CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP027022	Streptomyces sp. WAC00288 chromosome, complete genome	10 crisprs	WYL,csa3,DEDDh,DinG,cas3,cas4	1	16	1
CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	8 crisprs	cas3,cas8e,cse2gr11,cas7,cas5,cas6e	2	82	0
CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	2 crisprs	cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e	0	18	0
CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	0 crisprs	DEDDh	1	10	0
CP027026	Streptomyces sp. WAC00288 plasmid p4, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027022_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_6

1889955-1890127

Orphan

Consensus_repeat	Method
CCTCGACGTCGGGATCCTCGGAG	CRISPRCasFinder

2 spacers

DinG

The CRISPR arrays of CP027022_6

>merge|CP027022|6|1889955-1890127|CRISPRCasFinder
CCGCGAAGTCGGCCTCGACAGAGCCGGCCTCGGCGGAATCGGTCCCGGTGAAGCCGGCCTTGGCGGAAGCGGGCTCCTCGACGTCGGGATCCTCGGAGACGGACGCCTCGGAGACGAACCTCCTGCCGTCGGCCCTCTCGGAACCCAACCCCTCGACGTCGGGATCCTCGGAG

>CP027022|6|6|1889955-1890127|CRISPRCasFinder
CCGCGAAGTCGGCCTCGACAGAG	CCGGCCTCGGCGGAATCGGTCCCGGTGAAGCCGGCCTTGGCGGAAGCGGGCT
CCTCGACGTCGGGATCCTCGGAG	ACGGACGCCTCGGAGACGAACCTCCTGCCGTCGGCCCTCTCGGAACCCAACC
CCTCGACGTCGGGATCCTCGGAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH95089.1\|1882199_1882988_+\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
CP027022.1\|AVH95090.1\|1883103_1885077_-\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
CP027022.1\|AVH95091.1\|1887093_1887990_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379237
CP027022.1\|AVH95097.1\|1900679_1901597_-\|diaminopimelate-epimerase	unknown	unknown	gnl\|CDD\|234768
CP027022.1\|AVH95098.1\|1901682_1902219_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH99516.1\|1885114_1886947_-\|IucA/IucC-family-siderophore-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226715
CP027022.1\|AVH95085.1\|1876530_1877136_-\|DUF4937-domain-containing-protein	unknown	unknown	gnl\|CDD\|374476
CP027022.1\|AVH95100.1\|1903613_1903943_+\|antitoxin	unknown	unknown	gnl\|CDD\|379416
CP027022.1\|AVH95083.1\|1874883_1875792_-\|ADP-ribosylglycohydrolase-family-protein	unknown	unknown	gnl\|CDD\|377122
CP027022.1\|AVH95092.1\|1890337_1891720_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235892
CP027022.1\|AVH99517.1\|1896492_1897965_-\|zinc-metalloprotease	unknown	unknown	gnl\|CDD\|341066
CP027022.1\|AVH95094.1\|1893576_1894749_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226119
CP027022.1\|AVH95099.1\|1902327_1903266_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP027022.1\|AVH95086.1\|1877509_1878040_+\|TerD-family-protein	unknown	unknown	gnl\|CDD\|132992
CP027022.1\|AVH95088.1\|1881176_1881686_-\|transcriptional-repressor-NrdR	unknown	unknown	gnl\|CDD\|234774
CP027022.1\|AVH95095.1\|1894843_1896337_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|225171
CP027022.1\|AVH95096.1\|1898169_1900542_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
CP027022.1\|AVH95093.1\|1892262_1893438_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226119
CP027022.1\|AVH95087.1\|1878100_1880998_-\|vitamin-B12-dependent-ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|235828
CP027022.1\|AVH95084.1\|1875804_1876464_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH95089.1\|1882199_1882988_+\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.36665e-114
CP027022.1\|AVH95090.1\|1883103_1885077_-\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	1.20534e-143
CP027022.1\|AVH95091.1\|1887093_1887990_-\|N-acetyltransferase	gnl\|CDD\|379237	pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.32851e-58
CP027022.1\|AVH95097.1\|1900679_1901597_-\|diaminopimelate-epimerase	gnl\|CDD\|234768	PRK00450, dapF, diaminopimelate epimerase; Provisional.	3.59788e-102
CP027022.1\|AVH99516.1\|1885114_1886947_-\|IucA/IucC-family-siderophore-biosynthesis-protein	gnl\|CDD\|226715	COG4264, RhbC, Siderophore synthetase component [Secondary metabolites biosynthesis, transport, and catabolism].	3.17274e-165
CP027022.1\|AVH95085.1\|1876530_1877136_-\|DUF4937-domain-containing-protein	gnl\|CDD\|374476	pfam16291, DUF4937, Domain of unknown function (DUF4937. This family consists of uncharacterized proteins around 120 residues in length and is mainly found in various Bacillus species, such as Bacillus subtilis and Bacillus amyloliquefaciens. Several members are annotated as ydbC, but the specific function of this family is unknown.	1.90107e-41
CP027022.1\|AVH95100.1\|1903613_1903943_+\|antitoxin	gnl\|CDD\|379416	pfam14013, MT0933_antitox, MT0933-like antitoxin protein. This family of proteins contains the MT0933 protein, which has been identified as an antitoxin to /protein MT0934. This family of proteins is found in bacteria. Proteins in this family are typically between 61 and 90 amino acids in length.	3.16188e-13
CP027022.1\|AVH95083.1\|1874883_1875792_-\|ADP-ribosylglycohydrolase-family-protein	gnl\|CDD\|377122	pfam03747, ADP_ribosyl_GH, ADP-ribosylglycohydrolase. This family includes enzymes that ADP-ribosylations, for example ADP-ribosylarginine hydrolase EC:3.2.2.19 cleaves ADP-ribose-L-arginine. The family also includes dinitrogenase reductase activating glycohydrolase. Most surprisingly the family also includes jellyfish crystallins, these proteins appear to have lost the presumed active site residues.	9.49349e-46
CP027022.1\|AVH95092.1\|1890337_1891720_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235892	PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional.	0
CP027022.1\|AVH99517.1\|1896492_1897965_-\|zinc-metalloprotease	gnl\|CDD\|341066	cd09603, M1_APN_like, Peptidase M1 family similar to aminopeptidase N catalytic domain. This family contains mostly bacterial and some archaeal M1 peptidases with smilarity to the catalytic domain of aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease belonging to the M1 gluzincin family. APN preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and, in higher eukaryotes, is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation, thus considered a marker of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. APNs are also present in many pathogenic bacteria and represent potential drug targets. Some APNs have been used commercially, such as one from Lactococcus lactis used in the food industry. APN also serves as a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs have also been extensively studied as putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	4.3002e-144
CP027022.1\|AVH95094.1\|1893576_1894749_+\|hypothetical-protein	gnl\|CDD\|226119	COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism].	0.00498493
CP027022.1\|AVH95099.1\|1902327_1903266_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	8.0838e-146
CP027022.1\|AVH95086.1\|1877509_1878040_+\|TerD-family-protein	gnl\|CDD\|132992	cd06974, TerD_like, Uncharacterized proteins involved in stress response, similar to tellurium resistance terD. Tellurium resistance terD like proteins. This family is composed of uncharacterized proteins involved in stress response, such as the tellurium resistance proteins, chemical-damaging agent resistance proteins, and general stress proteins from a variety of organisms. The tellurium resistance proteins are homologous terA,-D,-E,-F,-Z,-X gene products, which confer tellurium resistance mediated by plasmids. Currently, the biochemical mechanism of tellurium resistance remains unknown. The family also contains several ter gene homologues, YceC, YceD, YceE, for which there is no clear evidence for any involvement in the tellurium resistance. A putative cAMP-binding protin CABP1 shows a significant similarity to the terD protein and is also included in this family.	1.71102e-27
CP027022.1\|AVH95088.1\|1881176_1881686_-\|transcriptional-repressor-NrdR	gnl\|CDD\|234774	PRK00464, nrdR, transcriptional repressor NrdR.	7.78732e-81
CP027022.1\|AVH95095.1\|1894843_1896337_-\|GTPase-HflX	gnl\|CDD\|225171	COG2262, HflX, GTPases [General function prediction only].	1.59344e-170
CP027022.1\|AVH95096.1\|1898169_1900542_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	3.39082e-154
CP027022.1\|AVH95093.1\|1892262_1893438_+\|hypothetical-protein	gnl\|CDD\|226119	COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism].	0.000104998
CP027022.1\|AVH95087.1\|1878100_1880998_-\|vitamin-B12-dependent-ribonucleotide-reductase	gnl\|CDD\|235828	PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase; Validated.	0
CP027022.1\|AVH95084.1\|1875804_1876464_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	4.19297e-36

