NAD(+) diphosphatase	NA	NA	NA	NA
AUT40246.1\|39799_41323_+	cryptochrome/photolyase family protein	A0A1V0S9A0	Catovirus	6.0e-47	27.8
AUT40179.1\|41326_41470_+	DUF2256 domain-containing protein	NA	NA	NA	NA
AUT40180.1\|41475_41730_-	TIGR03643 family protein	NA	NA	NA	NA
AUT40181.1\|41910_43404_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AUT40247.1\|45726_46899_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
AUT40182.1\|47753_48527_+	partitioning protein	Q8JL10	Natrialba_phage	4.4e-14	33.3
AUT40183.1\|48540_49452_+	partitioning protein	S5VSZ7	Leptospira_phage	2.0e-13	42.9
AUT40184.1\|49557_49836_+	hypothetical protein	NA	NA	NA	NA
AUT40185.1\|50189_50948_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.5e-46	42.9
AUT40186.1\|50988_51285_+	hypothetical protein	NA	NA	NA	NA
AUT40187.1\|53564_54635_-	alpha/beta hydrolase	NA	NA	NA	NA
AUT40188.1\|54652_55144_-	hypothetical protein	NA	NA	NA	NA
AUT40189.1\|55443_56634_+	MFS transporter	NA	NA	NA	NA
AUT40190.1\|57090_57795_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-118	84.5
AUT40191.1\|58272_58791_+	hypothetical protein	NA	NA	NA	NA
AUT40192.1\|58916_59633_+	molecular chaperone	NA	NA	NA	NA
AUT40193.1\|59636_61934_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AUT40194.1\|61946_62354_+	hypothetical protein	NA	NA	NA	NA
AUT40195.1\|63860_64565_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	4.2e-120	85.3
AUT40196.1\|65996_68846_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.2e-128	41.1
74994:76501	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026128

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP026127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP026125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP026129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection