CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	1 crisprs	PD-DExK,csa3,RT	5	1
CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	0 crisprs	csa3	0	2
CP026168	Leclercia sp. LSNIH1 plasmid pLEC-b38d, complete sequence	0 crisprs	NA	0	5
CP026167	Leclercia sp. LSNIH1 chromosome, complete genome	0 crisprs	DEDDh,csa3,WYL,DinG,cas3,PD-DExK	0	5
CP026169	Leclercia sp. LSNIH1 plasmid pKPC-79f0, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026171_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026171_1

12077-12312

Orphan

Consensus_repeat	Method
CATTCATGCAANTGCTTTT	CRT

5 spacers

The CRISPR arrays of CP026171_1

>merge|CP026171|1|12077-12312|CRT
CATTGATACAAGTGCTTTTCAGCCACATCCTGTGTGTCGCCCCATTCATGCAAATGCTTTTCAAACAATGCGCCTTTTCCAGCCTCATTCATGCAAATGCCTTTGTAGCAAAGACACATATCCGAAACCCATTCATGCAAATGCTTTTCGACCAAAGGAACCTTTTCCGGGCTCATTCATGCAGTTGCTTTTCGACCAAGGGCAACTTTTACTATTCCATTCATGTAAATGCTTTT

>CP026171|1|1|12077-12312|CRT
CATTGATACAAGTGCTTTT	CAGCCACATCCTGTGTGTCGCCC
CATTCATGCAAATGCTTTT	CAAACAATGCGCCTTTTCCAGCCT
CATTCATGCAAATGCCTTT	GTAGCAAAGACACATATCCGAAACC
CATTCATGCAAATGCTTTT	CGACCAAAGGAACCTTTTCCGGGCT
CATTCATGCAGTTGCTTTT	CGACCAAGGGCAACTTTTACTATTC
CATTCATGTAAATGCTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP026171.1\|AUU87249.1\|16993_17815_+\|hypothetical-protein	unknown	unknown	unknown
CP026171.1\|AUU87237.1\|6711_7218_-\|transcriptional-regulator	unknown	unknown	unknown
CP026171.1\|AUU87251.1\|20434_22111_+\|restriction-endonuclease-subunit-M	unknown	unknown	gnl\|CDD\|372683
CP026171.1\|AUU87252.1\|22125_22302_+\|hypothetical-protein	unknown	unknown	unknown
CP026171.1\|AUU87236.1\|5853_6711_-\|htdT	unknown	unknown	gnl\|CDD\|239318
CP026171.1\|AUU87238.1\|7226_8585_-\|conjugal-transfer-protein-TraB	unknown	unknown	gnl\|CDD\|319756
CP026171.1\|AUU87246.1\|14719_15793_+\|hypothetical-protein	unknown	unknown	unknown
CP026171.1\|AUU87245.1\|13302_14178_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	unknown
CP026171.1\|AUU87248.1\|16007_16727_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|199908
CP026171.1\|AUU87240.1\|9016_10255_-\|TrhK	unknown	unknown	gnl\|CDD\|368991
CP026171.1\|AUU87243.1\|11423_11777_-\|pili-assembly-chaperone	unknown	unknown	unknown
CP026171.1\|AUU87242.1\|11054_11405_-\|plasmid-transfer-protein	unknown	unknown	gnl\|CDD\|377786
CP026171.1\|AUU87250.1\|19014_20169_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|275105
CP026171.1\|AUU87241.1\|10257_11055_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377500
CP026171.1\|AUU87253.1\|22547_24935_+\|DUF4165-domain-containing-protein	unknown	unknown	gnl\|CDD\|372704
CP026171.1\|AUU87234.1\|2203_4885_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274279
CP026171.1\|AUU87235.1\|4893_5844_-\|TrhV	unknown	unknown	gnl\|CDD\|370611
CP026171.1\|AUU87549.1\|17829_18654_-\|DNA-modification-methylase	unknown	unknown	gnl\|CDD\|273146
CP026171.1\|AUU87239.1\|8574_9015_-\|hypothetical-protein	unknown	unknown	unknown
CP026171.1\|AUU87247.1\|15810_16011_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP026171.1\|AUU87251.1\|20434_22111_+\|restriction-endonuclease-subunit-M	gnl\|CDD\|372683	pfam13708, DUF4942, Domain of unknown function (DUF4942). The function of this family is not known.	2.0231e-15
CP026171.1\|AUU87236.1\|5853_6711_-\|htdT	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	3.35992e-20
CP026171.1\|AUU87238.1\|7226_8585_-\|conjugal-transfer-protein-TraB	gnl\|CDD\|319756	cd16430, TraB, TraB is a homolog of VirB10 which forms part of core complex in Type IV secretion system (T4SS). This family contains TraB (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TraB is localized similarly to related proteins in other systems, but unlike in other systems, Neisseria gonorrhoeae TraB does not require the presence of other T4SS components for proper localization. It has been shown to be expressed with TraK (VirB9 homolog) at low levels in wild-type cells, suggesting that gonococcal T4SS may be present in single copy per cell and the small amounts of these proteins are sufficient for DNA secretion.	3.5155e-78
CP026171.1\|AUU87248.1\|16007_16727_+\|hypothetical-protein	gnl\|CDD\|199908	cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40. Central/middle or CxxCxGxG-motif containing domain of DnaJ/Hsp40 (heat shock protein 40). DnaJ proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonin family. Hsp40 proteins are characterized by the presence of an N-terminal J domain, which mediates the interaction with Hsp70. This central domain contains four repeats of a CxxCxGxG motif and binds to two Zinc ions. It has been implicated in substrate binding.	0.000368454
CP026171.1\|AUU87549.1\|17829_18654_-\|DNA-modification-methylase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	1.98549e-68
CP026171.1\|AUU87240.1\|9016_10255_-\|TrhK	gnl\|CDD\|368991	pfam06586, TraK, TraK protein. This family consists of several TraK proteins from Escherichia coli, Salmonella typhi and Salmonella typhimurium. TraK is known to be essential for pilus assembly but its exact role in this process is unknown.	9.97055e-09
CP026171.1\|AUU87242.1\|11054_11405_-\|plasmid-transfer-protein	gnl\|CDD\|377786	pfam07178, TraL, TraL protein. This family consists of several bacterial TraL proteins. TraL is a predicted peripheral membrane protein which is thought to be involved in bacterial sex pilus assembly. The exact function of this family is unclear.	0.000885487
CP026171.1\|AUU87250.1\|19014_20169_+\|DNA-binding-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	0.00453379
CP026171.1\|AUU87241.1\|10257_11055_-\|pilus-assembly-protein	gnl\|CDD\|377500	pfam05309, TraE, TraE protein. This family consists of several bacterial sex pilus assembly and synthesis proteins (TraE). Conjugal transfer of plasmids from donor to recipient cells is a complex process in which a cell-to-cell contact plays a key role. Many genes encoded by self-transmissible plasmids are required for various processes of conjugation, including pilus formation, stabilisation of mating pairs, conjugative DNA metabolism, surface exclusion and regulation of transfer gene expression. The exact function of the TraE protein is unknown.	1.93118e-15
CP026171.1\|AUU87253.1\|22547_24935_+\|DUF4165-domain-containing-protein	gnl\|CDD\|372704	pfam13750, Big_3_3, Bacterial Ig-like domain (group 3). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.	1.31106e-31
CP026171.1\|AUU87234.1\|2203_4885_-\|AAA-family-ATPase	gnl\|CDD\|274279	TIGR02746, hypothetical_protein, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.	6.92476e-108
CP026171.1\|AUU87235.1\|4893_5844_-\|TrhV	gnl\|CDD\|370611	pfam09676, TraV, Type IV conjugative transfer system lipoprotein (TraV). This entry includes TraV, which is a component of conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK. The alignment contains three conserved cysteines in the N-terminal half.	2.02424e-06

>CP026171.1|AUU87243.1|11423_11777_-|pili-assembly-chaperone
MELTLNTNVEREQTNAFAFLKSKHAKVPLFILLFLASCGLAYAGSDDGAFGDIWAYMSEALTGAPGKIIACGMLFSVAYFGVVKPNLGLALVSALMMLIMANGEKIISTFLDAGIPL
>CP026171.1|AUU87242.1|11054_11405_-|plasmid-transfer-protein
MRGIFPLSGVFMTSQYEVPPHTYRFPYRINMPLLILFWDAKQLGITFVTIASGNIFDFFITSVVVAVVFWFAYKKAAEEGVRGKLKHKLWWFGLFPGKSVFSSRYFTDPFIRNLYS
>CP026171.1|AUU87241.1|10257_11055_-|pilus-assembly-protein
MELRMKLLSKLKIPFIKSASNGDFDKKDETSQNGGEDSKGRFRDSKARFSKEIEASEIGITYSALIKRDEKLLRVNSIAILVIAVLVVKNQFLTDPVTIVLPPNMTEEVKVVGNKASESYKTQWALFFSTLIGNINPTNIGFVTTTILDALSPDLQAKTRESLQQQTNIMQARGVEQSFKPIDMYYDTKNDMVYVWGTKSTRLINVPDKTESSKWTFEWVLGMKNGRPRIAYVNQYSGTPNIKKITINGKEQLATLDNPPPSTGN
>CP026171.1|AUU87240.1|9016_10255_-|TrhK
MTSKKGFRCHAITAMILLATSNVVFAEDYQLPATVNNPVVMPVGADEFQNGVKNAIIKESGTGPAPETSQATKPTTELPSLSPASSASPAVNEITGALSKNPTLVGYQQQVKSGNFDSYGRPAGKEPQQNAQSTGAPSKADELYVEARNRYKEVQRVNVPPGGNIVLPVSRGLQNRISTSFKNASVSTSTPGDEASIFVNGGDVFISTNTDKPIGIMLSEDSVPESTYNLTLVPLDVPGAMISVTTSLSPTMQAKRETSLDKHNYDEMLARSQSEELAPSDPRQDDHKQRIIDLLTPVALGEVPSGFSLQEDRLSRIPSSEQSPCNFNMYSKLGQRLVGSRELIDVILVKNDKPYGQVVADQQCITEGVIASALFDKAFLQPGEETELYIVRDKLFKERQTRVTTRPSLIKR
>CP026171.1|AUU87239.1|8574_9015_-|hypothetical-protein
MRKATFLTGVSFGLVVFLGTSYYYQTEYIPKGTVNIVPDDHRPGETVDDAFEEHTIIISDPTLAQKFVGSSTEFESRRGVKEIKEVGSLNNGKDFAPVESDNSGLNFKDKWPRAGEPYIVPQMTENERNLKVKRFQQPKSGVNNGH
>CP026171.1|AUU87238.1|7226_8585_-|conjugal-transfer-protein-TraB
MDIKNAWENKTVRISVIGAALIVLIIVISQSIFSTPVKKEKKTQKKDMQTGFLIDDSQMTKLSNEESQKTYNEMVRQNRIDQNAAKADRDKAEKAQQESKVQIANLASQVQQLSTQLTDMQTSRNGNRNLDAGGSRKNVNEQAPATPYQLNPNAAVNGASSGYAPITPTRNSPMRTITQSSIKTNGSDGVIQVMPISESRIREGREVVAGGDKAPTRTIRGDGTAPVDSKARHAARKDEMFLPATSIITGVLINGLEAPTSLSSKAEPMPVTMRIKKDIIMPNNFTMDLRDCNLLGSAVGDLASQRAYIRATSISCVNSKGKAFDVKLEAYAVSENDGKNGIRGNLISRNGNAIAGSAFAGGLSALAGSLSPSKVSSLNIDPNSTAEYQSPNIGALGALAGAGAAQGGLNRLVDYYTSIAEQQWPIVEVSPGRPITFIVQSGATIPTNLTSR
>CP026171.1|AUU87237.1|6711_7218_-|transcriptional-regulator
MENNIEPGTKSDSAENVKLEAAKPVGGIRTTKKVTLEIDIEKTLKYLMLAGLAVLFVIYGYKGASFVYESVKAMSNPSYQIAVLDMQTLRKEFNKQNPEPDLVQSKNNFENYFKALMKVYRSRGYLVIDASLAVTIPDNVQIVSYIDLGGSFGEVQSLQGETKESEIR
>CP026171.1|AUU87236.1|5853_6711_-|htdT
MKKLLLSLLVSMITVCPPLTNAAENVLNNTDAAALMEKAKEGGVSTKPLEGVLAKMQSYKPKDVIYIPTGGLYLFQDERSQLMAVTTDGRYTITGGSVMDILQRKSVLSVEDVRKSYFINLDDAPFPLDTVALIPLGNPKLKRQAAIFITLDCDGCQDLIKKFYDEREKYRVDIILIPSPGEPKQELRQLWCSKEKGKVNDLDILRWLMGNKTDIEQRLLTKKEAETCPAEPLVGSLMLAGIYKLQGVPSVVRQDGLAGNGIPKDFDSWLKQSVEPLLKNPFATN
>CP026171.1|AUU87235.1|4893_5844_-|TrhV
MNIKKVIFSALVVGSSSYLAGCTIGSSESECPGIEKGVVCKGPREVMELTNNRDDLSGLAEEEANSGKEKSAVNDSQYPAQISPPGAVQYPKSAVLVNKPVTYKTTQIKPAGQVPVMYDETLKMGAPTSTIGPRPISGVPVNSNVRMTTSYSSTGASGNPFIHPTADVMKQTTQVVSPAPVPRYVAPNSDISASKDLYSVNNGQPVNPTLSSGQIQQYRTQGYKQAVVAPEPLAVLQQGRVMRITFAPYTDDNDALNLPGFVYVNVKPQTWIAGKNSTSNPARIVPLQVQDAARENMQQQQRATKAVSSNGIIRQL
>CP026171.1|AUU87234.1|2203_4885_-|AAA-family-ATPase
MKSANIYNKELSRHQFGGFIPVYDQIPGTNYFLIDGNRLGFMFICNPSPGVFDNQQDVLAELFKMDFPTDTICQTSLTALPDLTLHLSAWSAVRGGRMEGHDKLKGDLLTAYQLDYYDRSLNEPLKPDHDKLMLRDFQIWMSFSIPLKSALPTEIEINRIDALYSDLISKLNTLGLFPHKVSAENWLYCMDKLMHPGKTSRWAEGHVEVNTMRRLNEQLNVPGRKYTVTENNFSSTTQSTDVSEHRYFKQLSVVKFPEHVNFGSMYELVVNWMNGRKTIFSPFMITQTVHFADPLKLARDNVRYKAITNKQASIPTVLTFCPRLKDMDNDYMAVTRELEDGARLLHSYLTFTVMGNSALDVQSAADQLKSFYLESRVKVADDSYIIFPSFVSCLPMCNDPKTILDLDRFEVVSNTGAAHMTPLFGPWKGNTDRPVLNLVSREGQLLGLDIFKTSASYNMVVGATSGAGKSFWVAYIINNYLGAGPRSNNLIHYRDTFEGFKNNAYDAFDPDGAQIFVVDVGRSYQGISEQYTNSQFIDFGKKPDFTLNPFAFLTDVTVADRVFDEAPVFNDDSNNNDEEKDKVAQTIMVLNQLKIMASEKGNIDDFQQSVMLQLIGDEYNESRKVGSTGSITGFARRCSAHEDKRIKDIGEQLGQWCEGGIYGNRFTEKLPPINFGSRFIVLELEELKGTPHLQTVVLMSIIQAAQHAMFIKKDGRRRLFILDEAWEYIRPDNASGSSNQSNQFFSSFLEAAWRRFRKTNCAGICITQSFEDYFTSSVGRALTANSPWKIIMKQEKESIEAMKANNYFSTTDAVYERMKNIRTIKRAFSEMLVRFENFQEICRLYVDRKMELCFTTDSTDRGKLWEIQSRLDCSYGEAIEILYEQEVASNAAA
>CP026171.1|AUU87245.1|13302_14178_-|RepB-family-plasmid-replication-initiator-protein
MSDNNELAHPFDVTNTDTGRTYQLSPNSSKSVQPIALLRLSVFTPVGTKEKRFRNFEVDASDELSSMELARSEGYDDIRITGLKLSMSTDFKCWLGCIMAFSKYGFASEKITLSFNEFAKMCGISSTNINKRTRSRFQEALANLASVVISFRDSKTERFTVTHLVQKAMIDPKKDTVELVGDPSMWELYRYDHKTLLSLQVLSVLAKKEAAQSLYIYFEAMPAGTLFVNMKRLRERLLLTTPVRTQNQIIRKAMLELKSIGYLEYQEVKKGRDIQFQIFKRSPKLALAKQS
>CP026171.1|AUU87246.1|14719_15793_+|hypothetical-protein
MNHCDYQIIEISPKDLIIEPGFNPREAVIGDLCYEQEPVKSAIISLKQAYKEGRRVDLIKVVKKDSKYVVRQGHCRYRALLLALAEGADIQLFSVVLMHYKDKIEEYLENLDGNRNNSLNPVALAYALAETLKLGSTVESLAMRYQRSGTAIRNQLKILDMPLELQRLISLNLIKKTLAIEIMLKYSNDHAKVLAHLESCSFLVPSSGVLDLSKPTTVETATNSEPLEEQEKPPVHINPKDIKTKSITRSSLGIKRLSHKKTERLKNEFIGLIDNVGSTMSDNNKLTELILDGQHSNLFMNVSNTLITKTNESVKITLDEAKLQLVLSLLNDENTAIIIPKSKVTELNEIRDLLTNE
>CP026171.1|AUU87247.1|15810_16011_+|hypothetical-protein
MDKIVHFTVINTFNDLLIAKASLDRNIVEINAGKRFDHFEEGHDQYVQKVTDALLIVEGRLENLKK
>CP026171.1|AUU87248.1|16007_16727_+|hypothetical-protein
MKHSIFFTHDGYLLPAVVKPFHGNDGHYYAMITRECFACGGTGEIANAVCVTCNGSKTSPATEEKLVLKEGIEFLETIPEFRCNPDLDAWKRRHSGHLALLQADNSKFAVSISQQLNNNLFLTVRQLESFYSTYQPVSKDLPENADVPVEHSFSIGDVVSIDIIFTEVRAAFSKGSHSYFFTFTGKKQNDGFALTGNVQDHVLLGHSYHLSGRVRKIHYFDSVPYALLTVFKLTTKPSA
>CP026171.1|AUU87249.1|16993_17815_+|hypothetical-protein
MQNDLGLGFICKSARASAKIISRKVTFPLNGSSTTKLTLTGLQCHPSCRFPFYQLSMLIHNQLADHAANVVDENAPFTVSINIHEWLSRARVAFIDYHGLRNTDKTAMITLDHLEELLTHLSTTLAVYIPYSKKRLNFSFLTSFTLIKTSQSYTLMFPGVLRPILVLLGGLIQEFMTEKLLKRRNTQLVIFEYLRKSRRHSHKITDIANALQLQTVNVRIMHVLTQLADLGLISFICEGKRGERSIEELQFIPYASRDHSEVLSFEEWISPID
>CP026171.1|AUU87549.1|17829_18654_-|DNA-modification-methylase
MRKHTPIIKWAGGKTKLMPFISQHFPHDQSRRWVEPFIGGGAVFLNMFATDALLADSNPDLINLYRNIQRNKSAFIREVNLLAEREFDKEDYLKLRNTFNSTSLDDAPLQRAVLFYAMNRLGYNGLCRYNLKRKYSVPWGNRSKLTLDPQKVDYLSFRLSGVELTTADFGLTLESAGGCDQIYCDPPYDKISKTSFVSYDGIPFNKSAHVKLADMLVAAHRKGASVAISNSLTPFTLELYEERGFEIHTLNAYRSVGSQSKSRKKEKEILAVLR
>CP026171.1|AUU87250.1|19014_20169_+|DNA-binding-protein
MSDLMTDSQQTNSRVFKSPLVSFSTVTGSGRFVSGMKQFRDANPDLCNEVTEQKAWAINPSVVQISPGFNSREMGMGEAYYQLPEVVDHLNNIKCAFIRGDYVDPIRVLIKDGIPYVCQGHCRLKAALMAQAEGHTDLTILCIEMKADEISCELTTIDGNRGLALSPVALGESYRRLQALGGWSLDRIAEREGKSSTTIAALIRLTGCSVYIKKLIHADAISYVAVLSLIDEFGETEAISRIEKMIAELEKADSSGIKIKKTPRGSIRVVPSDFKPARVPPVLATKAVEGVKLITTSLLQKLGDIQLPEVTDSSEDEEISFTLNRSMLEMLKNLQSEITEAENKQLRRVENRQARLKGEKVTYKSAKNTNTGGEPQSEAPPAQA
>CP026171.1|AUU87251.1|20434_22111_+|restriction-endonuclease-subunit-M
MSAVESNFPQIGAPGNSLVACMPLTGLSVNEDNFLPEMREELGIIASQVESYNEELSLLRSMSTQFMKYGNQKLYSYLSGYNHLISETDALYAENALRSEYWKRVMALTDVLSVMSDEKKNEWDKQFTADRYHRPPQEIPEFTLDAVVATVVTLLNDRHQFIKERVYAVFQSLSRHHKTNKAFGFSTRMITVGVCEGVKDKWVKLKVEFKESGLMPLSELRVICSYFRGETVKPVYDTKKMVENMVGHAGFRNWISLDGNSIRFRVYKNGSMHIDVHPDIAERLNNILAAIVPLALPTERLAHYKATLQEFPALKRCIDFHSRMQLAELEFTRNEKEWSSWTSLGYAGEFADKTRQVNAEVLRFLGARITSYHVTFDYDPTEVMRFIGHMGAMPDIVSHQFYPSSLRLSEYVASIIATGEGERLLEPSIGHGDLLQCFPKSVNVTGIELDTLNCLVSRAKGYDTTEADFLAWSAANPNQKFDCVVMNPPFADNRAKLHLLAAASHLVSGGRLAAVLPLSLQGIDNLLGEGYRAEWMDTFDNEFDNTAVSVRVLYVECL
>CP026171.1|AUU87252.1|22125_22302_+|hypothetical-protein
MSEISPGLPEDQNDVEFMMDDFQQSLGKSKPVHEVQFLGESPQSEDSANAADSPWFEN
>CP026171.1|AUU87253.1|22547_24935_+|DUF4165-domain-containing-protein
MKCRAILLAPLIAFSFTAQAEIAELRFNDTQNQPKIVVPSVQWINPATSFEADVISGLDRYVQLSLLNVNGASLWSTKSSKVTVDDRMTSSSGYDYYGKRLSVPAFGEDNYTLREVITDLQNNEISRRDYVISIDRTPPKTSTIGYTRNGWQYGSEAIFTSVPSGMQYASVQALVFSGLSDSRSGLDRAEYFLVDSNGVERKRGAVINLVDNSVTVQNTTASDPALAPASQSEYRMGLYVYDKAGNKASVSRQSVIDRVNPPSVLQVLNTRTNTWENYSAGITVYSNPISLRVLRNKSNFTAANKTSFGWADANYQSSDSTYNIYSFNFVFPSTGDIYHEFQTLAGGVRRYHHSELSFTPSPTMELAPKVTSKEIFRSDTGKWSSATGNVRTAKFTQIRVTTEPRNYVQRVAANSNRNWYCLIPVGSTGCTMNVDYTFTSDKGMQYIHLVSGKDGTAIYDNLAGAFVVIWDNNPPVINAVKINRMDKNVTMTVTDDDRINGWQIGAWDTREFGVVLKTETGNVIDLPARTWTESDFKTKNAVISYADLPDGKYTVLSAYARDLVGNTANYVINDLLTIDSTAPLISYRYLNDDPEGKLVKGLENLRISVADPSGDASLESLVLSGGPNSEQVTLAYSSQGSGVYTPEYPRIFPVIAKEDGIYTIEAHAVDASGNRSSKKLNFLYQPANMITLDRLRTLATAAALKTTDNQPLAFIRTSVLRRKDGSVITGQLNGTLSVRKDADFPVSVAGVTVAPGETKAIIFDMGQGEERIYSVTPGKSGVSGTSEFAVEFPQF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	226329-226351	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	63039-63061	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	44468-44490	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	12096-12118	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	170368-170390	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	197792-197814	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	373055-373077	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	7864-7886	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	65196-65218	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	199100-199122	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	301567-301589	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	68205-68227	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	222313-222335	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	19382-19404	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	326068-326090	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	2077-2099	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	226286-226309	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	62996-63019	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	44510-44533	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	12138-12161	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	170410-170433	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	197749-197772	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	373097-373120	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	106429-106452	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	7906-7929	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	65153-65176	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	199142-199165	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	301609-301632	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	68162-68185	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	222270-222293	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	19339-19362	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	326110-326133	0	1.0
CP026171_1	1.2\|12138\|24\|CP026171\|CRT	12138-12161	24	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	2034-2057	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	44553-44577	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	12181-12205	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	170453-170477	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	373140-373164	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	7949-7973	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	199185-199209	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	301652-301676	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	326153-326177	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	226242-226266	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	62952-62976	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	197705-197729	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	106385-106409	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	65109-65133	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	68118-68142	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	222226-222250	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	19295-19319	0	1.0
CP026171_1	1.3\|12181\|25\|CP026171\|CRT	12181-12205	25	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	1990-2014	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	226198-226222	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	62908-62932	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	44597-44621	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	12225-12249	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	170497-170521	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	197661-197685	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	373184-373208	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	106341-106365	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	7993-8017	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	65065-65089	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	199229-199253	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	301696-301720	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	68074-68098	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	222182-222206	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	19251-19275	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	326197-326221	0	1.0
CP026171_1	1.4\|12225\|25\|CP026171\|CRT	12225-12249	25	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	1946-1970	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	226154-226178	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	62864-62888	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	44641-44665	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	12269-12293	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	170541-170565	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	197617-197641	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	373228-373252	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	106297-106321	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	8037-8061	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	65021-65045	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	199273-199297	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	301740-301764	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	68030-68054	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	222138-222162	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	19207-19231	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	326241-326265	0	1.0
CP026171_1	1.5\|12269\|25\|CP026171\|CRT	12269-12293	25	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	1902-1926	0	1.0
CP026171_1	1.1\|12096\|23\|CP026171\|CRT	12096-12118	23	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	106472-106494	3	0.87

1. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

2. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

3. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

4. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

5. spacer 1.1|12096|23|CP026171|CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

6. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

7. spacer 1.1|12096|23|CP026171|CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

8. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

9. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

10. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

11. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

12. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

13. spacer 1.1|12096|23|CP026171|CRT matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

14. spacer 1.1|12096|23|CP026171|CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

15. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

16. spacer 1.1|12096|23|CP026171|CRT matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 0, identity: 1.0

cagccacatcctgtgtgtcgccc	CRISPR spacer
cagccacatcctgtgtgtcgccc	Protospacer
***********************

17. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

18. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

19. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

20. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

21. spacer 1.2|12138|24|CP026171|CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

22. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

23. spacer 1.2|12138|24|CP026171|CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

24. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

25. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

26. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

27. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

28. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

29. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

30. spacer 1.2|12138|24|CP026171|CRT matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

31. spacer 1.2|12138|24|CP026171|CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

32. spacer 1.2|12138|24|CP026171|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

33. spacer 1.2|12138|24|CP026171|CRT matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaatgcgccttttccagcct	CRISPR spacer
caaacaatgcgccttttccagcct	Protospacer
************************

34. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

35. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

36. spacer 1.3|12181|25|CP026171|CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

37. spacer 1.3|12181|25|CP026171|CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

38. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

39. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

40. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

41. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

42. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

43. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

44. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

45. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

46. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

47. spacer 1.3|12181|25|CP026171|CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

48. spacer 1.3|12181|25|CP026171|CRT matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

49. spacer 1.3|12181|25|CP026171|CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

50. spacer 1.3|12181|25|CP026171|CRT matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 0, identity: 1.0

gtagcaaagacacatatccgaaacc	CRISPR spacer
gtagcaaagacacatatccgaaacc	Protospacer
*************************

51. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

52. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

53. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

54. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

55. spacer 1.4|12225|25|CP026171|CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

56. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

57. spacer 1.4|12225|25|CP026171|CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

58. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

59. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

60. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

61. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

62. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

63. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

64. spacer 1.4|12225|25|CP026171|CRT matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

65. spacer 1.4|12225|25|CP026171|CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

66. spacer 1.4|12225|25|CP026171|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

67. spacer 1.4|12225|25|CP026171|CRT matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaaaggaaccttttccgggct	CRISPR spacer
cgaccaaaggaaccttttccgggct	Protospacer
*************************

68. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

69. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

70. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

71. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

72. spacer 1.5|12269|25|CP026171|CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

73. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

74. spacer 1.5|12269|25|CP026171|CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

75. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

76. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

77. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

78. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

79. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

80. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

81. spacer 1.5|12269|25|CP026171|CRT matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

82. spacer 1.5|12269|25|CP026171|CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

83. spacer 1.5|12269|25|CP026171|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

84. spacer 1.5|12269|25|CP026171|CRT matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 0, identity: 1.0

cgaccaagggcaacttttactattc	CRISPR spacer
cgaccaagggcaacttttactattc	Protospacer
*************************

85. spacer 1.1|12096|23|CP026171|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 3, identity: 0.87

cagccacatcctgtgtgtcgccc	CRISPR spacer
gccccacatcctgtgtgtcgccc	Protospacer
   ********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

222544 : 286325

Escherichia_phage(40.0%)

transposase,integrase

attL 233506:233519|attR 253403:253416

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87569.1\|222544_223891_+\|transposase	transposase	NA	NA	NA	NA
AUU87437.1\|223949_224741_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AUU87438.1\|224781_225618_-	hypothetical protein	NA	NA	NA	NA
AUU87439.1\|225674_226238_-	hypothetical protein	NA	NA	NA	NA
AUU87440.1\|226604_226898_-	hypothetical protein	NA	NA	NA	NA
AUU87441.1\|226918_227218_-	hypothetical protein	NA	NA	NA	NA
AUU87442.1\|227281_227512_-	hypothetical protein	NA	NA	NA	NA
AUU87443.1\|227533_228481_-	hypothetical protein	NA	NA	NA	NA
AUU87444.1\|228477_228993_-	nuclease	V5UN65	Mycobacterium_phage	3.2e-08	28.9
AUU87445.1\|229215_230643_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	9.5e-103	49.4
AUU87446.1\|230768_230939_+	hypothetical protein	A0A1P7WFU2	Pectobacterium_phage	2.3e-08	56.4
AUU87447.1\|230962_232282_+	DUF1173 domain-containing protein	NA	NA	NA	NA
AUU87448.1\|232295_232499_+	hypothetical protein	NA	NA	NA	NA
AUU87449.1\|232553_233774_-	hypothetical protein	NA	NA	NA	NA
233506:233519	attL	NA	NA	NA	NA
AUU87450.1\|233776_234589_-	DUF4942 domain-containing protein	NA	NA	NA	NA
AUU87570.1\|235089_235755_+	hypothetical protein	NA	NA	NA	NA
AUU87451.1\|235792_236245_+	hypothetical protein	NA	NA	NA	NA
AUU87452.1\|236820_237276_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AUU87453.1\|237347_237743_+	mercuric ion transporter MerT	NA	NA	NA	NA
AUU87454.1\|237758_238034_+	mercuric transporter periplasmic component	NA	NA	NA	NA
AUU87455.1\|238061_238487_+	mercury transport protein MerC	NA	NA	NA	NA
AUU87456.1\|238525_240211_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
AUU87457.1\|240228_240594_+	transcriptional regulator	NA	NA	NA	NA
AUU87458.1\|240590_240827_+	mercury resistance protein	NA	NA	NA	NA
AUU87571.1\|240810_240930_-	mercury resistance protein	NA	NA	NA	NA
AUU87459.1\|240892_241105_+	DUF3330 domain-containing protein	NA	NA	NA	NA
AUU87460.1\|241124_241301_-	resolvase	NA	NA	NA	NA
AUU87461.1\|241342_242107_-\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AUU87462.1\|242194_242308_+	NTP-binding protein	NA	NA	NA	NA
AUU87463.1\|242613_243114_-	N-acetyltransferase	NA	NA	NA	NA
AUU87464.1\|243132_243312_+	hypothetical protein	NA	NA	NA	NA
AUU87465.1\|243241_244081_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AUU87466.1\|244280_244937_-	quinolone resistance pentapeptide repeat protein QnrA1	NA	NA	NA	NA
AUU87467.1\|245269_246811_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AUU87468.1\|247215_248055_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AUU87469.1\|248048_248396_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AUU87470.1\|248559_249351_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AUU87471.1\|249442_249748_-	hypothetical protein	NA	NA	NA	NA
AUU87472.1\|249763_250276_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AUU87473.1\|250394_250859_-	AAC(3)-I family aminoglycoside 3-N-acetyltransferase	NA	NA	NA	NA
AUU87572.1\|250934_251489_-	aminoglycoside N-acetyltransferase AAC(6')-Ib3	NA	NA	NA	NA
AUU87474.1\|251649_252663_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
AUU87475.1\|252601_252859_+	hypothetical protein	NA	NA	NA	NA
AUU87476.1\|252804_253509_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
253403:253416	attR	NA	NA	NA	NA
AUU87477.1\|254481_255570_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AUU87478.1\|255656_255917_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
AUU87479.1\|256214_257075_+	class A extended-spectrum beta-lactamase SHV-5	A0A077SL40	Escherichia_phage	4.4e-156	99.7
AUU87480.1\|257095_257857_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AUU87481.1\|258117_259020_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0
AUU87482.1\|259031_260297_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.6e-234	99.8
AUU87483.1\|260289_260910_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
AUU87484.1\|261621_262326_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUU87485.1\|262488_263511_+\|transposase	IS110-like element IS5708 family transposase	NA	NA	NA	NA
AUU87486.1\|264346_265738_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AUU87487.1\|265836_266805_+\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	3.8e-172	91.3
AUU87573.1\|267066_267864_-	KR domain-containing protein	Q06VL0	Trichoplusia_ni_ascovirus	5.1e-13	26.9
AUU87488.1\|268025_268994_+\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	1.7e-172	91.6
AUU87574.1\|269197_270127_+\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	1.4e-75	53.1
AUU87575.1\|271426_272407_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AUU87489.1\|273109_274633_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.8e-44	31.8
AUU87490.1\|274926_275337_+	hypothetical protein	NA	NA	NA	NA
AUU87491.1\|275728_276880_-\|transposase	IS30 family transposase IS30	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
AUU87492.1\|276836_277193_-	hypothetical protein	U5P4I9	Shigella_phage	1.3e-32	91.2
AUU87493.1\|278264_278561_+	XRE family transcriptional regulator	NA	NA	NA	NA
AUU87494.1\|278984_279641_+	TetR family transcriptional regulator	NA	NA	NA	NA
AUU87576.1\|279703_280687_-	oxidoreductase	NA	NA	NA	NA
AUU87495.1\|281898_282174_+	regulator protein FrmR	NA	NA	NA	NA
AUU87496.1\|282208_283318_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	4.9e-30	28.3
AUU87497.1\|283361_283760_+	VOC family protein	NA	NA	NA	NA
AUU87498.1\|283824_284661_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AUU87499.1\|285248_286325_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP026170

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13841 : 73532

Macacine_betaherpesvirus(20.0%)

transposase,holin,integrase

attL 38436:38495|attR 72367:73283

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87139.1\|13841_14621_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	1.5e-49	88.4
AUU87140.1\|16756_17281_+	hypothetical protein	NA	NA	NA	NA
AUU87141.1\|17319_17559_+	hypothetical protein	NA	NA	NA	NA
AUU87228.1\|17801_18296_-	hypothetical protein	NA	NA	NA	NA
AUU87142.1\|18342_18888_-	hypothetical protein	NA	NA	NA	NA
AUU87143.1\|19581_20664_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.5e-185	96.1
AUU87144.1\|20785_23860_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	95.5
AUU87145.1\|23911_25165_+	MFS transporter	NA	NA	NA	NA
AUU87146.1\|25221_25392_+	galactoside O-acetyltransferase	NA	NA	NA	NA
AUU87147.1\|28637_29195_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	2.6e-48	81.3
AUU87148.1\|29324_29537_-	DUF3330 domain-containing protein	NA	NA	NA	NA
AUU87229.1\|29499_29619_+	mercury resistance protein	NA	NA	NA	NA
AUU87149.1\|29602_29839_-	mercury resistance protein	NA	NA	NA	NA
AUU87150.1\|29835_30201_-	transcriptional regulator	NA	NA	NA	NA
AUU87151.1\|30218_31904_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
AUU87152.1\|31942_32368_-	mercury transport protein MerC	NA	NA	NA	NA
AUU87153.1\|32619_33324_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	99.6
AUU87154.1\|33742_34156_-	hypothetical protein	NA	NA	NA	NA
AUU87155.1\|34832_35234_+	hypothetical protein	NA	NA	NA	NA
AUU87156.1\|36094_36493_+	DNA-binding protein	NA	NA	NA	NA
AUU87157.1\|37541_37853_+	cytoplasmic protein	NA	NA	NA	NA
AUU87158.1\|37849_38269_+	transcriptional regulator	NA	NA	NA	NA
38436:38495	attL	NA	NA	NA	NA
AUU87159.1\|39251_39458_+\|transposase	transposase	NA	NA	NA	NA
AUU87160.1\|39414_40566_+\|transposase	IS30 family transposase IS30	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
AUU87230.1\|43937_45145_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	5.7e-101	62.9
AUU87161.1\|45471_45867_+	hypothetical protein	NA	NA	NA	NA
AUU87162.1\|48118_49090_-	plasmid-partitioning protein	I3WF22	Macacine_betaherpesvirus	3.5e-109	62.9
AUU87163.1\|49089_50256_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	3.2e-218	93.3
AUU87164.1\|50920_51781_-	protein RepA	Q71TL8	Escherichia_phage	3.6e-65	48.9
AUU87165.1\|53010_54201_-	MFS transporter	NA	NA	NA	NA
AUU87166.1\|54288_55083_+	AraC family transcriptional regulator	NA	NA	NA	NA
AUU87167.1\|56207_57131_+	aminoimidazole riboside kinase	NA	NA	NA	NA
AUU87168.1\|57296_58814_+	carbohydrate porin	NA	NA	NA	NA
AUU87169.1\|58949_60320_+	PTS sucrose EIIBC component	NA	NA	NA	NA
AUU87170.1\|60319_61720_+	glycosyl hydrolase family 32	S6ATV4	Bacillus_phage	6.2e-14	24.4
AUU87171.1\|61749_62754_+	transcriptional regulator	NA	NA	NA	NA
AUU87172.1\|63032_63932_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUU87173.1\|65542_65731_-	hypothetical protein	NA	NA	NA	NA
AUU87174.1\|66073_66505_-	hypothetical protein	NA	NA	NA	NA
AUU87175.1\|66863_67196_+	hypothetical protein	NA	NA	NA	NA
AUU87176.1\|67961_68141_+	hypothetical protein	NA	NA	NA	NA
AUU87177.1\|68289_70287_+\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	1.4e-19	24.7
AUU87178.1\|70776_71769_-\|integrase	integrase	A0A0K0N6I5	Gordonia_phage	2.3e-07	32.7
AUU87179.1\|72384_73532_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
72367:73283	attR	NA	NA	NA	NA

DBSCAN-SWA_2

93320 : 107068

Salmonella_phage(25.0%)

transposase,integrase

attL 94131:94146|attR 108212:108227

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87193.1\|93320_95726_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.9e-140	45.8
94131:94146	attL	NA	NA	NA	NA
AUU87194.1\|95722_96802_+	signal peptidase II	NA	NA	NA	NA
AUU87195.1\|96977_97538_+\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
AUU87196.1\|97541_100508_+\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
AUU87197.1\|100967_101225_-	DDE domain-containing protein	A0A077SL39	Escherichia_phage	8.9e-12	61.9
AUU87198.1\|101288_102053_-\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AUU87199.1\|102140_102254_+	NTP-binding protein	NA	NA	NA	NA
AUU87200.1\|102559_103060_-	N-acetyltransferase	NA	NA	NA	NA
AUU87201.1\|103078_103258_+	hypothetical protein	NA	NA	NA	NA
AUU87202.1\|103187_104027_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AUU87203.1\|104020_104368_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AUU87204.1\|104531_105323_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AUU87205.1\|105424_105898_-	trimethoprim-resistant dihydrofolate reductase DfrA15	G3MBI7	Bacillus_virus	6.9e-18	30.8
AUU87206.1\|106054_107068_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
108212:108227	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP026169

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 45374

Burkholderia_phage(18.75%)

integrase,transposase

attL 38907:38924|attR 46091:46108

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87065.1\|4446_5442_-	glycosyl transferase	NA	NA	NA	NA
AUU87066.1\|5502_6330_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.0e-53	42.0
AUU87067.1\|6348_7827_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-200	74.6
AUU87068.1\|8252_8876_+	serine recombinase	NA	NA	NA	NA
AUU87069.1\|8930_11915_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.5e-301	54.2
AUU87070.1\|12154_13474_+\|transposase	IS1182 family transposase ISKpn6	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AUU87071.1\|13723_14605_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
AUU87072.1\|15129_15834_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUU87073.1\|16406_16772_-	FipA	NA	NA	NA	NA
AUU87074.1\|16771_20008_-	conjugative relaxase	U5J9B0	Bacillus_phage	2.4e-05	27.3
AUU87075.1\|20007_21537_-	DUF87 domain-containing protein	NA	NA	NA	NA
AUU87076.1\|21538_21955_-	traK protein	NA	NA	NA	NA
AUU87119.1\|22727_22865_+	StbA	NA	NA	NA	NA
AUU87077.1\|22873_23590_+	StdB protein	NA	NA	NA	NA
AUU87078.1\|23591_23960_+	StbC	NA	NA	NA	NA
AUU87120.1\|24252_24486_+	hypothetical protein	NA	NA	NA	NA
AUU87079.1\|24596_24917_-	CcgAII protein	NA	NA	NA	NA
AUU87080.1\|24971_25151_-	cobalamin biosynthesis protein CbiX	NA	NA	NA	NA
AUU87081.1\|25877_26387_-	antirestriction protein	NA	NA	NA	NA
AUU87082.1\|27739_28072_-	hypothetical protein	NA	NA	NA	NA
AUU87083.1\|28280_28565_-	cobalamin biosynthesis protein CbiX	NA	NA	NA	NA
AUU87084.1\|28633_28993_-	hypothetical protein	NA	NA	NA	NA
AUU87085.1\|28989_29286_-	cobalamin biosynthesis protein CbiX	NA	NA	NA	NA
AUU87086.1\|30171_30411_-	cobalamin biosynthesis protein CbiX	NA	NA	NA	NA
AUU87087.1\|30420_30825_-	antirestriction protein ArdR	NA	NA	NA	NA
AUU87088.1\|30882_31308_-	hypothetical protein	NA	NA	NA	NA
AUU87089.1\|31722_32163_+	peptidase	A0A1W6JNS2	Morganella_phage	1.2e-27	48.8
AUU87090.1\|32150_33416_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	2.2e-119	53.8
AUU87121.1\|33566_34358_+	sprT domain-containing protein	NA	NA	NA	NA
AUU87091.1\|34372_34714_-	ArdK family transcriptional regulator	NA	NA	NA	NA
AUU87092.1\|35273_35993_+	RepB family plasmid replication initiator protein	I3WF20	Macacine_betaherpesvirus	8.6e-20	28.9
AUU87093.1\|36599_38012_+	hypothetical protein	NA	NA	NA	NA
AUU87094.1\|38433_39003_-	recombinase family protein	E5FFF9	Burkholderia_phage	5.2e-36	43.2
38907:38924	attL	NA	NA	NA	NA
AUU87095.1\|39142_39457_-\|transposase	transposase	NA	NA	NA	NA
AUU87096.1\|39395_40409_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AUU87097.1\|40555_41038_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	6.6e-16	28.9
AUU87098.1\|41258_41525_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AUU87099.1\|41667_42432_+\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AUU87100.1\|42473_42686_+	resolvase	NA	NA	NA	NA
AUU87101.1\|42698_43907_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
AUU87102.1\|43940_45374_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
46091:46108	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP026168

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 17952

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87003.1\|2123_2753_-	hypothetical protein	NA	NA	NA	NA
AUU87058.1\|2998_3628_-	hypothetical protein	NA	NA	NA	NA
AUU87004.1\|3909_4419_-	transcription termination factor NusG	NA	NA	NA	NA
AUU87005.1\|4705_4966_-	conjugal transfer protein TraA	NA	NA	NA	NA
AUU87006.1\|5417_6080_-	hypothetical protein	NA	NA	NA	NA
AUU87007.1\|6350_6551_+	plasmid stabilization protein	NA	NA	NA	NA
AUU87008.1\|6856_7393_+	hypothetical protein	NA	NA	NA	NA
AUU87009.1\|7389_8412_+	replication initiation protein	NA	NA	NA	NA
AUU87010.1\|8907_9210_-	hypothetical protein	NA	NA	NA	NA
AUU87059.1\|9958_10414_+	hypothetical protein	NA	NA	NA	NA
AUU87011.1\|10578_11391_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.0e-37	78.4
AUU87012.1\|11549_11840_+	nucleotidyltransferase	NA	NA	NA	NA
AUU87013.1\|11836_12238_+	DUF86 domain-containing protein	NA	NA	NA	NA
AUU87014.1\|12227_12584_+	cupin domain-containing protein	NA	NA	NA	NA
AUU87015.1\|12838_13165_+	hypothetical protein	NA	NA	NA	NA
AUU87016.1\|13161_13662_+\|transposase	transposase	NA	NA	NA	NA
AUU87017.1\|13658_14030_+	hypothetical protein	NA	NA	NA	NA
AUU87018.1\|14023_14581_+	recombinase family protein	A0A0C4UR34	Shigella_phage	3.3e-59	63.2
AUU87019.1\|14577_14958_-	chromosome partitioning protein ParB	A0A0R6PHV6	Moraxella_phage	1.4e-13	46.2
AUU87020.1\|14964_17952_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.5e-294	53.3

DBSCAN-SWA_2

21794 : 24298

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87023.1\|21794_22499_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUU87024.1\|22508_22973_+	hypothetical protein	W8CYM9	Bacillus_phage	1.6e-11	31.5
AUU87025.1\|22948_24298_+	two-component sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	2.9e-08	25.6

DBSCAN-SWA_3

27508 : 33782

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87028.1\|27508_27709_-	hypothetical protein	A0A2L1IV26	Escherichia_phage	6.1e-08	93.3
AUU87029.1\|27784_28576_+	resolvase	I3WFA4	Macacine_betaherpesvirus	6.5e-53	92.9
AUU87030.1\|28726_28918_-	hypothetical protein	NA	NA	NA	NA
AUU87031.1\|28914_29100_-	hypothetical protein	NA	NA	NA	NA
AUU87032.1\|29390_30023_+	hypothetical protein	A0A0K1LMB9	Rhodobacter_phage	8.1e-30	40.3
AUU87033.1\|30022_30433_+	hypothetical protein	NA	NA	NA	NA
AUU87034.1\|30713_31688_+	plasmid segregation protein parM	A0A222YXF2	Escherichia_phage	7.5e-67	43.1
AUU87035.1\|31692_32082_+	plasmid stability protein	A0A222YWJ6	Escherichia_phage	1.1e-05	45.5
AUU87036.1\|32085_33354_-	DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.5e-147	61.0
AUU87037.1\|33353_33782_-	peptidase	A0A1W6JNS2	Morganella_phage	7.4e-27	47.7

DBSCAN-SWA_4

38520 : 39659

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87045.1\|38520_39024_+	antirestriction protein	A0A1I9S7Y0	Rhodococcus_phage	4.3e-10	34.7
AUU87046.1\|39061_39247_+	hypothetical protein	NA	NA	NA	NA
AUU87047.1\|39404_39659_+	DNA polymerase III subunit theta	A0A077SLL5	Escherichia_phage	2.7e-21	65.5

DBSCAN-SWA_5

46336 : 48661

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU87055.1\|46336_47164_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.0e-53	42.0
AUU87056.1\|47182_48661_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-200	74.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP026167

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

198377 : 267448

Cronobacter_phage(35.14%)

tRNA,tail,integrase,capsid,portal,holin,head,plate,terminase,protease

attL 212582:212597|attR 273442:273457

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU82688.1\|198377_200462_-\|protease	serine protease	Q2A0D0	Sodalis_phage	1.4e-22	26.0
AUU82689.1\|200831_201500_+	DNA-binding response regulator	NA	NA	NA	NA
AUU82690.1\|201520_202534_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.8e-108	58.9
AUU82691.1\|202771_202987_+	30S ribosomal protein S21	NA	NA	NA	NA
AUU82692.1\|203103_204849_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.7e-77	39.2
AUU82693.1\|204878_206861_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	9.0e-35	33.7
AUU82694.1\|206922_207429_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
AUU82695.1\|207811_208177_+	hypothetical protein	R9TR46	Vibrio_phage	6.1e-22	63.4
AUU86839.1\|208235_208454_-	transcriptional regulator	A0A2I8TV89	Erwinia_phage	4.3e-31	80.6
AUU82696.1\|208519_209668_-	hypothetical protein	Q7Y4C6	Escherichia_virus	3.0e-168	78.8
AUU82697.1\|209660_210149_-\|tail	phage tail protein	A0A0F7LBX3	Escherichia_phage	1.5e-68	80.4
AUU82698.1\|210164_212879_-\|tail	phage tail tape measure protein	F1BUT7	Erwinia_phage	1.3e-196	62.3
212582:212597	attL	NA	NA	NA	NA
AUU82699.1\|212871_212991_-\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	2.6e-14	89.7
AUU82700.1\|213023_213299_-	hypothetical protein	A0A0F7LDQ8	Escherichia_phage	9.8e-33	81.3
AUU82701.1\|213359_213878_-\|tail	phage major tail tube protein	A0A0F7LDZ1	Escherichia_phage	1.2e-87	91.9
AUU82702.1\|213892_215083_-\|tail	phage tail protein	A0A0F7LBW9	Escherichia_phage	2.7e-196	85.1
AUU82703.1\|217390_218002_-\|tail	phage tail protein I	A0A218M4J3	Erwinia_phage	7.9e-99	88.6
AUU82704.1\|217994_218903_-\|plate	baseplate assembly protein	A0A218M4K5	Erwinia_phage	2.6e-130	79.5
AUU82705.1\|218907_219255_-\|plate	baseplate assembly protein	A0A0F7LDQ1	Escherichia_phage	9.5e-41	70.4
AUU82706.1\|219251_219887_-\|plate	phage baseplate assembly protein V	A0A0F7LDY9	Escherichia_phage	9.4e-95	82.5
AUU82707.1\|219956_220406_-	phage virion morphogenesis protein	O80313	Escherichia_phage	9.4e-49	66.0
AUU82708.1\|220398_220866_-\|tail	phage tail protein	A0A0F7LA33	Escherichia_phage	5.1e-66	78.7
AUU82709.1\|220940_221390_-	LysB family transcriptional regulator	F1BUQ1	Erwinia_phage	3.0e-47	70.1
AUU82710.1\|221374_221776_-	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	4.6e-15	37.6
AUU82711.1\|221772_222282_-	glycoside hydrolase	A0A218M4K3	Erwinia_phage	1.7e-70	76.0
AUU82712.1\|222284_222512_-\|holin	holin	A0A218M4L5	Erwinia_phage	9.6e-10	54.5
AUU82713.1\|222502_222706_-\|tail	phage tail protein	A0A0F7LCN2	Escherichia_phage	6.1e-24	79.1
AUU82714.1\|222705_223209_-\|head	head completion/stabilization protein	A0A0F7LDJ1	Escherichia_phage	9.5e-66	77.5
AUU82715.1\|223306_224056_-\|terminase	terminase	U5N091	Enterobacteria_phage	8.8e-92	77.5
AUU82716.1\|224059_225136_-\|capsid	phage major capsid protein, P2 family	Q778Y7	Enterobacteria_phage	1.0e-165	80.7
AUU82717.1\|225193_226048_-\|capsid	GPO family capsid scaffolding protein	Q94MB7	Escherichia_virus	1.6e-121	76.8
AUU82718.1\|226215_227985_+	oxidoreductase	A0A0M4RE51	Salmonella_phage	3.8e-303	86.1
AUU82719.1\|227984_229019_+\|portal	phage portal protein	M1SV64	Escherichia_phage	1.1e-161	80.6
AUU82720.1\|229372_229696_-	hypothetical protein	K7PGV5	Enterobacterial_phage	1.8e-25	57.0
AUU82721.1\|229770_229959_-	hypothetical protein	F1BUR9	Erwinia_phage	2.6e-16	71.0
AUU86840.1\|230105_232208_-	replication protein	A0A218M4H2	Erwinia_phage	1.2e-292	71.5
AUU82722.1\|232315_233170_-	DNA adenine methylase	A0A1S6L011	Salmonella_phage	6.2e-110	69.0
AUU82723.1\|233166_233358_-	hypothetical protein	NA	NA	NA	NA
AUU82724.1\|233358_233580_-	hypothetical protein	Q6K1F5	Salmonella_virus	8.2e-22	73.6
AUU82725.1\|233579_233807_-	hypothetical protein	A0A0M3UL87	Salmonella_phage	5.3e-24	80.0
AUU86841.1\|233876_234224_-	hypothetical protein	F1BUS4	Erwinia_phage	1.1e-23	53.6
AUU82726.1\|234244_234442_-	DUF2724 domain-containing protein	A0A0M4RTI3	Salmonella_phage	6.2e-13	66.0
AUU82727.1\|234449_234959_-	hypothetical protein	A0A0M4QWN1	Salmonella_phage	2.7e-60	65.1
AUU82728.1\|234989_235253_-	hypothetical protein	A0A218M4I5	Erwinia_phage	2.4e-28	70.1
AUU82729.1\|235382_235961_+	phage repressor protein CI	A0A218M4J1	Erwinia_phage	6.6e-63	62.2
AUU82730.1\|235960_237010_+\|integrase	integrase	A0A218M4I3	Erwinia_phage	6.4e-181	88.7
AUU82731.1\|238265_238544_+	hypothetical protein	NA	NA	NA	NA
AUU82732.1\|238581_240279_-	hypothetical protein	F1BUJ7	Cronobacter_phage	3.6e-210	66.1
AUU82733.1\|240282_240828_-	hypothetical protein	F1BUJ9	Cronobacter_phage	5.6e-56	68.7
AUU86842.1\|240802_241519_-	hypothetical protein	F1BUK1	Cronobacter_phage	2.0e-48	53.1
AUU82734.1\|241550_244586_-	hypothetical protein	O09496	Escherichia_virus	7.5e-158	47.6
AUU82735.1\|244594_245233_-	hypothetical protein	F1BUK5	Cronobacter_phage	3.8e-80	76.2
AUU82736.1\|245225_246410_-	hypothetical protein	F1BUK6	Cronobacter_phage	6.1e-180	81.5
AUU82737.1\|246406_246736_-	DUF2590 domain-containing protein	F1BUK8	Cronobacter_phage	2.1e-45	85.7
AUU82738.1\|246732_248700_-\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	1.9e-258	68.6
AUU82739.1\|248887_249148_-	hypothetical protein	A5X9I7	Aeromonas_virus	4.5e-19	54.7
AUU82740.1\|249131_249320_-	hypothetical protein	F1BUL1	Cronobacter_phage	1.1e-11	61.7
AUU82741.1\|249264_249630_-	hypothetical protein	F1BUL2	Cronobacter_phage	4.2e-23	58.5
AUU82742.1\|249629_249971_-	hypothetical protein	F1BUL3	Cronobacter_phage	5.1e-47	87.1
AUU82743.1\|249967_250261_-\|holin	holin	A0A0M5M1H1	Salmonella_phage	6.0e-20	54.2
AUU82744.1\|250269_250725_-	DUF2597 domain-containing protein	F1BUL4	Cronobacter_phage	2.8e-64	78.1
AUU82745.1\|250721_251849_-	DUF2586 domain-containing protein	F1BUL5	Cronobacter_phage	2.5e-175	81.9
AUU82746.1\|251866_252553_-	hypothetical protein	F1BUL6	Cronobacter_phage	8.6e-102	82.5
AUU82747.1\|252552_253056_-\|tail	phage tail protein	F1BUL7	Cronobacter_phage	1.5e-66	70.9
AUU82748.1\|253052_253505_-\|head	head completion protein	F1BUL8	Cronobacter_phage	9.1e-60	77.3
AUU82749.1\|253598_254303_-\|terminase	terminase	F1BUM0	Cronobacter_phage	7.7e-98	76.3
AUU82750.1\|254306_255329_-\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	1.2e-155	80.0
AUU86843.1\|255382_256192_-\|capsid	phage capsid protein	F1BUM4	Cronobacter_phage	3.9e-77	54.4
AUU82751.1\|256349_258125_+\|terminase	terminase	F1BUM5	Cronobacter_phage	2.6e-283	82.8
AUU82752.1\|258121_259153_+\|portal	phage portal protein	F1BUM7	Cronobacter_phage	7.2e-161	80.5
AUU82753.1\|259149_259470_+	transcriptional regulator	F1BUM8	Cronobacter_phage	5.1e-41	78.8
AUU82754.1\|259446_259635_-	hypothetical protein	NA	NA	NA	NA
AUU82755.1\|259753_261796_-	replication endonuclease	F1BUM9	Cronobacter_phage	0.0e+00	77.4
AUU82756.1\|261794_262091_+	hypothetical protein	NA	NA	NA	NA
AUU82757.1\|262169_263027_-	adenine methylase	F1BUN1	Cronobacter_phage	3.4e-132	83.4
AUU82758.1\|263017_263251_-	hypothetical protein	NA	NA	NA	NA
AUU82759.1\|263317_263719_-	hypothetical protein	F1BUN2	Cronobacter_phage	1.6e-39	56.4
AUU82760.1\|263718_264147_-	hypothetical protein	F1BUN5	Cronobacter_phage	1.5e-27	54.1
AUU82761.1\|264136_264334_-	hypothetical protein	NA	NA	NA	NA
AUU82762.1\|264343_264847_-	hypothetical protein	F1BUN6	Cronobacter_phage	6.8e-64	76.0
AUU82763.1\|264877_265099_-	regulator	NA	NA	NA	NA
AUU82764.1\|265242_265824_+	phage repressor protein	A0A218M4J1	Erwinia_phage	6.9e-28	37.2
AUU82765.1\|265840_266407_+	hypothetical protein	Q4ZA70	Staphylococcus_virus	2.8e-18	32.2
AUU82766.1\|266410_267448_+\|integrase	integrase	F1BUS9	Erwinia_phage	8.6e-122	64.4
273442:273457	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1421415 : 1481513

uncultured_Caudovirales_phage(25.0%)

tRNA,integrase,capsid,transposase,protease

attL 1468523:1468582|attR 1481611:1481673

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU83806.1\|1421415_1422768_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
AUU83807.1\|1422993_1423377_+	cytochrome b562	NA	NA	NA	NA
AUU83808.1\|1423733_1425102_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.6e-75	69.0
AUU83809.1\|1425086_1425197_+	ABC transporter	NA	NA	NA	NA
AUU83810.1\|1425235_1426216_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
AUU83811.1\|1426288_1426612_+	hypothetical protein	NA	NA	NA	NA
AUU83812.1\|1426757_1427174_-	VapC toxin family PIN domain ribonuclease	NA	NA	NA	NA
AUU83813.1\|1427170_1427401_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AUU86874.1\|1427624_1427741_+	hypothetical protein	NA	NA	NA	NA
AUU83814.1\|1428313_1428781_-	hypothetical protein	NA	NA	NA	NA
AUU83815.1\|1430032_1430458_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.8e-48	69.3
AUU83816.1\|1430924_1431263_+	glycine dehydrogenase	NA	NA	NA	NA
AUU83817.1\|1431273_1431636_+	hypothetical protein	NA	NA	NA	NA
AUU83818.1\|1431638_1431938_+	cytoplasmic protein	NA	NA	NA	NA
AUU83819.1\|1431960_1432737_+	hypothetical protein	NA	NA	NA	NA
AUU83820.1\|1432750_1433392_+	hypothetical protein	NA	NA	NA	NA
AUU83821.1\|1433434_1434568_+	amidohydrolase/deacetylase family metallohydrolase	NA	NA	NA	NA
AUU83822.1\|1434551_1435670_+	SelA-like pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AUU83823.1\|1435666_1436407_+	2-dehydro-3-deoxyphosphooctonate aldolase	NA	NA	NA	NA
AUU83824.1\|1436461_1437598_+	6-phosphogluconolactonase	NA	NA	NA	NA
AUU83825.1\|1437617_1439528_+	transcription antiterminator BglG	NA	NA	NA	NA
AUU83826.1\|1439605_1439848_+	type II toxin-antitoxin system antitoxin, RelB/DinJ family	A0A2H4JBG1	uncultured_Caudovirales_phage	1.1e-16	52.5
AUU83827.1\|1439837_1440122_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	A0A2H4JBF4	uncultured_Caudovirales_phage	2.3e-29	69.1
AUU83828.1\|1440125_1440590_-	anaerobic ribonucleotide reductase-activating protein	K4F9T1	Cronobacter_phage	3.6e-51	55.2
AUU83829.1\|1440696_1442835_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	2.8e-268	64.7
AUU83830.1\|1443205_1444861_-	alpha,alpha-phosphotrehalase	NA	NA	NA	NA
AUU83831.1\|1444911_1446333_-	PTS trehalose transporter subunit IIBC	NA	NA	NA	NA
AUU83832.1\|1446459_1447407_-	trehalose operon repressor	C6ZCU4	Enterobacteria_phage	1.6e-13	22.6
AUU83833.1\|1447797_1450500_+	magnesium-translocating P-type ATPase	M1HLC0	Paramecium_bursaria_Chlorella_virus	3.8e-44	26.5
AUU83834.1\|1450655_1453040_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
AUU83835.1\|1453043_1453241_+	hypothetical protein	NA	NA	NA	NA
AUU83836.1\|1454814_1455201_-	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
AUU83837.1\|1455269_1455731_-	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
AUU83838.1\|1455743_1456676_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.6e-50	38.9
AUU83839.1\|1456710_1456815_-	PyrBI operon leader peptide	NA	NA	NA	NA
AUU83840.1\|1457018_1457471_+	YhcH/YjgK/YiaL family protein	NA	NA	NA	NA
AUU83841.1\|1457659_1458568_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
AUU83842.1\|1458582_1460550_+	YjhG/YagF family D-xylonate dehydratase	NA	NA	NA	NA
AUU83843.1\|1460789_1462172_+	MFS transporter	NA	NA	NA	NA
AUU83844.1\|1462184_1463798_+	glycoside hydrolase 43 family protein	NA	NA	NA	NA
AUU83845.1\|1463802_1464561_-	IclR family transcriptional regulator	NA	NA	NA	NA
AUU83846.1\|1464814_1465174_+	hypothetical protein	NA	NA	NA	NA
AUU83847.1\|1465238_1466243_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AUU83848.1\|1466407_1466830_+	ribonuclease E inhibitor RraB	NA	NA	NA	NA
AUU83849.1\|1466874_1467633_+\|tRNA	tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE	NA	NA	NA	NA
AUU83850.1\|1467667_1468399_+	topoisomerase II	NA	NA	NA	NA
1468523:1468582	attL	NA	NA	NA	NA
AUU83851.1\|1469533_1470349_-	hypothetical protein	NA	NA	NA	NA
AUU83852.1\|1470531_1470807_-	hypothetical protein	NA	NA	NA	NA
AUU83853.1\|1471248_1471512_-	hypothetical protein	NA	NA	NA	NA
AUU83854.1\|1471511_1472099_-\|integrase	integrase	NA	NA	NA	NA
AUU83855.1\|1474039_1474477_+	hypothetical protein	NA	NA	NA	NA
AUU83856.1\|1474642_1475824_+	hypothetical protein	NA	NA	NA	NA
AUU83857.1\|1475830_1476415_+	hypothetical protein	NA	NA	NA	NA
AUU83858.1\|1476521_1476890_+	hypothetical protein	NA	NA	NA	NA
AUU83859.1\|1477536_1477881_+	hypothetical protein	NA	NA	NA	NA
AUU83860.1\|1477905_1478943_+\|capsid	phage capsid protein	K4F6Z8	Cronobacter_phage	4.9e-08	24.4
AUU83861.1\|1479095_1479389_+	hypothetical protein	NA	NA	NA	NA
AUU83862.1\|1479709_1480288_+	N-acetyltransferase	Q8HA62	Vibrio_phage	3.0e-39	49.2
AUU83863.1\|1480268_1481513_-\|integrase	integrase	NA	NA	NA	NA
1481611:1481673	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2787150 : 2884542