>CP027022.1|AVH95091.1|1887093_1887990_-|N-acetyltransferase
MSPTRPPADPPGDDTLDLRVDDLVALLTRGAPPQPPAPDTPAPIPDTPAPDNLAVTPANSATTPGGPATGTFLPGTPATAAGNTSAPVPGTPTGALFRGGHPHRELLDGDLLDSVASWSPAATPVGSFRLVPVRLERDLPLLTRWMNDPAVAAFWELAGPETVTADHLRAQLEGDGRSVPCLGLLDGTPMSYFEIYRADLDPLARHYPARPHDTGLHLLIGGTADRGRGVGTTLLRAVADLVLDHRPRCTRVLAEPDLRNTPSVSAFLGGGFRYAAEVDLPDKRAALMIRDRTLRHVL
>CP027022.1|AVH99516.1|1885114_1886947_-|IucA/IucC-family-siderophore-biosynthesis-protein
MTSAPTPPAPGPELLSPPELNAAAWTRASSRLLAKLLAEFAYEEVIEPLPVEHLPAEALPAEPRDGESGRYTLRLDDGTALTFRARRGAYGNWRVAADSITHEGRPLTDPFDLLVRARGLLRLDGATLGHLIRELSATLAADTRLDHTALTAHELAELSYAELEGHQTGHPWLVLNKGRIGFSASDTARWAPEARRPTRLPWIAVSNRLAAYRGVPSLKTPDLLYSGELDPEVRASFRAVLTARGHTPDDYLLLPVHPWQWDEVLLLLYAPAVAAGDIVPLPADGDLRLPQQSVRTFLNTSRPDRHTVKLPLSVLNTLVWRGLPTERTLAAPAVTAWVHGLRDADPFLRDECRVILLGEVASVTVEHPLYDRLPEVPYQYKELLGAIWREPLRLPPGERARTLAALLHTDPAGRAFVAELVERSGLAPAVWLQHLFTALLPPLLHFLYRYGTVFSPHGENAIVVYDTDDVPVRLAIKDFVDDVNISAHPLPEHATLPDDVRDVLLTEEPDFLTQFIHSGLFVGVFRYLAPLCEEQLGVPERDFWSLVRAEILRHQARFPELKERFELFDLLTPRIERLCLNRNRLHLDGYRDRSERPHAAVHGTVPNPLA
>CP027022.1|AVH95090.1|1883103_1885077_-|ATP-dependent-DNA-helicase
MTKPSLPDLLHAAVSAVGGTERPGQVAMAEAVAEAIDDNSHLLVQAGTGTGKSLGYLVPALAQGERVVVATATLALQRQLVERDLPRTVDALHPQLRRRPQFAMLKGRSNYLCLHRLHEGVPQDEEEGLFDPFEAAAPTSKLGQDLMRLRDWSDETETGDRDDLTPGVSDRAWAQVSVSSRECLGASKCAYGAECFAEAARERAKLADVVVTNHALLAIDAIEGAPVLPEHEVLIVDEAHELVSRVTGVATGELTPGQVNRAVRRSAKLVDEKVADQLQTAAEGFERVMELALPGRLEEIPEDLAYALMALRDAARAVITALGSTRDRSVQDEDAVRKQAMASVETVHGVAERITQGSEYDVVWYERHDRFGASLRVAPLTVSGLLREKLFTERSVVLASATLKLGGDFNGVGASLGLAPEGTTGDDLPVWKGIDVGSPFDYPRQGILYVAKHLSRPARDGDRGDMLDELTELMQAAGGRTLGLFSSMRAAQQAAEELRTRVPELPILLQGEDTLGELIKNFAADPKTCLFGTLSLWQGVDVPGPSCQLVVMDKIPFPRPDDPLMSARQKAVEEAGGNGFMAVAATHAALLMAQGAGRLVRATGDRGVVAVLDPRLATARYGSYLKASLPDFWYTTDRNQVRKSLAAIDAASKAANA
>CP027022.1|AVH95089.1|1882199_1882988_+|transcriptional-repressor-LexA
MTTTADSATITAQDRSLGRLEAVHAMSDVNVNGEEPGRPARALPGRPPGIRADSSGLTDRQRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLRRDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLPRQLVGDGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLDGEATVKRFKREDGHVWLLPHNAAYQPIPGDEATILGKVVAVLRRV
>CP027022.1|AVH95088.1|1881176_1881686_-|transcriptional-repressor-NrdR
MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTAETCSLMVVKRSGVTEPFSRTKVISGVRKACQGRPVTEDALAKLGQRVEEAVRATGSAELTTHDVGLAILGPLRELDLVAYLRFASVYKAFDSLEDFEAAIAELRVRPPVENPGSGATPGVPVPATAAD
>CP027022.1|AVH95087.1|1878100_1880998_-|vitamin-B12-dependent-ribonucleotide-reductase
MTETASGPARGSRTKGAKSASKGLRIERIHTTPGVHPYDEVTWERRDVVMTNWRDGSVNFEQRGVEFPDFWSVNAVNIVTSKYFRGAVGTPQRETGLKQLIDRIVKTYTKAGEEYDYFASPADAEIFEHELAYALLHQIFSFNSPVWFNVGTPQPQQVSACFILSVDDSMESILDWYKEEGMIFKGGSGAGLNLSRIRSSKELLSSGGNASGPVSFMRGADASAGTIKSGGATRRAAKMVILDVDHPDIEDFIETKVKEEEKIRALRDAGFDMDLGGDDITSVQYQNANNSVRVNDAFMKAVETGGKFGLRARMTGEVIEEVDAKALFRKMAEAAWACADPGIQYDDTINRWHTCPESGRINGSNPCSEYMHLDNTSCNLASLNLMKFLKDDGKGNQSFDVERFAKVVELVITAMDISICFADFPTQKIGENTRAFRQLGIGYANLGALLMATGHAYDSDGGRALAGAITSLMTGTSYKRSAELAAVVGPYDGYARNAEPHQRVMKQHADANTAAVRMDDLDSPIWAAATEAWQDVIRLGAKNGFRNAQASVIAPTGTIGLAMSCDTTGLEPDLALVKFKKLVGGGSMQIVNGTVPQALRRLGYQEEQIEAIVAHIAEHGNVIDAPSLKTEHYEVFDCAMGERSISAMGHVRMMAAIQPWISGALSKTVNLPETATVEDVEEVYFEAWKMGVKALAIYRDNCKVGQPLSAKKKEDEKAEVTAKSEATIREAVEKVVEYRPVRKRLPKGRPGITTSFTVGGAEGYMTANSYPDDGLGEVFLKMSKQGSTLAGMMDAFSIAVSVGLQYGVPLETYVSKFTNMRFEPAGMTDDPDVRMAQSIVDYIFRRLALDFLPFETRSALGIHSAEERQRHLDTGSYEQSEDEEVDVEGLAQSAPRTPELKAVATAPAPKAEVPAPKQAHTSAELVEMQLGISADAPLCFSCGTKMQRAGSCYICEGCGSTSGCS
>CP027022.1|AVH95086.1|1877509_1878040_+|TerD-family-protein
MSGLNKGVGRVEVTLKWDPAPAGSPAHDLDLVAGVFTADDPHGAPVQLVHFGSRSPDGTITLHRDSRTGQGFGYDEAMTVELDRLAPRYARVVVGVAIQQSGGRLSFGDIAGTGVRVREGYTDLLTHDFADVPDALAATVVEFTRTGPDSWSYRPIPRGFDADPQTFGTLLGSEAS
>CP027022.1|AVH95085.1|1876530_1877136_-|DUF4937-domain-containing-protein
MLVKWIRCTVVDRRGFERGQRKWAGLLGEPGFRGQGGGWSRSRPDVAHVFAFWESRAFYDSFMARSHDRLAASQVGTFRDGQVKLFDHRFDVKTGFEPRFADADVARVAHCRVHEDRAEHFALMQEKVWNPAMAGSPGMLRGMFGEAPGSEFLVLSMWQSTAEHGKYREERVERLGLRARTAADVAALNGDVVRLEPSWTV
>CP027022.1|AVH95084.1|1875804_1876464_-|histidine-phosphatase-family-protein
MARPRRIVLVRHGESEGNADDTVYEREPDHALRLTETGWRQAEATGERLRELFGEEAVSVYVSPYRRTHETLRAFRFPPEQVRVREEPRLREQDWGNWQDREDVRLQKAYRDAYGHFFYRFAQGESGADVYDRVGAFLESLYRSFEAPDHPPNVLIVTHGLTMRLFCMRWFHWTVADFESLSNPGNAETRVLLLDEDGRYRLDRPFERWRTPEPYGSTG
>CP027022.1|AVH95083.1|1874883_1875792_-|ADP-ribosylglycohydrolase-family-protein
MTADSSPDRRFDRALASLRGLSVGDALGSQFFVPVHYPLLKRRELPPGPWQWTDDTEMACSVLAVLARHDRIDQDALALSFAHHHDFDRGYGPAVNRMLRLIREGGDWRELAAALFKGQGSWGNGAAMRIAPLGAWYADDPEQATHQAEISAYTTHQHREAVVGAMAVAAAAALAADPAGPPTPEALLDGVIALVPRSAVGAGLRRARDMLDYGDPGTVAAVLGSGRRTSAHDTVPFALWSAARALGDFERMFWTTAQVGGDVDTTCAIAGGVVAATAVGAPPAEWLGQTEELPEWVPTTAS
>CP027022.1|AVH95092.1|1890337_1891720_-|aspartate-aminotransferase-family-protein
MRGTGYESILRRQSLRESAARTYARSLPIVPVRARGLTIEGADGRRYLDCLSGAGTLALGHNHPVVLEAIKKVLDSGAPLHVLDLATPVKDAFTSELFATLPGELADDARVQFCGPAGTDAVEAALKLVRTATGRDGLLAFTGAYHGMTAGALAASGGAPDVRVTRLPYPHAYRCPFGTGGERGAELSARWTESLLDDPKSGVTTPAGMIVEAVQGEGGVIPAPDDWMRRMRRITADRAIPLVVDEVQTGVGRTGAFWAVEHSGVVPDVMVLSKAIGGSLPLAVVVYRSSLDAWEPGAHAGTFRGNQLAMAAGTATLAYVRENRLAERAGTLGARILGQLQGLAAAHPCVGDVRGRGLMIGIELVDPDAAGPEDTAPPAAPALALAVQQECLARGLIVELGGRHSAVVRLLPPLTLTDEQATAVLDRFADALAAAERARVPRPSPSRRAPAPVPAPGPSH
>CP027022.1|AVH95093.1|1892262_1893438_+|hypothetical-protein
MRSIRPLLTAASAVAALTLTVTSCGPSEENAGDKPSAPASLDPAEKLKIPEDLKDRLKEHGIDLDKWRNGEWKNWDRDKWLREAKDFVNPIIEGLWDPDRMREAERPDEPVEEEDISGDKGVTDPTPDPVRAKAVDAKYHDNAPESGKVFFDGPEGSMVCSATVVKDPAHPGKSNMVWTAGHCVHKGKKGGWYRNIAFVPSYNDSALATSDLEKAAREQIAPYGVWWAEWVKTSDQWIAEGASTGGAGAPYDFAVIKVTPEKGSSGKSLEETVGSALPVEFNAPAVPKIASLTATGYPAAAPYDGQKMFQCQDKPGRLSLKANQPTMYRIGCTMTGGSSGGGWVGKGSDGKPALVSNTSIGPASAGWLAGPRLGPEAKGIFDEVSKKYAGQ
>CP027022.1|AVH95094.1|1893576_1894749_+|hypothetical-protein
MRSVRLIPTALGLATALALTATACGPTETPAADKPAGGASSSAPAADAGDGGADLTKDLADKLKKRGVDLEGWKNGEWKNWDRETWLREAEDFVNPVIEGLWDPARMQSAKSPEQTITTQAGASGTDPVPRPVQAQREKTPYHRNAAPVGKIFFDSPQGHMVCSGTIVKDPRRPGKSNLVWTAGHCVHAGKKGGWYRNITFVPSYNDLGKSPAALRNAKPHEVYPYGQYWADWAVTSGEWIKSGGTNQAWPYDYAVLHVKPQRGTKSLEETVGAALPVDFSAPAPARAGTIGAWGYPQAAPYNGVIMHKCLDRATRFTTAPATPVMYRIGCTMTAGSSGGGWFRVLPNGKTALVSNTSIGPAGRNGWLAGPQLGSGAKAAHEMVSKKFAR
>CP027022.1|AVH95095.1|1894843_1896337_-|GTPase-HflX
MTSSSSPSQDNQSFAETSRTESLRADALMEEDVAWSHEIDGERDGDQFDRSERAALRRVAGLSTELEDVTEVEYRQLRLERVVLVGVWTSGTVQDAENSLAELAALAETAGALVLDGVIQRRDKPDPATFIGSGKARELRDIVVETGADTVVCDGELSPGQLIALEDVVKVKVVDRTALILDIFAQHAKSREGKAQVALAQMQYMLPRLRGWGQSLSRQMGGGGGGGMATRGPGETKIETDRRRIREKMAKMRREIAEMKTGRDIKRQERRRNNVPSVAIAGYTNAGKSSLLNRLTGAGVLVENALFATLDPTVRRAETPTGRVYTLADTVGFVRHLPHHLVEAFRSTMEEVGDSDLILHVVDGSHPAPEEQLAAVREVFRDVGAVNVPEIVVINKADAADPLVLQRLLRMEKHSIAVSARSGQGIEELLALIDAELPRPKVEIEALVPYTQGGLVSRVHAEGELESEEHTPEGTLLKARVHEELAALLAPFVPAAH
>CP027022.1|AVH99517.1|1896492_1897965_-|zinc-metalloprotease
MPPRARWLRSAGLIASSAGLVAAALPAPAPLGIGDPLFPHLGNPGYDVLAYTLDVAYPGVNTKPLSAVTRIDALVTDDLERINLDFTHGEVSAVTVDGRPAAYASSGEDLVITPAAPVEAGEPVRITVTHTSDPSGPADTGGWVRTGDGLAMANQADAAHRVFPSNDHPADKAYFTFRITVPDGLTAVANGLPAGRVRHGSTTTWTYRTRHPMATELAQISIGRSTVVHRAGPHGLPLRDVVPTADRELLEPWLRRTPAHMEWMERQVGPYPFETYGVLVADATTGFELETQTLSLFERRLFADRALPEWYVDSIMVHELAHQWFGNSVSPRSWSDLWLNEGHASWYEALYADETAGRSLERRMRAAYAASDGWRAAGGPPAAPEPPSPDHKISLFRPVVYDGSSLVLYALRQEIGADAFQRLERAWVARYRNGNAATADFVALAGRTAGRDLTGFFRGWLYGEKTPPMPGHPDWRSNPPRDAGSAPERG
>CP027022.1|AVH95096.1|1898169_1900542_-|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MSAEAANPVSAAEDAAADTTVRRRGRARIDLRRLGRAALLGATAGPAPRDRLPDAIGHVAEAHRAHHPEADLTVLRRAYVLAESSHRGQFRKSGEPYITHPLAVTLILAELGAETTTLTASLLHDTVEDTDVTLDQVRREFGAEVAYLVDGVTKVEKIDYGAAAEPETFRKMLVATGNDVRVMSIKLADRLHNMRTLGVMRPEKQARIARVTRDVLIPLAERLGVQALKTELEDLVFAILHPEEYETTRALIAGNPHAPDALGAVAEQVEAVLREAGIGAEVLVRPRHFVSVHRVRLKRGELRGCDFGRLLVLVAEDADCYGVLGELHTCFTPVISEFKDFIAAPKFNLYQSLHTAVAAPDGAVAEVLIRTHRMHKVAEAGVVALGNPHVGQEPAEQPEGAAPAASPVSSASLVSEDGERVDPTRPGWLSRLLDWQQSAPDPDTFWTSLRADLAEDDEITVFRADGSAPGTISLPAGASCIDAAYAQHGEAAHACLGARVNGRLAPLSTVLGDGDTVQLLLAQDPVSGPSPEWLDHARTPAARIAITGWLRDHPEDAEPTDPGPDPRPTASRSTGPRATDPRSGSRSNGLRPDARATDARPDAQADARPRSRPEPRPEPRPAADRRPGAGPHAEFHADLDGEQPAAVRPAGCCTPVPPDEITGFRVRGGSVTVHRSGCASADAMRRIGRAPVAVRWGDTAQGRVTLVAESFGRPGLLADLTEAIATAGAEVVSATVEPPSEQRVRHTYTLHLPDAAGLPALMRAMRDVPGVYDVSRARHRASPRPRPRRS
>CP027022.1|AVH95097.1|1900679_1901597_-|diaminopimelate-epimerase
MTSTQTSPLRFLKGHGTENDFVIVPDAENALDLPPAVVARLCDRRAGIGGDGLLHVVRSAAHPEARHLADEAEWFMDYRNADGSVAEMCGNGVRVFARYLEHAGHVTAGEVAVATRGGVKHVHLDKDGTVTVAMGRAALPEAAATITVDGRSWPARNVNMGNPHAVAFVEDLDHAGNLLTEPAYAPASVYPDGVNIEFVVDRGPRHVAMRVHERGAAETRSCGTGACAVAVATARRDGADPAESGTPVTYTVDVLGGTLVITEHPDGRIDMTGPAVIVAEGTVDPVWLAAGPGNAAVTGIETVDD
>CP027022.1|AVH95098.1|1901682_1902219_-|hypothetical-protein
MEAGPRDREQHEAVLGDPTAAPSGDLPGDPPDEPPLRPADDAPAVAPGLTPDGPDDAVGTAVVVDADEVEVELRPQRRLRIWQLAPIVGLAAVGSLMFAFPLAFGSGDGGAVVAMLGLLISSCAAGWGVMAARKVGHTWPGLPARGSGERPDWRVLALYVATIGALVALAVWRVARLR
>CP027022.1|AVH95099.1|1902327_1903266_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MRSAAPAPRVIAVVGPTAAGKSDLGVFLAQQLGGEVVNADSMQLYRGMDIGTAKLTPEERGGVPHHLLDVWDVTEAASVAEYQRLARAEIDRLLAAGRTPVLVGGSGLYVRGAVDALEFPGTDPAVRARLEAELEERGPGVLHARLAGADPEAARAILPGNGRRIVRALEVIEITGKPFTANLPGPDSVYDTVQIGVDVARPELDERITTRVDRMWEAGLVDEVRALEARGLREGRTAARALGYQQVLTALAGECTEDEARAETVRATKRFARRQDSWFRRDPRVHWLSGAAEHRRELPREALSLVERAVTA
>CP027022.1|AVH95100.1|1903613_1903943_+|antitoxin
MGLMDSLKAKLGPAKEKVADLAQQHGEKIDQGLDKAARVVDEKTKGKYSDKIHSGTDKAKGAIDRMGHKDGGAPGADGTPGAGGTPGTGGTPGTGTGTGGGGVTPPPAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_8

2555149-2555249

Orphan

Consensus_repeat	Method
TACAGCCGGGGCCTCGGGCTTCACGGCCGGAGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_8

>merge|CP027022|8|2555149-2555249|CRISPRCasFinder
TACAGCCGGGGCCTCGGGCTTCACGGCCGGAGGCGCGGGCTTCACGGCCGGAGCCTCCAGCCTGTGTACAGCCGGAGCCTCGGGCTTCACGGCCGGAGGCG

>CP027022|8|8|2555149-2555249|CRISPRCasFinder
TACAGCCGGGGCCTCGGGCTTCACGGCCGGAGGCG	CGGGCTTCACGGCCGGAGCCTCCAGCCTGTG
TACAGCCGGAGCCTCGGGCTTCACGGCCGGAGGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH95602.1\|2557457_2559131_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
CP027022.1\|AVH95603.1\|2559154_2560144_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP027022.1\|AVH95608.1\|2566169_2566829_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP027022.1\|AVH95593.1\|2545612_2546065_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379161
CP027022.1\|AVH99570.1\|2554089_2555088_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH95601.1\|2555521_2557267_-\|transferase	unknown	unknown	gnl\|CDD\|340841
CP027022.1\|AVH95607.1\|2565734_2565950_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH95600.1\|2552978_2553950_-\|reductase	unknown	unknown	gnl\|CDD\|366597
CP027022.1\|AVH99571.1\|2560140_2561052_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
CP027022.1\|AVH95596.1\|2549123_2550317_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP027022.1\|AVH95598.1\|2551002_2552181_-\|adenylyltransferase/sulfurtransferase-MoeZ	unknown	unknown	gnl\|CDD\|181156
CP027022.1\|AVH99569.1\|2547189_2548809_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
CP027022.1\|AVH95599.1\|2552244_2552991_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|371915
CP027022.1\|AVH95597.1\|2550403_2550862_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP027022.1\|AVH95609.1\|2566974_2567202_+\|DUF3107-domain-containing-protein	unknown	unknown	gnl\|CDD\|378634
CP027022.1\|AVH95594.1\|2546222_2546648_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH95604.1\|2561114_2562845_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173871
CP027022.1\|AVH95605.1\|2563268_2564624_-\|DUF3152-domain-containing-protein	unknown	unknown	gnl\|CDD\|371483
CP027022.1\|AVH95595.1\|2546843_2547029_+\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|283241
CP027022.1\|AVH95606.1\|2564632_2565595_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH95603.1\|2559154_2560144_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.39126e-102
CP027022.1\|AVH95608.1\|2566169_2566829_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.38293e-16
CP027022.1\|AVH95593.1\|2545612_2546065_+\|hypothetical-protein	gnl\|CDD\|379161	pfam13396, PLDc_N, Phospholipase_D-nuclease N-terminal. This family is often found at the very N-terminus of proteins from the phospholipase_D-nuclease family, PLDc, pfam00614. However, a large number of members are full-length within this family.	0.000212107
CP027022.1\|AVH95602.1\|2557457_2559131_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
CP027022.1\|AVH95601.1\|2555521_2557267_-\|transferase	gnl\|CDD\|340841	cd03813, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.	7.76232e-135
CP027022.1\|AVH95600.1\|2552978_2553950_-\|reductase	gnl\|CDD\|366597	pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.	1.02229e-40
CP027022.1\|AVH99571.1\|2560140_2561052_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	5.19914e-75
CP027022.1\|AVH95596.1\|2549123_2550317_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.22963e-52
CP027022.1\|AVH95598.1\|2551002_2552181_-\|adenylyltransferase/sulfurtransferase-MoeZ	gnl\|CDD\|181156	PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated.	0
CP027022.1\|AVH99569.1\|2547189_2548809_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.5942e-48
CP027022.1\|AVH95599.1\|2552244_2552991_-\|phage-tail-protein	gnl\|CDD\|371915	pfam12138, Spherulin4, Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.	3.3666e-23
CP027022.1\|AVH95609.1\|2566974_2567202_+\|DUF3107-domain-containing-protein	gnl\|CDD\|378634	pfam11305, DUF3107, Protein of unknown function (DUF3107). Some members in this family of proteins are annotated as ATP-binding proteins however this cannot be confirmed. Currently no function is known.	2.0186e-36
CP027022.1\|AVH95597.1\|2550403_2550862_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	5.18759e-33
CP027022.1\|AVH95604.1\|2561114_2562845_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173871	cd08506, PBP2_clavulanate_OppA2, The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	5.39416e-172
CP027022.1\|AVH95605.1\|2563268_2564624_-\|DUF3152-domain-containing-protein	gnl\|CDD\|371483	pfam11350, DUF3152, Protein of unknown function (DUF3152). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function.	1.98405e-58
CP027022.1\|AVH95595.1\|2546843_2547029_+\|CsbD-family-protein	gnl\|CDD\|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	7.15306e-06
CP027022.1\|AVH95606.1\|2564632_2565595_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.76031e-27