113

Enterobacteria_phage(46.15%)

tRNA,tail,integrase,lysis,capsid,portal,head,terminase,transposase

attL 2810211:2810236|attR 2854652:2854677

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU85004.1\|2787150_2787642_+\|transposase	transposase	NA	NA	NA	NA
AUU85005.1\|2787781_2788903_-	50S ribosomal protein L16 arginine hydroxylase	NA	NA	NA	NA
AUU85006.1\|2788992_2790456_-	two-component system sensor histidine kinase PhoQ	NA	NA	NA	NA
AUU85007.1\|2790456_2791128_-	two-component system response regulator PhoP	NA	NA	NA	NA
AUU85008.1\|2791202_2792489_-\|integrase	site-specific integrase	A0A0U2JGI6	Escherichia_phage	6.1e-109	49.6
AUU85009.1\|2792488_2792704_-	hypothetical protein	NA	NA	NA	NA
AUU85010.1\|2792770_2795692_-	hypothetical protein	K7P6V4	Enterobacteria_phage	5.9e-168	59.4
AUU86929.1\|2795829_2796159_-	transcriptional regulator	NA	NA	NA	NA
AUU85011.1\|2796174_2796510_-	hypothetical protein	NA	NA	NA	NA
AUU85012.1\|2796675_2796858_-	DUF1482 domain-containing protein	NA	NA	NA	NA
AUU85013.1\|2797250_2797640_-	transcriptional regulator	A0A077KGZ5	Edwardsiella_phage	2.8e-17	68.6
AUU85014.1\|2797748_2797973_+	transcriptional regulator	K7PKH4	Enterobacteria_phage	3.0e-16	58.5
AUU85015.1\|2797975_2798530_+	hypothetical protein	NA	NA	NA	NA
AUU85016.1\|2799318_2799990_+	replication protein	A0A0U2JGJ0	Escherichia_phage	8.8e-67	76.2
AUU85017.1\|2800005_2800422_+	hypothetical protein	NA	NA	NA	NA
AUU85018.1\|2800712_2801861_+	cytosine methyltransferase	M1PSQ0	Streptococcus_phage	3.7e-33	31.2
AUU85019.1\|2802818_2804231_-	ATP-binding protein	NA	NA	NA	NA
AUU85020.1\|2804909_2805158_+	hypothetical protein	NA	NA	NA	NA
AUU85021.1\|2805283_2805490_+	hypothetical protein	NA	NA	NA	NA
AUU86930.1\|2805510_2805843_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	1.9e-38	63.9
AUU85022.1\|2805842_2806874_+	hypothetical protein	A0A291AWV9	Escherichia_phage	2.7e-107	57.1
AUU85023.1\|2806887_2807502_+	hypothetical protein	H9C175	Pectobacterium_phage	2.8e-64	62.2
AUU85024.1\|2807765_2808143_+	hypothetical protein	A0A248XD00	Klebsiella_phage	7.5e-07	31.7
AUU85025.1\|2808139_2808412_+	hypothetical protein	NA	NA	NA	NA
AUU85026.1\|2808414_2809029_+	endolysin	Q8HA86	Salmonella_phage	3.6e-91	78.8
AUU85027.1\|2809025_2809376_+	hypothetical protein	R9TPM9	Aeromonas_phage	6.7e-10	37.6
AUU85028.1\|2809882_2810110_+	hypothetical protein	NA	NA	NA	NA
2810211:2810236	attL	NA	NA	NA	NA
AUU85029.1\|2810844_2811186_+	hypothetical protein	Q9EYD5	Enterobacteria_phage	2.5e-09	34.2
AUU85030.1\|2811422_2811911_+\|terminase	terminase	K7PJY2	Enterobacterial_phage	4.4e-68	82.1
AUU85031.1\|2811910_2814013_+	DNA packaging protein	K7PH52	Enterobacterial_phage	0.0e+00	80.7
AUU85032.1\|2814009_2814231_+	hypothetical protein	A5LH28	Enterobacteria_phage	6.5e-19	70.4
AUU85033.1\|2814227_2815733_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	1.9e-215	73.3
AUU85034.1\|2815677_2817690_+	peptidase S14	K7PKX4	Enterobacterial_phage	0.0e+00	83.6
AUU85035.1\|2817770_2818094_+	recombinase RecA	NA	NA	NA	NA
AUU85036.1\|2818086_2818362_+	ATP-binding protein	K7PH55	Enterobacterial_phage	3.2e-15	50.0
AUU85037.1\|2818372_2818927_+\|tail	phage tail protein	K7PKQ5	Enterobacteria_phage	5.0e-44	63.4
AUU85038.1\|2818923_2819322_+\|tail	phage tail protein	K7PHM6	Enterobacterial_phage	2.1e-44	63.6
AUU85039.1\|2819329_2820067_+\|tail	phage tail protein	M9NYX0	Enterobacteria_phage	1.2e-96	72.7
AUU85040.1\|2820108_2820519_+\|tail	phage minor tail protein G	M9NZD7	Enterobacteria_phage	1.2e-18	41.6
AUU85041.1\|2820539_2820848_+\|tail	phage tail assembly protein T	A0A0K2FJB3	Enterobacteria_phage	2.3e-22	55.1
AUU85042.1\|2820828_2823333_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	5.2e-298	66.6
AUU85043.1\|2823332_2823680_+\|tail	phage tail protein	K7P7G7	Enterobacteria_phage	6.8e-39	67.8
AUU85044.1\|2823676_2824432_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	1.0e-124	82.1
AUU85045.1\|2824433_2825141_+	peptidase P60	K7P6F5	Enterobacteria_phage	2.3e-134	90.2
AUU86931.1\|2825173_2825509_+	hypothetical protein	NA	NA	NA	NA
AUU85046.1\|2825649_2826240_+\|tail	phage tail protein	K7PM97	Enterobacterial_phage	4.8e-69	68.7
AUU85047.1\|2826291_2831217_+	hypothetical protein	Q6UAW1	Klebsiella_phage	0.0e+00	61.9
AUU85048.1\|2831281_2832937_+	hypothetical protein	A0A0E3M194	Enterobacteria_phage	2.9e-26	27.5
AUU85049.1\|2832936_2833239_+	hypothetical protein	NA	NA	NA	NA
AUU86932.1\|2833348_2834104_+	hypothetical protein	K7P6M1	Enterobacteria_phage	7.8e-80	59.4
AUU85050.1\|2834184_2834424_+	hypothetical protein	K7P7N3	Enterobacteria_phage	2.8e-28	71.8
AUU85051.1\|2834423_2834741_+	hypothetical protein	K7PGV5	Enterobacterial_phage	1.3e-23	52.9
AUU85052.1\|2835001_2836372_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.5e-109	46.2
AUU85053.1\|2836391_2837021_-	lysogenization regulator HflD	NA	NA	NA	NA
AUU85054.1\|2837048_2838203_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AUU85055.1\|2838199_2838673_-	NUDIX hydrolase	NA	NA	NA	NA
AUU85056.1\|2838665_2839337_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
AUU85057.1\|2839454_2840705_+	isocitrate dehydrogenase (NADP(+))	Q77Z09	Phage_21	4.7e-21	94.4
AUU85058.1\|2840818_2841673_+	hypothetical protein	NA	NA	NA	NA
AUU85059.1\|2841707_2842835_-\|integrase	integrase	O21925	Phage_21	9.7e-127	62.0
AUU85060.1\|2842815_2843061_-	excisionase	NA	NA	NA	NA
AUU85061.1\|2843184_2843466_-	hypothetical protein	K7PHA5	Enterobacterial_phage	5.5e-15	66.7
AUU85062.1\|2843452_2844481_-	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	6.5e-154	82.3
AUU85063.1\|2844477_2844891_-	hypothetical protein	K7PJS4	Enterobacterial_phage	2.9e-52	79.6
AUU85064.1\|2845179_2845692_+	hypothetical protein	K7P861	Enterobacteria_phage	7.5e-10	29.3
AUU85065.1\|2845887_2846535_-	DNA-binding protein	A0A1I9KG86	Aeromonas_phage	1.3e-38	41.8
AUU85066.1\|2846632_2846842_+	cell division protein	NA	NA	NA	NA
AUU85067.1\|2846870_2847422_+	DNA-binding protein	S5FXP0	Shigella_phage	9.1e-62	61.2
AUU85068.1\|2847585_2847798_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.3e-11	61.5
AUU85069.1\|2847754_2848681_+	transcriptional regulator	K7PLZ7	Enterobacterial_phage	1.4e-62	84.8
AUU85070.1\|2848677_2849124_+	hypothetical protein	Q8HA95	Salmonella_phage	5.3e-12	29.6
AUU85071.1\|2849123_2849783_+	DNA methyltransferase	I6PDF5	Cronobacter_phage	1.1e-98	82.5
AUU85072.1\|2849779_2850100_+	LexA family transcriptional regulator	K7PHB4	Enterobacterial_phage	2.1e-34	68.3
AUU85073.1\|2850096_2850486_+	hypothetical protein	K7PKN5	Enterobacterial_phage	1.9e-58	86.1
AUU85074.1\|2850482_2851472_+	hypothetical protein	K7PJS6	Enterobacterial_phage	2.5e-155	76.0
AUU85075.1\|2851486_2851831_+	antitermination protein	A0A0P0ZCW0	Stx2-converting_phage	1.8e-55	85.8
AUU85076.1\|2851820_2853053_-	hypothetical protein	NA	NA	NA	NA
AUU85077.1\|2853042_2854188_-	nucleoid-associated protein	NA	NA	NA	NA
AUU85078.1\|2855090_2855276_+	hypothetical protein	NA	NA	NA	NA
2854652:2854677	attR	NA	NA	NA	NA
AUU85079.1\|2855437_2855761_+	four-helix bundle copper-binding protein	NA	NA	NA	NA
AUU85080.1\|2855800_2856052_-	hypothetical protein	NA	NA	NA	NA
AUU85081.1\|2856282_2856522_+\|lysis	lysis protein	A0A2H4JCI1	uncultured_Caudovirales_phage	2.3e-17	57.9
AUU85082.1\|2856522_2857026_+	lysozyme	A0A2H4JCH1	uncultured_Caudovirales_phage	8.0e-73	75.3
AUU85083.1\|2857015_2857474_+\|lysis	lysis protein	F1C590	Cronobacter_phage	9.0e-47	69.3
AUU85084.1\|2858572_2858800_+	hypothetical protein	NA	NA	NA	NA
AUU86933.1\|2859238_2859412_+	addiction module toxin, GnsA/GnsB family	NA	NA	NA	NA
AUU85085.1\|2859465_2859717_+	hypothetical protein	NA	NA	NA	NA
AUU85086.1\|2859720_2860266_+\|terminase	terminase small subunit	K7P7G0	Enterobacteria_phage	2.4e-91	94.5
AUU85087.1\|2860240_2862163_+\|terminase	terminase	E4WL19	Enterobacteria_phage	0.0e+00	93.0
AUU85088.1\|2862162_2862369_+\|tail	phage tail protein	K7PM10	Enterobacteria_phage	3.5e-27	91.2
AUU85089.1\|2862365_2863958_+\|portal	phage portal protein	E4WL21	Enterobacteria_phage	1.3e-291	92.1
AUU85090.1\|2863938_2865264_+\|capsid	capsid assembly protein	O64320	Escherichia_phage	6.6e-183	81.9
AUU85091.1\|2865273_2865606_+\|head	head decoration protein	E4WL24	Enterobacteria_phage	1.5e-48	85.5
AUU85092.1\|2865673_2866699_+\|capsid	major capsid protein E	K7PGW9	Enterobacteria_phage	5.1e-175	90.6
AUU85093.1\|2866745_2867153_+	DNA-packaging protein	K7P7M3	Enterobacteria_phage	1.6e-34	82.6
AUU85094.1\|2867163_2867517_+\|tail	phage tail protein	K7P6U9	Enterobacteria_phage	2.2e-53	86.3
AUU85095.1\|2867526_2868081_+\|tail	phage tail protein	K7P7A8	Enterobacteria_phage	2.8e-79	96.9
AUU85096.1\|2868077_2868476_+\|tail	phage tail protein	K7P7G5	Enterobacteria_phage	7.0e-64	87.1
AUU85097.1\|2868483_2869221_+\|tail	phage tail protein	O64327	Escherichia_phage	2.0e-117	88.6
AUU85098.1\|2869256_2869670_+\|tail	phage minor tail protein G	K7PM17	Enterobacteria_phage	7.3e-40	65.0
AUU85099.1\|2869678_2869999_+\|tail	phage tail assembly protein T	K7PHE1	Enterobacteria_phage	3.9e-49	90.5
AUU85100.1\|2869976_2872472_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	0.0e+00	78.2
AUU85101.1\|2872474_2872813_+\|tail	phage tail protein	E4WL34	Enterobacteria_phage	6.2e-53	83.0
AUU85102.1\|2872870_2873608_+\|tail	phage minor tail protein L	M9NYX1	Enterobacteria_phage	4.5e-125	84.1
AUU85103.1\|2873610_2874357_+	peptidase P60	M9NZD8	Enterobacteria_phage	2.8e-106	71.6
AUU85104.1\|2874334_2874949_+\|tail	tail assembly protein	K7PH59	Enterobacterial_phage	8.8e-74	69.3
AUU85105.1\|2875002_2879931_+	hypothetical protein	E4WL39	Enterobacteria_phage	7.0e-12	42.9
AUU85106.1\|2879995_2881651_+	hypothetical protein	A0A0E3M194	Enterobacteria_phage	4.1e-25	27.6
AUU85107.1\|2881650_2881953_+	hypothetical protein	NA	NA	NA	NA
AUU85108.1\|2881964_2882963_+	hypothetical protein	O64338	Escherichia_phage	1.5e-43	48.5
AUU85109.1\|2883228_2883477_+	hypothetical protein	NA	NA	NA	NA
AUU85110.1\|2883985_2884225_+	hypothetical protein	K7P7N3	Enterobacteria_phage	1.8e-27	72.2
AUU85111.1\|2884224_2884542_+	hypothetical protein	K7PGV5	Enterobacterial_phage	2.9e-20	51.0