>CP027022.1|AVH99570.1|2554089_2555088_-|hypothetical-protein
MHRHRELCERAVDPLEVAAGLEAQGFTDRTAARYRHRDVFSLAEELYARVPRRPEEVRVAEDRPEPVAPWALAVLAPGAVAALAWLGLALTHGPVRAAVGAAGALALGGALFLAVRHGPLRAPGGRTVPAARLWALWLLAYAVGGDGLLAEVLTGGPDDLWELTPGPLLGLALAVAPAAWCAHLFARRARRRIADSRGLADFAAAVRPLLLGTVTLQLLALAALLLPTGAGPGALALGALLLLARLLTVHGHPETASAALAAACAAEVLALASVLSSRLPVPGFDALAVPVRAVTDAWGPGAVPTLVCGAAALGLLAHATGSLARASAHTTP
>CP027022.1|AVH95600.1|2552978_2553950_-|reductase
MRVLLLGANGFIGRFVADRLLADPAVHLTALGRGDDADVRFDLASGSPGALTRFLDAVHPGVVVNCAGATRGGARDLTRHNTVAVATVCEALRRSGCGARLVQVGCASEYGPSQPGSSTAEDAVPRPGGPYGVSKLAATELVLGSGLDAVVLRVFSPVGPGTPAGSPLGRLAEAMRRAMQAGDGELKLSGLGVQRDFVDVRDVARAVHAASLSAAQGVVNIGTGRAVRLRDAAAVLARVAGYAGNLNELDAPHGIPQRPMIGAPRTEGTIADQLASAPYPYPDGCGPWQQADVRTARDRLGWRPRINLEESLADIWMEAACRI
>CP027022.1|AVH95599.1|2552244_2552991_-|phage-tail-protein
MSHLTGTTATGAVQALGVGVPGYAHPLLAPVEWAELTRPGTPLHWAVLNVADGPGSRPDPHCLEAAGKLRAAGVRVLGHLDAAHGSRPFGELVTDAHRFLDWYKVDGYYLDRCPADRADLAGVRRVCATLETVLGGEAHLVLGHGTHPHPGYAETADQLVTFSGAWSDYRWSQVAEWTAEYAETKFVHLVHGVPRTHLDEALRIARWQGAGTIFFTDRPGRPGQTDPFHSLPGYWDEIVSRIGPGVSE
>CP027022.1|AVH95598.1|2551002_2552181_-|adenylyltransferase/sulfurtransferase-MoeZ
MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLCVGAGGLGSPALMYLAAAGVGTLGIVEFDEVDESNLQRQIIHSQADIGRSKAASARDSVLGINPYVNVILHEERLEADNVLEIFGQYDLIVDGTDNFATRYLVNDACVLLNKPYVWGSIYRFDGQASVFWSEYGPCYRCLYPEPPPPGMVPSCAEGGVLGVLCASIGSIQVTEAIKVLAGVGDPLVGRLMIYDALEMQYRQVKVRKDPNCAVCGENPTVTELIDYEAFCGVVSEEAQEAAAGATITPKQLKEWIDDGESIDIIDVREQNEYEIVSIPGARLIPKNEFLMGTALQDLPQDKRIVLHCKTGVRSAEVLAVLKSAGFADAVHVGGGVIGWVHQIEPEKPVY
>CP027022.1|AVH95597.1|2550403_2550862_+|transcriptional-regulator
MSRATTRTPDAGWTDPECPVARTLDLVGDRWSLLVVRDAMDGARSFTEFQRRTGIARNILTDRLRKLIAHGLLARRTAPSGRRQEYVLTEAGRDLFPVVLTLRQWGERHAFAPGEARSTLVDRHGDPVPEVAPTGADGTSLDADTTHVRKAG
>CP027022.1|AVH95596.1|2549123_2550317_-|MFS-transporter
MDAWRRSLLAAVCAVAVASVYAAQPVLESMGRDLGVPAGLAGWIVAAGQFGYLAGLLLLVPLGDVVDRRRLVAAHLAVTAAGTALTASAPAAWVAFAGLATAGVVAVVVQTAVAYTASVSPPAERGRNIGVVTSGVVVGILGARVVTGTLAEVWGWRSVYAVLAVLSLVLAALVLAALPPEERPGPPAGYRQVVVSLGGLFGQRAFLTRGLVAFFLFASFGTLWSGLALPLADAPWRLSESGIGLFGIAGLAGALGAARAGRWADAGRAGPVTGLALALLILSWAAIAQLPWSLWLLVAGIVVLDFAVQAVHVSNQHLLTAAHPDRLSSVIGGYMVFYSLGSALGAAATTALFSAYGWAGSSLLGAGFAACALLVRATGERLPVTTRTSVPAVDRGR
>CP027022.1|AVH99569.1|2547189_2548809_+|MFS-transporter
MASRTGTGEGTEKKSIVLLTLAAGQFLMALDSSVMNVSIATVAEDVGTTVAGIQGAITAYTLVMAMFMIPGGKTGALIGRKRAFMIGCVVYGCGSLTTALAPNLLVLLIGWAFLEGVGAALILPAIVALVAGNFSEKRRPAAYGMVAAAGAIAIAVGPLVGGVATTYFSWRWVFAGEVLVVLGILLLARPIVDAVSEERPRIDLIGTLLSALGLGSFVYGVLRSDEWGWFRPKPDAPVLFGISSTVWLMLLGIALTWLFLRWEARLVKQHKEPLLNPAMLQNKQLSGGLTMFFFQYLVQMGVFFVVPLYLSVALGLSALATGARLLPLSVALLAAAVLIPRLLPDVSPRRVVRLGVLALLVGAVILMAALDVSAGAEIITIPMLLIGLGMGALASQLGSITVSALPEEQSTEVGGVQNAVTNLGASIGTALAGSILIASLTSSFLTSIEQNPAVPAGVKNQAALELQSGAPFLSDTQLRSALADAGVSEELAQEALDANTAARLDGLRAALAVLAFAALIALFFTQRIPAAQPGSTKSS
>CP027022.1|AVH95595.1|2546843_2547029_+|CsbD-family-protein
MSSATDKLKGKIKEIAGKAVGDRRLETEGKTDQARAKTQEAVEEVRERTRGIRDSFKRKRS
>CP027022.1|AVH95594.1|2546222_2546648_+|hypothetical-protein
MTTTHPARSVGSARQAWAGGLTVFAAVMLGITGLVGVFRGIMAIAEDDVFLTTPNYVFEFDLTSWGWIHLILGIVALVVSFGLYTAATWARVTGVGIAGLVIIANFLSLPYYPAWSILMIAMSAVVIWALCTVRRDDTVPR
>CP027022.1|AVH95593.1|2545612_2546065_+|hypothetical-protein
MYLAYDFPLLSVFWSMLWFFLWILWFILLFRIITDIFRDHDMNGWAKAGWLAFVVLLPFLGILVYVIARGKDMGRREIAQARAQQQEFDSYIRKTATGSARSGSVDELVRLSELRSKDAITDEEFRRAKALILTDDQPAAAQPSPPAAGH
>CP027022.1|AVH95601.1|2555521_2557267_-|transferase
MRIGLLTEGGYPYAVGESGVWCERLVRGLGQHRFDLYAVGRPSAAGASLPLPPNARLVRAADPEGASGNLLERAALGTARAARRAYGRRDRRRFTEAYERLATGLCAEEAEGTGGARGVSTAGAGGSGAAGAGGSGAADVGESGGAAAFAEGLYALAELARERGGLPGALRSDDAVRALEAACRAPGARRGAAAAGLPDHLAFAEHLEGVLRPLSLDWYEEDALGAADLCHAAAGGTTALPGLLAGHFFGTPLLVTEYGVQLRAHYLSAAGADRSAPLRTLLAALHGRLAAEVYRQAALLTPGNAHTRRWQERCGADRDRVRTVHPGMAADRFDGVGEDEESGDPATLVWVGRAEPAKDLVALLHAFAEIRTRQPDARLRIVTVPVRDPGAEPYLAQCRALAAQLFPDEAAGAHAVGENPVSFEELGGPEAPTLEDTYASGAVVVLSSVVEGFPAGLVEAMFCARATVSTDVGAVVEIIGGTGLVVPPRNPRALADACLALLRDPERRYRLGAAARARALELFTVEQNLAAFRGIYLELLSHAPVRHRPGDGALFAHPAEAHVPGSWTPRAVTAGTGAPDA
>CP027022.1|AVH95602.1|2557457_2559131_-|ABC-transporter-ATP-binding-protein
MTAPETEAPLVDVRDLSVSFDRDGDPVRAVDGLSLTLAEGRALALVGESGSGKSTVAGALLGLHRGTGARVTGTVRVGGVDVATAGPADLRRLRGGIAAMVFQDPLSSLDPYYAVGDQIAEVYRIHAGGTRKAARARAVDVLDRVGIPDAARRSRSRPHEFSGGMRQRALIAMALACEPRLLVADEPTTALDVTVQAQILDLLHELRRETGTALLLVTHDVGVAAESADEVLVMRDGREVERGPVAGLLGAPSEPYTRRLLSAVPRLDGPVRAPSEEGETLLEAVGLRREFGRGGRTVTAVDDVSLTVRAGETLGLVGESGSGKTTLGRMLVRLLDPTGGRLRYGGVEIGALSERELRPYRRELQMVFQDPVASLNPRRSVGESIADPLRTAGERDEKRIRDRVGELLDRVGLDPDRYEAYPHEFSGGQRQRVGIARALAAEPRLIVCDEPVSALDVTTQAQVTALLAELQAELGLGLVFIAHDLAVVRQVSDRVAVMRGGRIVEQGTVEEVYGTPRDPYTRQLLAAVPSLDPALAAARRERRGEQRAERDGELAVA
>CP027022.1|AVH95603.1|2559154_2560144_-|ABC-transporter-permease
MTRFVLKRLAGAALVLLALSVLVYGLFYLAPGDPARLACGERCNPQQIAQVREQLGLNDSVFAQYLHFLQGVFTGRDYSTGTSVVHCDAPCLGLSYQSDQQVTRLVLERLPATASLALGAMVVWLLVGIGTGLLSALRRGGITERALTVLTLAGTGTPVFILGLLLLMAVCAHLQWLPFPSYVPLGEDPEQWAWNMLLPWITLGLFESAKYARLTRSSTLETLAEDHIRTFRAYGVGERTVVTRHALRGAVPPVIAISAVDLGSMFGGAVLTESLFGIPGLGKTLIDGVREIDLPVVVGVVMVMGTAVVLANVLADLLYAAADRRVVLT
>CP027022.1|AVH99571.1|2560140_2561052_-|ABC-transporter-permease
MWRRLRTRPAALASLAVLLLLVLLALAAPLLAALEGQDAYAYHDDLVDSARGGVPYGSFGGASADHWLGVEPGTGRDLFVRLLYGARISLLVGIGATVVQILIGVLVGLAAGLGNRWVDTVLGRATDVLVALPMLVLAIALTAVVPRDFPRPLLLILVIGFLGWAGTSRIVRAQTLTLKSLDFVAASRLAGSGRWRTARRELLPALAAPVITYAAILVPTNIVVEASLSFLGVGATPPTPSWGQMLSTAQTWFRADPAYVLLPAGLLFTTVLAFTVLGDAVRTALDPREASRLRVGTRKESSR
>CP027022.1|AVH95604.1|2561114_2562845_-|ABC-transporter-substrate-binding-protein
MRQPSVISRRVAAAAVSVVLASGTAACAGPEDAGAESGTSGKGSAAPQKGGTLTVLNAEAQTDFDPARLYTSGGGNVPSLVFRTLTTRNREAGAAGTQVVPDLATDIGRPNKDATEWTYTLKDGLKFEDGTPITSADVKYGIERSFAAELSGGAPYLRDWLVGGDTYQGPYKDPEGLASIVTPDPKTIVFKLRKPEGEFPFVATQTQFAPVPKAKDKGAKYEEHPVSSGPYKVVSNENDGERLVLERNEHWDPKTDEERKAYPDRIDVRSGLDEAVINQRLATSSGADAAAVTTDTNLGPAELAQIGSDKALAARVGTGHFGFTNYIAFNPKVKPFDNPKVRQAIAYAVNRTSVVNAAGGSALAEPATTFLPEQKAFGFTPYDHFPAGRTGNPEKAEQLLEEAGFPNGLTVTLLHSTAQNRTTSPEIATAVQEALGKAGITVKLDGQEPNSFNEKRWSVKDAPGFFLSRWGADWPAGGPFLAPIFDGRQIVTNGSNYNHAQLNDPAVNKEIDEINKLTDLKAAAARWGALDKKIGEQALDVPLFHPVYKRLVGKDVKNVVISDWTGVLDVSQVAVK
>CP027022.1|AVH95605.1|2563268_2564624_-|DUF3152-domain-containing-protein
MGRHSRKGSAPSPADTGRPTSAEQRRTAPEPGAAGPGAGTGRRRRTTAGDGQDPTGTPSGGTPRYGAPPQGGAPPYGTPAHGVPAYGGQGYGTPAHGTPAYGGQGYGTPAHGIPVHRTGAVRGGHPQHDEGGARPTPYDGRRGRTLTAEPEQGDEQGTFVPAPRHDDDDPDAEAPAARGGLGRTLAGVGAAAVATVLAVVVTGQVTGEEAPEAAPRAAGEPAERAVDDSSASRSEGRTTPSLPTAPPEPPAPTYEQLMNRQFPIDPKLKGSGAFEAVQGFQKAPGKGKLIRYRVDVEKGLGLDPKLFADAVQKTLNDPRSWAGNGAMTFERISGGEAQFVITLASPGTTGVWCRKSGLDTTVDNVSCDSASTERVMINAFRWAQGADTFGPKAIHAYRQMLINHEIGHRLGHNHVNCRTPGALAPVMQQQTKSLDIDGVRCRPNPWVHPGS
>CP027022.1|AVH95606.1|2564632_2565595_-|alpha/beta-hydrolase
MSSTELPETRTAAPPASRNRPVRVADGEELRSVALPGLSLTVRSRPGTRPGLPPALYVHGLGGSSQNWSALMPLLADVVDGEAVDLPGFGVSPPPEDGNYSVTGHARAVIRLLDSGGRGPVHLFGNSLGGAVATRVAAVRPDLVRTLTLVSPALPELRAQRTAWPTALLALPGVSSFFARLTRDWTAEQRVRGVMALCYGDPGQVTDEGFLHAVEEMERRLELPYFWDAMARSSRGIVDAYTLGGQHGLWRQAERVLAPTLLVYGARDRLVSFRMARRAATAFRGSRLLTLPDAGHVAMMEYPETVAQAARELIADHGGS
>CP027022.1|AVH95607.1|2565734_2565950_+|hypothetical-protein
MTVDPTEPDTFAEEEVVELDEETPEADAAEQHAELRPREDEPLTHVERESANEADASEQARVVTLDEDDYR
>CP027022.1|AVH95608.1|2566169_2566829_+|TetR/AcrR-family-transcriptional-regulator
MSAIEQTEAARPRGTRLPRRARRNQLLGAAQEVFVAQGYHSAAMDDIAERAGVSKPVLYQHFPGKLELYLALLDQHCESLLLAVRTALASTTDNKLRVAATMDAYFAYVEDEGGAFRLVFESDLTNEPAVRERVDRVSLQCAEAISQVIAEDTGLSEDESMLLAVGLGGVSQVVARYWLSSGSAIPRDKAVGLLTSLAWRGIAGFPLHPVDGQLSAEGH
>CP027022.1|AVH95609.1|2566974_2567202_+|DUF3107-domain-containing-protein
MEVKIGVQHAPREIVLESGQSAEEVERAVADALAGKAQLLSLSDEKGRKVLVPADRIAYVELGEPAVRRVGFGAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_9

2972452-2972586

Orphan

Consensus_repeat	Method
GCACCTACGCGCGCGTGGCGGCGCG	PILER-CR

2 spacers

The CRISPR arrays of CP027022_9

>merge|CP027022|9|2972452-2972586|PILER-CR
GCCCCTGCGCGCGCGTGGCGGCGCGTGCGGTGAAGAACCCTGAGAACGTGACCTACGCGCGCGTGGCGGCGCGACCTGTCCGGCCGCCTGCGCCGACGCCTGCGATCCGTGCGCCTACGCGCGCGTGGCGGCGCG

>CP027022|9|1|2972452-2972586|PILER-CR
GCCCCTGCGCGCGCGTGGCGGCGCG	TGCGGTGAAGAACCCTGAGAACG
TGACCTACGCGCGCGTGGCGGCGCG	ACCTGTCCGGCCGCCTGCGCCGACGCCTGCGATCCGT
GCGCCTACGCGCGCGTGGCGGCGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH95940.1\|2985986_2986685_+\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
CP027022.1\|AVH95927.1\|2967161_2968286_-\|GuaB3-family-IMP-dehydrogenase-related-protein	unknown	unknown	gnl\|CDD\|236322
CP027022.1\|AVH95936.1\|2978395_2979712_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
CP027022.1\|AVH95923.1\|2957418_2960652_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH95933.1\|2974266_2975040_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
CP027022.1\|AVH95930.1\|2972013_2972346_+\|WhiB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376791
CP027022.1\|AVH95938.1\|2980613_2981483_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP027022.1\|AVH95924.1\|2960852_2963408_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH95934.1\|2975058_2976972_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378358
CP027022.1\|AVH95935.1\|2977170_2978271_+\|HTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|380491
CP027022.1\|AVH95928.1\|2968391_2969894_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|235507
CP027022.1\|AVH99612.1\|2970117_2970690_-\|RNA-polymerase-sigma-factor-ShbA	unknown	unknown	gnl\|CDD\|236607
CP027022.1\|AVH95941.1\|2986757_2988386_-\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
CP027022.1\|AVH95926.1\|2965848_2967090_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|223749
CP027022.1\|AVH95939.1\|2981501_2982521_+\|hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240644
CP027022.1\|AVH95937.1\|2979717_2980617_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP027022.1\|AVH95929.1\|2970964_2971576_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|225107
CP027022.1\|AVH95922.1\|2955429_2957241_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH95932.1\|2973539_2974226_+\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225167
CP027022.1\|AVH95925.1\|2963658_2965365_-\|glycerol-3-phosphate-dehydrogenase/oxidase	unknown	unknown	gnl\|CDD\|223651

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH95940.1\|2985986_2986685_+\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	2.85742e-34
CP027022.1\|AVH95927.1\|2967161_2968286_-\|GuaB3-family-IMP-dehydrogenase-related-protein	gnl\|CDD\|236322	PRK08649, PRK08649, GuaB3 family IMP dehydrogenase-related protein.	0
CP027022.1\|AVH95936.1\|2978395_2979712_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.44747e-63
CP027022.1\|AVH95923.1\|2957418_2960652_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.09255e-18
CP027022.1\|AVH95933.1\|2974266_2975040_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	2.07908e-83
CP027022.1\|AVH95930.1\|2972013_2972346_+\|WhiB-family-transcriptional-regulator	gnl\|CDD\|376791	pfam02467, Whib, Transcription factor WhiB. WhiB is a putative transcription factor in Actinobacteria, required for differentiation and sporulation.	1.6089e-27
CP027022.1\|AVH95938.1\|2980613_2981483_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	8.41877e-62
CP027022.1\|AVH95924.1\|2960852_2963408_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	2.11219e-101
CP027022.1\|AVH95934.1\|2975058_2976972_-\|hypothetical-protein	gnl\|CDD\|378358	pfam10022, DUF2264, Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.	1.81908e-140
CP027022.1\|AVH95935.1\|2977170_2978271_+\|HTH-domain-containing-protein	gnl\|CDD\|380491	cd06267, PBP1_LacI_sugar_binding-like, ligand binding domain of the LacI transcriptional regulator family belonging to the type 1 periplasmic-binding fold protein superfamily. Ligand binding domain of the LacI transcriptional regulator family belonging to the type 1 periplasmic-binding fold protein superfamily. In most cases, ligands are monosaccharide including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor. In this case, the domain sugar binding changes the DNA binding activity of the repressor domain.	3.52274e-43
CP027022.1\|AVH95928.1\|2968391_2969894_-\|IMP-dehydrogenase	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	0
CP027022.1\|AVH99612.1\|2970117_2970690_-\|RNA-polymerase-sigma-factor-ShbA	gnl\|CDD\|236607	PRK09648, PRK09648, RNA polymerase sigma factor ShbA.	6.47279e-90
CP027022.1\|AVH95941.1\|2986757_2988386_-\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
CP027022.1\|AVH95926.1\|2965848_2967090_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|223749	COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane].	2.21313e-129
CP027022.1\|AVH95939.1\|2981501_2982521_+\|hydroxyacid-dehydrogenase	gnl\|CDD\|240644	cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	2.4581e-133
CP027022.1\|AVH95937.1\|2979717_2980617_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.70643e-60
CP027022.1\|AVH95929.1\|2970964_2971576_-\|DNA-binding-response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.73082e-50
CP027022.1\|AVH95922.1\|2955429_2957241_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	7.43929e-103
CP027022.1\|AVH95932.1\|2973539_2974226_+\|MOSC-domain-containing-protein	gnl\|CDD\|225167	COG2258, COG2258, Uncharacterized protein conserved in bacteria [Function unknown].	5.39202e-61
CP027022.1\|AVH95925.1\|2963658_2965365_-\|glycerol-3-phosphate-dehydrogenase/oxidase	gnl\|CDD\|223651	COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion].	1.76999e-162

>CP027022.1|AVH95930.1|2972013_2972346_+|WhiB-family-transcriptional-regulator
MADFSRLPGPNADLWDWQLLAACRGVDSSLFFHPEGERGAARSARENSAKEVCMRCPVRAECAAHALAVREPYGVWGGLTEDEREELMGRARNRLITTPPAAPTAAPASM
>CP027022.1|AVH95929.1|2970964_2971576_-|DNA-binding-response-regulator
MTSVLVCDDSPLAREALRRAVATVPGVERVTTAANGEEVLRRWGADRSDLILMDVRMPGLGGVETVRRLLSADPGARIIMLTVAEDLDGVALAVAAGARGYLHKDASRAELRATVTQALADPTWRLAPRRLRSAEMGAAPTLTAREIQVLEGMSHGRSNAEIGRELFLSEDTVKTHARRLFKKLGASDRAHAVALGFRWGLVR
>CP027022.1|AVH99612.1|2970117_2970690_-|RNA-polymerase-sigma-factor-ShbA
MPAKQGEIGALVHRAVEGDAQATHDLLARVHPLALRYCRTRLNRLPGDARHFVEDLAQEVCVAVLMALPRYKDTGRPFEAFVFAIAGHKVADLQRAAMRHPGSTAVPSDEMPERPDDSLGPEERALLSDDAEWAKKLLANLPENQRELLVLRVAVGLTAEETGQMLGMSPGAVRVAQHRALSRLRALAEQ
>CP027022.1|AVH95928.1|2968391_2969894_-|IMP-dehydrogenase
MTANVDGVPDKFATLGLTYDDVLLLPGASEVLPNAVDTSSRISRNVRVNIPLLSAAMDKVTESRMAIAMARLGGVGVLHRNLSVEDQVNQVDLVKRSESGMVTDPITVHPEATLAEADALCAKFRISGVPVTTPDGKLLGIVTNRDMAFETDRDRQVREVMTPMPLVTGKVGISGVDAMELLRRHKIEKLPLVDDQGVLKGLITVKDFVKAEKYPNAAKDAEGRLLVGAAVGASPEALERAQALAAAGVDFLVVDTSHGHNSNALSWMAKIKSSVDVDVIGGNVATRDGAQALIDAGVDGIKVGVGPGSICTTRVVAGIGVPQVTAIYEASLAARAAGVPLIGDGGLQYSGDIGKALAAGADTVMLGSLLAGCEESPGELLFINGKQFKSYRGMGSLGAMQSRGQGRSYSKDRYFQAEVSSDDKLVPEGVEGQVPYRGPLSNVLHQLVGGLRQTMGYVGAATVAEMESKGRFVRITAAGLKESHPHDIQMTVEAPNYSRK
>CP027022.1|AVH95927.1|2967161_2968286_-|GuaB3-family-IMP-dehydrogenase-related-protein
MTEIEIGRGKRGRRAYAFDDIAVVPSRRTRDPKEVSIAWQIDAYRFELPFLAAPMDSVVSPQTAIRIGELGGLGVLNLEGLWTRYEDPQPLLDEIAELDEATATRRLQEIYSAPIQEELIGRRIKEVRDAGVVTAAALSPQRTAQFSKAVVDAGVDLFVIRGTTVSAEHVSGAAEPLNLKQFIYELDVPVIVGGCATYTAALHLMRTGAAGVLVGFGGGAAHTTRNVLGIQVPMATAVADVAAARRDYMDESGGRYVHVIADGGVGWSGDLPKAIACGADAVMIGSPLARATDAPGKGHHWGMEAVHEDVPRGKLVDLGIVGTTEEILAGPSHIPDGSMNFFGALRRAMATTGYSELKEFQRVEVTVADAQHKR
>CP027022.1|AVH95926.1|2965848_2967090_+|nucleotide-sugar-dehydrogenase
MPADLAVIGLGHHGLPLAQAATAAGIDTVGYDTDPRPAAELAAGRSPADGPLTVPEVRRMLAGGFRPTHDPAELGRVRTAVLCPPTPLGPDRALDLTAVTDAARALAVRLRPHTTVVLESPVPPGTTEGLLRDVLETGSGLRAGRDFHLAYSPGRLDPGSRTHGYAGTPKVIGGLTPACTESAAAFYGRLTDKVVRARGPREAETVKLLETNFRHVNIALVNEMAVLCHELGVDLWDVIRCAETKPFGFQAFRPGPGVGGHGVPVDTVGAHRPLRLVELAGQVNERMPAYVVRRAAALLNEHGKSARGARILLLGITYKPDLPDRQGSPADEIARRLMDLGAAVSYHDPYVPDWRVRELPVPRADSLYEAAAHADLTVLLQHHRTYDLQGLSVKAQLLLDTRGATPAGAAHRL
>CP027022.1|AVH95925.1|2963658_2965365_-|glycerol-3-phosphate-dehydrogenase/oxidase
MRTATLGPAERAEALVAMAGRELDVLVVGAGVVGAGTALDAVTRGLSTGIVEARDWASGTSSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERFYAGSGVALYDAMSLSSGHGRGLPAHRHLSRQGALRVAPCLRKDALVGALQYYDAQMDDARFVTTLVRTAASYGALAASRARVVGFLREGERVVGARVQDVEAGAEYEIRAKQVVNATGVWTDDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTDTDWDLDKAHPAASSADIDYLLEHVNTVLATPLTRDDVEGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAPCVTEDTPLLGAEGYRALWNARAGIAARYGLHVVRVEHLLNRYGSLTRQLLDLIAEDPRLGEPLPAADDYLRAEIVYAASHEGARHLDDVLTRRTRISIETFDRGTRSARECAELMAPVLGWDARQIDKEVEHYEKRVEAERESQRQPDDLTADAARLGAPDIVPI
>CP027022.1|AVH95924.1|2960852_2963408_-|serine/threonine-protein-kinase
MSEAEQSRDTAKDPGRDAAAGAATDSDRGTVPAAREPERDERDAQVERGARAPEGAAEPEPDGGSADAAEAAADAASGPRVAAGGAKPASEAGAAPEAGAASGAGSGSDAGAASGGSGGSSGSGGKSGSGAAGAAGASGASGVSGVSVVKGAGDPRTDGVTGSGAGDAAAGAGAAGRLRGTEPSTGRAGFGAGDGDGGSGRGPATSGTARGGDKFRKAPAGEGRLLAGRYRLGAVLGRGGMGTVWRAVDETLGRTVAVKELRFPNSIDEDEKRRLITRTLREAKAIARIRNNGAVTVYDVVDEDDRPWIVMELIEGKSLADAVREDGTLTPRRAAEVGLAILDVLRSAHREGILHRDVKPSNVLIAEDGRVVLTDFGIAQVEGDPSITSTGMLVGAPSYISPERARGHKPGPAADMWSLGGLIYAAVEGSPPYDKGSAIATLTAVMTEPVDPPRNAGPELEKVIYGLLAKDPAQRLDDAGARALLRAVLDAPEAAPATSPEVTRVVPLPPAPGQAPAAPATDRGGAPDAAADRVRGALKSVRNAAASAKAEPRSRTAPTPGTVPVRGGGRPAPARAPLTDVVPRRTLVIIAAVVVVALLGTILAVSLGGGGDEGNQGKGKEGTTASAGASAGGDGGSGGSDGGKNRTPADPGQQGGVQPGGEGADGSAGTDGATGSTGTTGGGNGTTPSGKPDGGTGTQLPAGYTLVTSDRFHFSMAMPANFRMSTIPGYSLGGIFSANGGFPRVQVDYNNSPKDNAASAWELAKVGVIATSKDYKHFGIRPVSYKGYPTVADWEFERTQKGVRVHVLNRGFKVDSKWGYSIMVSCKADEWNGEECRTLRETAFATFSPKN
>CP027022.1|AVH95923.1|2957418_2960652_-|serine/threonine-protein-kinase
MDDYAGRVLADRYRLPLPPADEAGDAHDPTETRAFDTYSGQEVLVRQVPLPEFVDAEVLDGAGPGGSAGLHGGAGRATRRPAEPVVRRAIEAAQAAAQIPDHPLLDQVFDVFAEAGSLWIVSERVAEARPLAALLAERPLNPYRAAEIGADVLTALRALHAHGWVHRNITSRTVLVCDDGRVVLSGLAVGAAEEALCGYAPIPERDRIDEFAYPSPPHETEEPAPETYEPGVYEAETYEPETDGADGPEAYEPGAYESETYGPGGYEPEADGPGADETGADGSGAYALETYTPNAYEPEVYAPESHRPEPYTPERPAPAEEYGSDPYGSGGYGPRAYGSEEYEAGGYGSDIRGSDPYGSEERRTEERRPETHRPEPHAPYALEAPEGAGRDGDGADDGPDETPGASPGPGSGPDAYGTDPYGKSTATPAGTRPAATPPTADVRAARAGAIAAYRAGARAAARLGETGALPVQRPAPPEPAGPPPPPPTAPAAGSPEPQWWARVADDEDDEDDGDEPYGGGPRNGPPPRAMLTGSWSDGPHAARDGSGPIPAGGGSVLPGSGRPALPAGYRSARPDPERLPVHAGVPEPRREDPAEAPAESYRGPTTRLAAERARQTRIAVVGAVTERWAPEQAGPVHENWRLAAPIGPATDLWALGALLYRAVQGHAPYPEDSAAELVQLVCAEPPAFAEESGPLRPVVESLLRQDPTERPDFEELRGWLRSLVRSAPEPDAGVGVVPLPSFDEARLPIVRRRGELVRRRRKGEGAGRRRHKRGRDPHAAARHESERTHASEYAHVREHARVRDDFREEADGGYHEELPQRAPRAPRAPRTSSGSPRALGLKLLLLILLLLVAAVAYAVLFLPGGGETPAGRGTPTAGPAPGTTAPGGAPDPTANGPSANSPSGSRPPATTAPATTRPPADPSAPALAAGYALRQDPEGFRIGVPDGWRRSPINDSGQVRYTGGGFTMIVVPGRDSVRDNGSDPLVYQNARERELEPWRASSWSGAERTLRVDIGSTATATGSYWWLDGTGREVFVRNLALIDGGRYHVVQVIGPYTERDKVSEIYEEATKAFRPGR
>CP027022.1|AVH95922.1|2955429_2957241_-|serine/threonine-protein-kinase
MEHSQGTGAGLLLAGRYRLGETIGRGGMGKVWRAHDEVLHRVVAVKELTAGRFVAEADRLVLHARTQKEARAAARITHPGVVTVHDVLEHDARPWIVMQYVDGPSLADAAKESGTVEPREAARIGLHVLGALRAAHAAGVLHRDVKPGNILLARDGRVLITDFGIAAIEGDSTITRTGEIVGSIDYLAPERVKGADPGPASDLWSLGATLYTAVEGTSPFRRTSPISTMQAVVTEEPPHPEKAGALTPVIVALLRKDPAQRPRADEVGRMLLEAMEGRAPTSAQAYVPTQRVAKEDLDPAEATDDRDAPTSTASTASAADRERQADRAPRSEAGAAETAGTASRGSTAQWPQPPQALQQPQQAHPSRPPTPVPGPAHPPSGRGRRRTVVLAALLAGLVAGGAVFAAMHYAGGDRDADGTGGTPIATAPPATPSAKDEGKNGIPAGWHRVEDPEGFSLLVPDGWKRQTEGDQIDYTPDNGNHRIRISIDRNPDFENPYMHALDLERVLAKRMDYTRIKLLPTTYRDQTLSCLWEFSWTEKKTFPGPRRAIDQMYYGDDGTEYAIYMSSPESSWETTREQFDIVLRHWREAGERGEAQEGAQGGE
>CP027022.1|AVH95932.1|2973539_2974226_+|MOSC-domain-containing-protein
MTLLSVNVGRARAVDYTDAPVGRTAIDKRPVEGAVRIEAPGPPGVGGSGLAGDDVCDLRFHGGADRAAYAFAREDMDLWERELGRELANGSFGENLTTRGLDVNNALIGERWRIGDEVVLEVTGGRIPCRTFAGFLGEKGWVKRFTRSEAGPGALLRVIVPGEVRAGDPIAVVHRPDHGVTVALLHRAATVDRDLLPGTLVAAEWMESGLLDLARRHAEKYAEKCAGA
>CP027022.1|AVH95933.1|2974266_2975040_+|SDR-family-NAD(P)-dependent-oxidoreductase
MTTALITGATAGIGAAFARRLAADGHDVVLVARDVKRLREQATELHDRHGVEAEVLAADLSEEKGIAAVEARLSDPRRPVDLLVNNAGFGNKGRFLEVSMADELKMLTVHCEAVLRLTSAAAASMRERRRGGVVNVASVAAFVPRGTYGASKAWVVQFTQGAAKDLAGSGVRLMALCPGFVRTEFHERAGMGTDNIPGWMWLDADKLVSAALSDLGRGKTLSIPDPRYKALMGVVKLAPRGLLGGVSSKAGRKYGPK
>CP027022.1|AVH95934.1|2975058_2976972_-|hypothetical-protein
MPTPSEGRGPALSTSSESHGPALPPHPEGRGPALPTPSEGRGLSPYTGWTRAHWEVAADRLLLDVRPFASPRHGLIGLPGPRPSWSGPRSDALEGWARTFLLAALRVAGARGEDPHGHLDRYAEGLAAGTEAPGREDAESWPLMADTRQAVVESASVALGLRLTRPWLWDRLDDRVRARVADWLLPALGPSPVDNNWWLFGLTVAGFLRDAGIETDRAAATIDRSLDRVEDWYLGDGWYTDGDNRAFDHYNGWALHFYPVLHAHLSGDRALLDRYGPRLRAHLDDHVHLFDANGAPVPYGRSLIYRFAAAAAPWLGALTGHTPLAPGATRRLASGALRHFLDRGAADGRGLLTLGWHGPYPPLVQEYSGPGSPYWASKGFLGLLLPADHPAWTDPEAPLPAERADTVRAFAPAGLLVQTTAADGLVRLHNHGSNHVESRAGGEDDPGYARQAYSTRTGPTTGSAPADNHFALLDAEGRATTRGPAAPAGTGPGWAASLHAPRPGVRVLSATLAHGSAELRAHLVLGAPEGTPVRQTGWATTPDGPRATLHPVHGHPPEDPAVVLPVGETLQGPGAHVLALHGTTRGPAALFAALASLTAAPDPTPVTDHARVRIDGHTLHVAWRDGTTTCLDLDALL
>CP027022.1|AVH95935.1|2977170_2978271_+|HTH-domain-containing-protein
MRESAAERHDRLLALVRERGTARVSDLAERLGVSPVTARRDVELLAGRGLLDRVHGQVSWPERQGAPGAGRPGEGLVLGLLVPSATYYFAEVIRGAHEAAARAGARLVLRVSDYRPEEDRARAEGLLAAGAEGVLVAPGWRGPEDRLAYGDRLAELPVPAVLLERRAEPGSPLDGLDRVASDHAHGVLLALRHLLSLGHATPLLVARRDSPTALAVRAGYAEALGTLGLAEPRPVIDSVPAEADPEGFERAVRALHEAVGSGLASAALVHNDVDAIEIARRLAELGVGVPRDLALIAYDDEVAALADTPLTAVAPPKRQVGRHATELLVERLTERDVPGETPARRHLSLLPWLRVRSSCGAPNPRP
>CP027022.1|AVH95936.1|2978395_2979712_+|sugar-ABC-transporter-substrate-binding-protein
MTPFRSRTTRVIAGTATALAVLTACGGGGDDTANKPNGPVTLTFWGWAKGTKDVVDAFNASHTDVKVKFEEIPSGTAGGYAKISNAVKAGNAPDLVSIEYSSLPEFVSSGALQDIGGEFTEADRAKLLPQTVELTTLGGKSWAVPFDASPQAFFYRKDLFEKYKVQVPTTWDQFEKAAAQVKKADAKARIATFFPDDPTTFEAMAWQAGAQWFKAEDDTWKVNTTDPATTKVTAYWQKLLDDGLVHKNASFSPEWVGSLKNGTTLGYLGASWGAGVLKGTLPEQSGKWAVAPVPSWDGKPASGMLGGTSFAVTKDSKKKAAAVAFAEWMSTTEEGVKARIASGTSSAFPAAAALRPVAKQAFDAGYYGGQDIYALFETAGASINPSWAWGPTTGTTNTTIKDQFGKIAPGGPSLADAVKAGHDATVAELTKRGLKVEG
>CP027022.1|AVH95937.1|2979717_2980617_+|sugar-ABC-transporter-permease
MKARTRAATILLTPFFLLFTAVMVVPIGYAVWLSLFTEKQSGLGFGGTETVFTGLDNYTAALGDRAFREGFGVLLGYCLFYIPLLLAGALGLALLLDSALARARRFFQLALFLPHAVPGIIAALIWVYLYTPQLSPVVKAMEAGGIGFDFFSPEGALPSVVNIALWEWLGYNMVIFYAALQAIDRSVLEAATVDGAGAWRIAFSIKVPLVKASLAMVGLFTIIGSLQLFTEPLILSKGTGSAVTSTWTPNMYAYTAAFDRNDYGLAAAASVLLALTAALLSFAVTRLTGRRAARKERTA
>CP027022.1|AVH95938.1|2980613_2981483_+|carbohydrate-ABC-transporter-permease
MSATRTGRTRPASRWLSRTAVNGVLVLATVYMLFPLVWLLTAATKDAGGLLAGNAFSFEGFDLGGNLTRLAEYNDGIYFHWYLNSLLYAGLGALACSLVSVAAGYAFHVYDFRGKEKLFGLVLLGVLVPTTALALPMYLLASEVGVVNTYWAVLVPVLVNPFGVYLSRVFCAGYVPDEALEAARIDGAGELRVFWSIGLRMVMPGFVTVFLFQFTAVWNNFFLPLVMLSDQKLYPLSLGLYAWNSNAHAEPDFYPLVVTGSLLAVVPLVVAFVSLQRHWKAGLTAGSVK
>CP027022.1|AVH95939.1|2981501_2982521_+|hydroxyacid-dehydrogenase
MHPTTDNRPALLLAMGPGVADRLLTGAHRARLAALTRTDPHLVAHDLTAPDARTAAALAEAEVLLTCWGATPLTPEVLDRAPRLRAVVHAAGSVKHHVTEACWERGLRVTSAAAANALPVAEYTLAAILFAGKRVLRSARRYAELRTGHAWLEESADWGNHRRTVGIVGASRIGRRVIDLLAPFDFEILLYDPYVTTPPPGTELVDLDELCARSTVVSVHAPQLPSTHRMIGAAQLAAMPAGTTLINTSRGSLVDEASLLPHLLTGRLDAVLDVTDPELPPPDSPLWTLPNVLLTPHVAGSLGNELHRMADQAVGEVERYARGEAFAEEVRVSDLTRSA
>CP027022.1|AVH95940.1|2985986_2986685_+|ester-cyclase
MTFMQIIDCRTSRFDEMNRLMDQWAEQTKGRRTATHSVLGKDRSDGSHFVEIVEFPSYDEAMRNSHLPETDRLFHEMVALCDGMPTFTDLDVVRDEQLYKDAARRFLELIGTPGELPPLDEVIAEGCHSHDPSDVQDSLGMDAIRRGFEMWRRGFDFTFTVEDQIAEGDRVCTRWTCDATHVGDFMGIQPTGIDVRVTGMLIQRFREDGKVVEDWWQYDMLGLMERLGAVEE
>CP027022.1|AVH95941.1|2986757_2988386_-|chaperonin-GroEL
MAKILKFDEDARRALERGVNKLADTVKVTIGPKGRNVVIDKKFGAPTITNDGVTIAREVEIEDPYENLGAQLVKEVATKTNDIAGDGTTTATVLAQALVREGLRNVAAGASPAALKKGIDAAVKAVSEELLATARPIDDKSDIAAVAALSAQDQQVGELIAEAMDKVGKDGVITVEESNTFGLELDFTEGMAFDKGYLSPYMVTDQERMEAVLDDPYILINQGKISSIQDLLPILEKVIQAGASKPLLIIAEDVEGEALSTLVVNKIRGTFNAVAVKAPGFGDRRKAMLGDMATLTGATVIAEEVGLKLDQAGLDVLGTARRVTITKDDTTIVDGGGNSEDVQGRVNQIKAEIESTDSDWDREKLQERLAKLAGGVCVIKVGAATEVELKEKKHRLEDAISATRAAVEEGIVSGGGSALVHAVKVLEDNLGKTGDEATGVAVVRRAAVEPLRWIAENAGLEGYVITSKVAELDKGQGFNAATGEYGDLVKAGVIDPVKVTRSALENAASIASLLLTTETLVVEKKEEEPADHGHGHGHGHSH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_13

4137455-4137538

Orphan

Consensus_repeat	Method
CCCCTCACGCGTACGCGTACGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_13

>merge|CP027022|13|4137455-4137538|CRISPRCasFinder
CCCCTCACGCGTACGCGTACGGAAGCGCGACCCGTACACCGGCTCCCGGAAGGCGGCCGACCCCTCCACGCGTACGCGTACGGA

>CP027022|13|12|4137455-4137538|CRISPRCasFinder
CCCCTCACGCGTACGCGTACGGA	AGCGCGACCCGTACACCGGCTCCCGGAAGGCGGCCGAC
CCCTCCACGCGTACGCGTACGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH96889.1\|4140285_4140861_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH96887.1\|4135546_4137400_+\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|237104
CP027022.1\|AVH96890.1\|4141776_4142514_+\|antibiotic-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
CP027022.1\|AVH96896.1\|4151679_4152882_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340951
CP027022.1\|AVH96879.1\|4126138_4126996_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|164795
CP027022.1\|AVH96893.1\|4144117_4145122_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|181818
CP027022.1\|AVH96883.1\|4131938_4132799_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH96880.1\|4127042_4128167_-\|DNA-integrity-scanning-protein-DisA	unknown	unknown	gnl\|CDD\|237395
CP027022.1\|AVH99715.1\|4140919_4141780_+\|multidrug-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
CP027022.1\|AVH96882.1\|4130135_4131917_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237864
CP027022.1\|AVH96885.1\|4133868_4134693_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
CP027022.1\|AVH96878.1\|4123947_4124883_-\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
CP027022.1\|AVH96892.1\|4143454_4144042_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
CP027022.1\|AVH96888.1\|4137558_4139691_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH96894.1\|4145392_4145632_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH96884.1\|4132839_4133772_+\|Ppx/GppA-family-phosphatase	unknown	unknown	gnl\|CDD\|223326
CP027022.1\|AVH96881.1\|4128554_4129958_-\|DNA-repair-protein-RadA	unknown	unknown	gnl\|CDD\|236994
CP027022.1\|AVH96895.1\|4150975_4151623_+\|hydrolase	unknown	unknown	gnl\|CDD\|319828
CP027022.1\|AVH96891.1\|4142599_4143409_+\|pyrroline-5-carboxylate-reductase	unknown	unknown	gnl\|CDD\|237008
CP027022.1\|AVH96886.1\|4134709_4135417_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380054

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH96887.1\|4135546_4137400_+\|dihydroxy-acid-dehydratase	gnl\|CDD\|237104	PRK12448, PRK12448, dihydroxy-acid dehydratase; Provisional.	0
CP027022.1\|AVH96890.1\|4141776_4142514_+\|antibiotic-ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	3.50856e-26
CP027022.1\|AVH96895.1\|4150975_4151623_+\|hydrolase	gnl\|CDD\|319828	cd07526, HAD_BPGM_like, subfamily of beta-phosphoglucomutase-like family, similar to Escherichia coli 6-phosphogluconate phosphatase YieH. This subfamily includes Escherichia coli YieH/HAD3 an 6-phosphogluconate phosphatase, which can hydrolyzed purines and pyrimidines as secondary substrates. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate, and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.70272e-56
CP027022.1\|AVH96896.1\|4151679_4152882_+\|MFS-transporter	gnl\|CDD\|340951	cd17393, MFS_MosC_like, Membrane protein MosC and similar proteins of the Major Facilitator Superfamily of transporters. The gene encoding Sinorhizobium meliloti membrane protein MosC is part of the mos locus, which encodes the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine. MosC belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.05496e-93
CP027022.1\|AVH96879.1\|4126138_4126996_+\|hypothetical-protein	gnl\|CDD\|164795	PHA00370, III, attachment protein.	0.00157285
CP027022.1\|AVH96893.1\|4144117_4145122_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|181818	PRK09393, ftrA, transcriptional activator FtrA; Provisional.	4.30707e-104
CP027022.1\|AVH96880.1\|4127042_4128167_-\|DNA-integrity-scanning-protein-DisA	gnl\|CDD\|237395	PRK13482, PRK13482, DNA integrity scanning protein DisA; Provisional.	0
CP027022.1\|AVH96886.1\|4134709_4135417_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380054	pfam17920, TetR_C_16, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. This entry represents the C-terminal domain found in a number of different TetR transcription regulator proteins found in Actinobacteria. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain.	1.49221e-34
CP027022.1\|AVH96882.1\|4130135_4131917_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237864	PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional.	1.32378e-09
CP027022.1\|AVH96885.1\|4133868_4134693_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	4.91588e-28
CP027022.1\|AVH96888.1\|4137558_4139691_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	2.22573e-84
CP027022.1\|AVH96892.1\|4143454_4144042_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	2.22597e-46
CP027022.1\|AVH96884.1\|4132839_4133772_+\|Ppx/GppA-family-phosphatase	gnl\|CDD\|223326	COG0248, GppA, Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism].	1.71866e-84
CP027022.1\|AVH96878.1\|4123947_4124883_-\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	3.65705e-81
CP027022.1\|AVH99715.1\|4140919_4141780_+\|multidrug-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.40002e-80
CP027022.1\|AVH96891.1\|4142599_4143409_+\|pyrroline-5-carboxylate-reductase	gnl\|CDD\|237008	PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed.	5.6128e-107
CP027022.1\|AVH96881.1\|4128554_4129958_-\|DNA-repair-protein-RadA	gnl\|CDD\|236994	PRK11823, PRK11823, DNA repair protein RadA; Provisional.	0

>CP027022.1|AVH96887.1|4135546_4137400_+|dihydroxy-acid-dehydratase
MPELRSRTVTHGRNMAGARALMRASGVPGADIGRKPIIAVANSFTEFVPGHTHLQPVGRIVSEAITAAGAIPREFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVEAHCADALICISNCDKITPGMLMAALRLDIPTVFVSGGPMESGRATLVDGTVRTLDLVDAISDAVNPKISDEDILRIEENACPTCGSCSGMFTANSMNCLTEAIGLSLPGNGSVLATHTARRALYENAARTVVDITRRYYDEDDASVLPRSIATRAAFENAMALDIAMGGSTNTILHLLAAAQEAELDYGLPDMDEVSRRVPCLAKVAPNVAKDRTYYMEDVHRAGGIPAILGELYRAGLLNEDVHSVHSRSIKEWLDAWDVRGGSPTEEAVELWHAAPGCVRSATAFSQSERWEALDTDAVGGCIRDAEHAYSKDGGLAVLHGNLAADGCVVKTAGVDESIWTFEGPAVVCESQEEAVEKILNKQVKDGDVVVIRYEGPKGGPGMQEMLYPTSFLKGRGLGKTCALVTDGRFSGGTSGLSIGHASPEAASGGVIALVEDGDRVRIDIPNRSIDLLVGDDVLAARREALGGVYAPKNRERKVSAALRAYAAMATSADKGAVRDVTKLG
>CP027022.1|AVH96886.1|4134709_4135417_+|TetR/AcrR-family-transcriptional-regulator
MTAQDPGAGPAPATGQSPETGTGPEAGSGTGPQAAPAPRRRGRPSRTAEESGPGARARILEAARDQFAERGYDKASVRGIARAAGVDPALVHHYFGSKDEVFAAAVEVSFEPATVVPAIVSGPRDGIGERLARFFIGVWENPASRAPLLAIVRSALTHEAAAAVLRTFVLRRLLERIAAELDVPDPKFRAELAASHMIGIAILRYVIRVEPLASADPEAIVAQVAPTLQRYLTES
>CP027022.1|AVH96885.1|4133868_4134693_+|sugar-phosphate-isomerase/epimerase
MVRVPDAKVALSTASVYPESTATAFEVAARLGYDGVEVMVWTDPVSQDVEALRRLSDYHRVPILAVHAPCLLITQRVWSTDPWVKLQRARTAAEKLGASTVVVHPPFRWQRQYARDFVSGIWRMADETDVRFAVENMYPWRYKDREMLAYAPEWDVTKDDYRHYTVDLSHTATARTDALAMIDRMGDRLGHVHLADGRGSAKDEHLVPGRGTQPCAELLERLAVTGFDGHVVIEVNTRRAMSAAEREADLAEALAFTRLHLASAAGRPSRTPRP
>CP027022.1|AVH96884.1|4132839_4133772_+|Ppx/GppA-family-phosphatase
MRLGVLDVGSNTVHLLVVDAHPGARPLPAHSHKAELRLAELLDARGAIAPDGVERLVATVRDALHAAEDKGCEEVLPFATSAVREAVNADAVLARVKDETGIDLQVLTGEEEARLTFLAARRWFGWSAGKLLLLDIGGGSLEVAYGIDEDPDTAVSLPLGAGRLTAGWLPGDPADSADVKALRRHVRAQIARTVGEFSRFGRPDHVVATSKTFKQLARIAGAAGSGEGLHVQRILTRRSLEEWVPRLAGMTVVERAALPGVSEGRAGQLLAGALVAEGAMDLLGVEELEICPWALREGVILRRLDHLPEE
>CP027022.1|AVH96883.1|4131938_4132799_-|hypothetical-protein
MPKTKKAKQDKDSARAVDVSAARAVKGAGKRGKDVEPDEKGLDFARAWVEFPDPADEEQVFRCDLTWLTSRWTCVFGSGCRGIQAGRADDGCCTLGAHFSDEDDEKRVAEHVARLTPELWQFHDVGTETGWTQLDEDGDRQTRRWEGSCIFQNRPGFAGGMGCSLHILALKEGREPLETKPDVCWQLPVRRTYDWIDRPDDTRVLQVSIGEYDRRGWGPGGHDLHWWCTSATSAHGAGEPVYVTYRPELTEMMGEEAYGVLAGLCEARLASQLPLVAPHPADPPRA
>CP027022.1|AVH96882.1|4130135_4131917_+|sigma-70-family-RNA-polymerase-sigma-factor
MTSSRLETPARTTGAHRAHRATGQGPRTLGRRPPARYEAALDGLFTYCLSVLCDHDTATAVLGDVLAVAERHHGRCPSDEDGRTAWLYALARWACLRTLGEQRRKRQGAHTGRPAVTPPEPPRVSAETAERHRAELALLAWPEAAGTTPEQREALELAVRHGLNHRQVAAVLSLDPLAARELLATAGCEVERTRAALAVVETGSCPTVARLTGDHRVLLSATLRAELVRHVDDCPRCRRAAERVGAAGPWPGAGALPPDRLPLVEAPRAAAYMAMLHVPRARAGAPRFAPTGFPMDPKDHTARRDRMRARAVTTTVVAAVVAAPVLALWTSYRGTTDTAAHDGGRVSARETDDGAGPDGRPYDRYENAGSARATPEPRFTRGSRSPDVSVEVVSPGGPTGPGTPPKPGEAAPGWVTVAARGHGDLTLLTLTAAGGSPVAWSLWTDAPWIYVSRASGTLRPGERITIEVRVDHGREPVDGWSARVGVNPSGAVVRITGSGTGPVFHPGPDVPRPPRPTPPPPTTEPTTPPTTPPPTTEPPTTPPPTTEEPPPTTPPPTTEEPTTPPPTTEEPPPPTTDPGTTPPPETEEPAPSP
>CP027022.1|AVH96881.1|4128554_4129958_-|DNA-repair-protein-RadA
MAARTKSAKERPSYRCTECGWQTAKWLGRCPECQAWGTVEEYGAPAVRTTAAGRVSTAALPIGQVDGRQATARSTGVDELDRVLGGGLVPGAVVLLAGEPGVGKSTLLLDVAAKAASDEHRTLYVTGEESASQVRLRADRIGAIDDHLYLAAETDLSAVLGHLDAVQPSLLILDSVQTVASPEIDGAPGGMAQVREVAGALIRASKERGMSTLLVGHVTKDGAIAGPRLLEHLVDVVLSFEGDRHARLRLVRGVKNRYGATDEVGCFELHDEGITGLADPSGLFLTRRDVAVPGTCLTVTLEGRRPLVAEVQSLTVDSQIPSPRRTVSGLETSRVSMMLAVLEQRGRISALGKRDIYSATVGGVKLSEPAADLAIALALASAASDTPLPKNLVAIGEVGLAGEVRRVTGVQRRLAEAHRLGFTHALVPTDPGRVPPGMKVTEVADMGDALRVLPRGRRAKAPEGAEQ
>CP027022.1|AVH96880.1|4127042_4128167_-|DNA-integrity-scanning-protein-DisA
MAAKDGAAAPGKSGAGSGSDALMRAALSAVAPGTALRDGLERILRGNTGGLIVLGLDKAVDSMCTGGFVLDVEFTATRLRELCKLDGALVLDKDITKIHRAGVQLVPDASIPTEETGTRHRTADRVSKQCNFPVVSVSQSMRLIALYVHGERRVLEESAAILSRANQALATLERYKLRLDEVAGTLSALEIEDLVTVRDVTAVAQRLEMVRRIATEIAEYVVELGTDGRLLSLQLDELIAGVEPERELVIRDYVPEPTAKRSRTVAEALTELDALTHTELLELPVVARALGYSGSPETLDSAVSPRGYRLLAKVPRLPGAIIERLVEHFGGLQKLLAASVDDLQAVDGVGEARARSVREGLSRLAESSILERYV
>CP027022.1|AVH96879.1|4126138_4126996_+|hypothetical-protein
MGSLRNPVGPLPSTIYWRRRAVALCLIALLALLTVWAVTSGGGGGEKPNDSANGSSPTPPSITPGPSGSGPAISQQPGGRDESDEEDGASGGNGGAEPGGSGSDSGSGGTDAGTGSGGADSAGPGVPDGNGDGSGDGGAGTGAGRQLPADSPIPNCPAGAVQLTLKSVKVTYETGEKPRFQLVAKNTSATDCKADFGPRSAVLTISDAKDDEVWSSAHCPRPGTPLLLSLPAGATVTHTVEWDRGRSAPQCATAPAGRAGPGTYLVEAAMPGVKILPASFTLAKD
>CP027022.1|AVH96878.1|4123947_4124883_-|A/G-specific-adenine-glycosylase
MTSIDTPSVPEAPGIPGVPAVPAELHRPVLAWFDQHARDLPWRRPEAGAWGVMVSEFMLQQTPVVRVLPVYEQWLARWPRPADLAAEAPGEAVRAWGRLGYPRRALRLHAAATAITERHGGDVPSDHGQLLALPGVGEYTAAAVASFAYGQRHAVLDTNVRRVFARAATGVQYPPNATTAAERRLARALLPEDEETASRWAAASMELGALVCTAKNEDCGRCPISGRCAWRLAGKPAHDGPPRRGQTYAGTDRQVRGRLLAVLRDSADPVAREALDAVWDEPVQRARALDGLVADGLVEPLDDGFYRLPLS
>CP027022.1|AVH96888.1|4137558_4139691_-|serine/threonine-protein-kinase
MPPLRGAGADREAEGPEYAGAYRLQARLGAGGMGVVHLATSPSGLRLAVKVVHGQYAEDPEFRARFRQEVAAARRVSGAFTAPVVDADPDAVRPWMATLYVPGPTLADQVKRNGPLSPAGLRRLTAGLAEALRDIHRAGVVHRDLKPSNVLLTDTGPKVIDFGISRPVDSDLHTETGKLIGSPPFMAPEQFQRPREVGPAADVFALGSVLVHAATGHGPFDSDSPYIVAYQVVHDEPDLTGVPDDLAPLVARCLAKEPAERPSPAEIMAALLPPSYEATAFVPSQRRAPSAPVPEPRPPASWEADTPVRMTTNRPRRRWPPHRAVTAAALLVLAGGAVFAAVPSGGGDPAPEPRRTGAAGAFAGWQTPLQQDGDPAAPACAYVGDALFCSGRGIGVARLDPATGRTLWSRPAPPGEKHSAPVPLSGGLLGVVSDDDRLRAYGTDGAPRWDTGASGRHGGVRGAGDTVLTGGSGTVRAVDGATGELLWDHALRGHSAPRLGQYAPETGLLPVFENSAGGTHTLVSALRPRSGGIAWQERLDGDLVPVGTGADGVLFLRSVNLDSRTDAVVVHDPASGSTRRVPLPSLLDEPRFAVRGTTVYLLTPTGRLTALDTAAPGGRVRWELETAAGTVSVPVTGPGDRLYFSASDGRLLAVDTARGALLGQTRPRLRDGRLGYATTVPAPVVAGDRVFGTAPDGSVFAVDAGDPGAW
>CP027022.1|AVH96889.1|4140285_4140861_+|hypothetical-protein
MSDDEQTPRTAGGTADGKTAGSAAGKTAATGGPSAGPRPEEIRFFGTTWVDHSGHYALRRAGLAAGALAAAVAACFVLRFAFQGLQIANTGGLVNGLVIVMFAVCSAIACRKTWEGFQRRPDDPAREDSLRSLKAIGFIGSLLAYAARCLTEAPGEKLHRAEYEAALARYEKRRGSRTGNPAARRKPKRGK
>CP027022.1|AVH99715.1|4140919_4141780_+|multidrug-ABC-transporter-ATP-binding-protein
MNYSADGSGDRSEADDTEADDLETTDPTPAAITARSLTAVRGDRTVLRGLDLTVPAGRITGLLGPSGCGKTTLMRAIVGTQAKVGGTLTVLGRPAGDPALRSRIGYVTQAPSVYDDLTVRQNLDHFAAVLLPGRAHRHERRAAVERAVADVDLTSRADSLAGRLSGGQRNRVSLAVALLGAPELLVLDEPTVGLDPVLRRDLWDLFHRVAADRGTTLLVSSHVMDEAERCHRLLLMREGEILAEDTPEALRRRNDTPTVEEAFLHLVDAAASRENQDQHQNQEPRP
>CP027022.1|AVH96890.1|4141776_4142514_+|antibiotic-ABC-transporter-permease
MSSARTLATAARVLRQLRHDPRSIALMLLVPCVMLFLLRYVFDGSPGTFDTIGASLLGIFPLITMFLVTSIATLRERTSGTLERLLALPLGKGDLIAGYALAFGLLAVVQSALATGLALWFLGLDVVGSPWLLLLVALLDALLGTALGLFVSAFAASEFQAVQFMPAVIFPQLLLCGLFTPRDRMAPALEAVSNVLPMSYAVDGMNEVLRHPEVTGAFVRDVLVVAGSALLVLALGAATLRRRTA
>CP027022.1|AVH96891.1|4142599_4143409_+|pyrroline-5-carboxylate-reductase
MTQTVAVLGTGKIGEALLSGMIRAGWRPANLLVTARRAERAEELRTRYGVETVTNAEAAKRADTLILAVKPQDMGRLLDELAPHVTADRLVVSAAAGIPTSFIEERLTAGTPVVRVMPNTPVLVDEGMSVISAGSHATPDHLAHTEEIFGGVGKTLRVPESQQDAATALSGSGPAYFYFLVEAMTDAGILLGLPRAQAHDLIVQAAIGAAVMLRDSGEHPVKLREAVTSPAGTTISAIRELENHGVRAALIAALEAARDRSRELASGNG
>CP027022.1|AVH96892.1|4143454_4144042_-|cysteine-hydrolase
MEIAENAALVVVDVQKGFEEEYWGRRNNPEAERNIAVLIDLWQETGRPVVFVRHDSPEGSRSPLRAGHGGNDFKDFVEERRGKGSGPELLVVKSVNSAFYAEPSLDAWLRGHGVGQIVVVGIQTNMCNETTARMGGNLGYDVVFPLDAMHTFDLEGPYGWTAGADELTRATAVSLHGGGFAKVVGTEDVVRGASA
>CP027022.1|AVH96893.1|4144117_4145122_+|AraC-family-transcriptional-regulator
MAPPPEPHPQRIALLAFPGVRAFDVSVITEVWGSDRALRGVPPFALHRAATDPHTPVRLRGGLTLTPDRPLTWLHDLTPTDLVIVPGIEDPDADVPPPVLDALRRAHSTGVPVASLCAGAFVLARAGLLDGRRAVTHWHLARTLAARHPAVRVEPDALFVEDSGIWTSAGTAAGIDLCLHLVRTAHGAEAAATVARSMVTAPFRTGTQAQFIEHPTPRADRDADALAAVRAHALAHLSEPHTVASLAAVAGMSPRSFARHFQATTGTTPLHWLITQRVAAAQKLLELTDHPLPEVARRAGFGSEVTMRQHFASHLSTSPRAYRNAFRHRAPDQA
>CP027022.1|AVH96894.1|4145392_4145632_-|hypothetical-protein
MDGVSTNLALIFGTLLSSQGTDASFVLTLSGFPPGFSLRSCVSDSIRSFRPDFLSAFRPLSLSLRALPAVPTLSDPFGV
>CP027022.1|AVH96895.1|4150975_4151623_+|hydrolase
MRYDLVIFDNDGVLVDSEPISNTLLAGYLTELGHPTSYEDSLRDYMGSAMHRVHDLVEERTGQRLPADFDDVFHARVFAAFRAELEAVPGVEDVLKRLVAAGVPYCVASSGSHERIRVGHRKTGLDAWFRDENVFSSEDVGRGKPAPDLFLHAAARMGVEPGRCVVVEDSRLGVQAAMAAGMDVYGFTAMTPEEKLAGARGFFRRMDELPMILGM
>CP027022.1|AVH96896.1|4151679_4152882_+|MFS-transporter
MTDARLRRGRGSLAFGFFVQGVTFALLVTRIPAIQDRYGISDALLPAFLAAVPILAGVASVVTEKVVARVGPAVVLRWSQPFVLLALLAVGAGTELWQAAVALGFFGLAVGALDASMNMLGVSLQRAYGRSIMLGFHASYSLGGIVGASLAWVGAHWHLSLFTSYLPVVAVLLPLALVGSRWYVAGDDGPVPEESTEKGSGAVAFTLLLPLCLVMTFAYIGDSTVANWSAKYLQDVLHGSEELATVPYNAYMVTTLLGRAVGDFGVRRLGAAAVVRGGAVLAALGFGLVAAAPGAWAGIAAFTLLGLGLSVLVPQTFAAAGRLFPGNSDAAVARLNVFNYVGFLIGSPLVGALGDAWSYRGAMLVPMVLVLVTVVYATSFGSRGARYGGGHERPRTVDVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_15

5127251-5127355

Orphan

Consensus_repeat	Method
ATCCCCTGTAGCTCAATTGGCAGAGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_15

>merge|CP027022|15|5127251-5127355|CRISPRCasFinder
ATCCCCTGTAGCTCAATTGGCAGAGCAGCCGGCTGTTAACCGGCAGGTTACTGGTTCGAGTCCAGTCGGGGGAGCGCGATCCCCTGTAGCTCAATTGGCAGAGCA

>CP027022|15|14|5127251-5127355|CRISPRCasFinder
ATCCCCTGTAGCTCAATTGGCAGAGCA	GCCGGCTGTTAACCGGCAGGTTACTGGTTCGAGTCCAGTCGGGGGAGCGCG
ATCCCCTGTAGCTCAATTGGCAGAGCA

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH97616.1\|5115427_5116750_+\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|235098
CP027022.1\|AVH97622.1\|5125302_5126742_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|198375
CP027022.1\|AVH99801.1\|5126769_5127081_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH97623.1\|5129085_5130378_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|128941
CP027022.1\|AVH97624.1\|5130623_5131100_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH97627.1\|5142382_5142898_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372824
CP027022.1\|AVH97629.1\|5143809_5144454_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
CP027022.1\|AVH99803.1\|5131400_5140091_+\|sugar-binding-protein	unknown	unknown	gnl\|CDD\|271154
CP027022.1\|AVH99802.1\|5128094_5129009_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226309
CP027022.1\|AVH97615.1\|5114614_5115391_+\|sirohydrochlorin-chelatase	unknown	unknown	gnl\|CDD\|225049
CP027022.1\|AVH97614.1\|5113563_5114187_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
CP027022.1\|AVH97621.1\|5123351_5125085_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
CP027022.1\|AVH97617.1\|5116878_5118138_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|170080
CP027022.1\|AVH97628.1\|5142928_5143543_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH97630.1\|5144560_5145034_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH97620.1\|5121423_5123352_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
CP027022.1\|AVH97625.1\|5140176_5140692_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379650
CP027022.1\|AVH97618.1\|5118167_5120060_+\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
CP027022.1\|AVH97626.1\|5140688_5141345_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
CP027022.1\|AVH97619.1\|5120113_5121199_+\|RNA-polymerase-subunit-sigma-70	unknown	unknown	gnl\|CDD\|235640

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH97616.1\|5115427_5116750_+\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|235098	PRK03007, PRK03007, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
CP027022.1\|AVH97622.1\|5125302_5126742_-\|sugar-kinase	gnl\|CDD\|198375	cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases. This subgroup is composed of D-xylulose kinases (XK, also known as xylulokinase; EC 2.7.1.17) from bacteria and eukaryota. They share high sequence similarity with Escherichia coli xylulokinase (EcXK), which catalyzes the rate-limiting step in the ATP-dependent phosphorylation of D-xylulose to produce D-xylulose 5-phosphate (X5P) and ADP. Some uncharacterized sequences are also included in this subfamily. EcXK exists as a dimer. Each monomer consists of two large domains separated by an open cleft that forms an active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The presence of Mg2+ or Mn2+ might be required for catalytic activity. Members of this subgroup belong to the FGGY family of carbohydrate kinases.	1.36909e-121
CP027022.1\|AVH97623.1\|5129085_5130378_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|128941	smart00701, PGRP, Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.	6.33559e-45
CP027022.1\|AVH97627.1\|5142382_5142898_+\|hypothetical-protein	gnl\|CDD\|372824	pfam13930, Endonuclea_NS_2, DNA/RNA non-specific endonuclease.	2.82956e-08
CP027022.1\|AVH97629.1\|5143809_5144454_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	6.6128e-24
CP027022.1\|AVH99803.1\|5131400_5140091_+\|sugar-binding-protein	gnl\|CDD\|271154	cd14488, CBM6-CBM35-CBM36_like_2, uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.	4.04683e-20
CP027022.1\|AVH99802.1\|5128094_5129009_+\|hypothetical-protein	gnl\|CDD\|226309	COG3786, COG3786, Uncharacterized protein conserved in bacteria [Function unknown].	7.93504e-24
CP027022.1\|AVH97615.1\|5114614_5115391_+\|sirohydrochlorin-chelatase	gnl\|CDD\|225049	COG2138, COG2138, Sirohydrochlorin ferrochelatase [Inorganic ion transport and metabolism].	9.20196e-24
CP027022.1\|AVH97614.1\|5113563_5114187_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.17918e-15
CP027022.1\|AVH97621.1\|5123351_5125085_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.58283e-166
CP027022.1\|AVH97617.1\|5116878_5118138_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|170080	PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional.	4.89116e-74
CP027022.1\|AVH97620.1\|5121423_5123352_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
CP027022.1\|AVH97625.1\|5140176_5140692_+\|hypothetical-protein	gnl\|CDD\|379650	pfam14568, SUKH_6, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	0.00043955
CP027022.1\|AVH97618.1\|5118167_5120