DBSCAN-SWA_4

3147433 : 3196064

Enterobacteria_phage(30.61%)

tail,lysis,integrase,terminase,transposase

attL 3137999:3138015|attR 3192401:3192417

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3137999:3138015	attL	NA	NA	NA	NA
AUU85366.1\|3147433_3149863_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.8e-218	49.6
AUU85367.1\|3150013_3150319_-	hypothetical protein	NA	NA	NA	NA
AUU85368.1\|3150424_3151135_+	YnfC family lipoprotein	NA	NA	NA	NA
AUU85369.1\|3151173_3151503_-	hypothetical protein	NA	NA	NA	NA
AUU85370.1\|3151652_3151979_+	YnfA family protein	A0A218MNG8	uncultured_virus	6.6e-20	52.5
AUU85371.1\|3152088_3153303_+	bifunctional D-altronate/D-mannonate dehydratase	Q6A202	Oenococcus_phage	6.3e-47	29.7
AUU85372.1\|3153314_3154334_+	Zn-dependent oxidoreductase	E3SJ82	Synechococcus_phage	7.9e-19	27.5
AUU85373.1\|3154518_3155802_-\|integrase	site-specific integrase	Q8W658	Enterobacteria_phage	5.6e-155	59.3
AUU85374.1\|3155834_3156086_-	DNA-binding protein	Q859D3	Escherichia_coli_phage	2.1e-13	41.0
AUU85375.1\|3156185_3156425_-	DUF4060 domain-containing protein	M9P0E0	Enterobacteria_phage	1.6e-31	87.0
AUU85376.1\|3156411_3157086_-	hypothetical protein	A0A1B0VDT5	Salmonella_phage	7.8e-39	42.4
AUU85377.1\|3157120_3158236_-	enterohemolysin	K7PKR8	Enterobacteria_phage	3.8e-176	84.9
AUU85378.1\|3158247_3161238_-	exodeoxyribonuclease VIII	K7PJT5	Enterobacteria_phage	0.0e+00	70.9
AUU85379.1\|3161549_3161756_-	cell division inhibitor protein	K7PM31	Enterobacteria_phage	4.9e-29	86.8
AUU85380.1\|3161741_3161951_+	hypothetical protein	NA	NA	NA	NA
AUU85381.1\|3162125_3163022_-	hypothetical protein	A0A0R6PIN1	Moraxella_phage	1.4e-30	33.5
AUU85382.1\|3163258_3163642_-	transcriptional regulator	K7PHG0	Enterobacteria_phage	6.1e-49	79.5
AUU85383.1\|3163739_3163949_+	Rha family transcriptional regulator	K7PKS2	Enterobacteria_phage	3.0e-18	63.2
AUU85384.1\|3163960_3164515_+	hypothetical protein	K7P7P2	Enterobacteria_phage	1.0e-20	41.4
AUU86941.1\|3164699_3165686_+	replication protein	A5VW95	Enterobacteria_phage	4.4e-51	77.2
AUU85385.1\|3165669_3166359_+	phage replication protein	G8C7U6	Escherichia_phage	1.0e-78	61.1
AUU85386.1\|3166371_3166635_+	DNA breaking-rejoining protein	H6WRX9	Salmonella_phage	7.2e-25	66.2
AUU85387.1\|3166627_3167137_+	hypothetical protein	F1C5B6	Cronobacter_phage	1.8e-11	35.1
AUU85388.1\|3167414_3167597_+	hypothetical protein	R9TNE4	Aeromonas_phage	8.2e-12	54.2
AUU85389.1\|3167596_3167854_+	hypothetical protein	NA	NA	NA	NA
AUU85390.1\|3167850_3169692_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.1e-199	55.1
AUU85391.1\|3169760_3170093_-	hypothetical protein	NA	NA	NA	NA
AUU85392.1\|3170091_3171072_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
AUU86942.1\|3171110_3171197_-	ABC transporter	NA	NA	NA	NA
AUU85393.1\|3171926_3172166_+	hypothetical protein	K7PHG9	Enterobacteria_phage	7.2e-16	54.2
AUU85394.1\|3172200_3172800_+	hypothetical protein	A0A0M4QX23	Salmonella_phage	1.2e-94	84.6
AUU85395.1\|3172804_3173005_+	hypothetical protein	S4TNP0	Salmonella_phage	6.1e-16	56.1
AUU85396.1\|3173007_3173298_+	DUF1364 domain-containing protein	K7PGZ6	Enterobacteria_phage	2.8e-46	89.6
AUU85397.1\|3173294_3173657_+	hypothetical protein	K7PM48	Enterobacteria_phage	2.3e-50	79.8
AUU85398.1\|3174456_3174597_+	hypothetical protein	NA	NA	NA	NA
AUU85399.1\|3174593_3175376_+	antitermination protein	K7PKS8	Enterobacteria_phage	1.6e-107	73.6
AUU85400.1\|3176312_3176498_+	hypothetical protein	NA	NA	NA	NA
AUU85401.1\|3176659_3176983_+	four-helix bundle copper-binding protein	NA	NA	NA	NA
AUU85402.1\|3177504_3177729_+\|lysis	lysis protein	M9NZI9	Enterobacteria_phage	4.8e-30	83.8
AUU85403.1\|3177706_3178270_+	lysozyme	M9P0E5	Enterobacteria_phage	2.2e-79	86.6
AUU85404.1\|3178269_3178662_+	DUF2570 domain-containing protein	U5P0U9	Shigella_phage	1.0e-30	59.7
AUU85405.1\|3178933_3179857_+	hypothetical protein	NA	NA	NA	NA
AUU85406.1\|3180003_3180999_+\|terminase	terminase small subunit	I6X6R5	Burkholderia_virus	2.2e-42	42.1
AUU85407.1\|3180976_3182284_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	7.2e-150	59.8
AUU85408.1\|3182285_3183692_+	hypothetical protein	A0A1B0VMH0	Pseudomonas_phage	3.2e-127	52.6
AUU85409.1\|3183675_3184761_+	hypothetical protein	I6PD76	Cronobacter_phage	4.2e-119	57.7
AUU85410.1\|3184841_3185612_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	5.7e-70	60.9
AUU85411.1\|3185624_3186578_+	hypothetical protein	A0A1B0VMF8	Pseudomonas_phage	1.2e-133	74.1
AUU85412.1\|3186896_3187379_+	hypothetical protein	A0A2H4J970	uncultured_Caudovirales_phage	1.3e-11	39.2
AUU85413.1\|3187380_3187731_+	hypothetical protein	I6PD77	Cronobacter_phage	7.8e-35	59.5
AUU85414.1\|3187732_3188341_+	hypothetical protein	G8C7Q1	Escherichia_phage	2.4e-55	57.8
AUU85415.1\|3188312_3188723_+	hypothetical protein	A0A2H4J130	uncultured_Caudovirales_phage	3.3e-16	36.4
AUU85416.1\|3188772_3189450_+\|tail	phage tail protein	I6PBN6	Cronobacter_phage	1.0e-78	68.8
AUU85417.1\|3189501_3189813_+	hypothetical protein	I6PDG2	Cronobacter_phage	1.7e-36	68.9
AUU85418.1\|3189860_3190124_+	hypothetical protein	I6PD79	Cronobacter_phage	4.8e-21	67.1
AUU85419.1\|3190123_3193579_+\|tail	phage tail tape measure protein	K7PMB9	Enterobacterial_phage	8.0e-281	57.5
3192401:3192417	attR	NA	NA	NA	NA
AUU85420.1\|3193612_3193963_+	hypothetical protein	G8C7R0	Escherichia_phage	1.5e-46	79.3
AUU85421.1\|3193959_3194733_+\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	1.9e-134	89.1
AUU85422.1\|3194745_3195477_+	peptidase P60	G8C7R2	Escherichia_phage	6.3e-143	91.8
AUU85423.1\|3195464_3196064_+\|tail	phage tail protein	G8C7R3	Escherichia_phage	1.2e-99	94.0

DBSCAN-SWA_5

3201762 : 3210487

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUU85425.1\|3201762_3203418_+	hypothetical protein	A0A0E3M0V5	Enterobacteria_phage	1.2e-24	30.0
AUU85426.1\|3203417_3203720_+	hypothetical protein	NA	NA	NA	NA
AUU85427.1\|3203729_3204686_+	hypothetical protein	H6WRW6	Salmonella_phage	3.0e-28	43.1
AUU85428.1\|3205806_3206046_+	hypothetical protein	K7P7E2	Enterobacteria_phage	2.0e-26	66.7
AUU85429.1\|3206045_3206378_+	hypothetical protein	I6PCW5	Cronobacter_phage	4.2e-14	45.5
AUU85430.1\|3206569_3206980_+	hemerythrin	NA	NA	NA	NA
AUU85431.1\|3207410_3208706_+	MFS transporter	Q6JIH2	Burkholderia_virus	4.2e-25	26.4
AUU85432.1\|3209026_3210487_+	D-mannonate oxidoreductase	H8ZJP8	Ostreococcus_tauri_virus	2.5e-42	32.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026171

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP026170

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP026169

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP026168

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. CP026167

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection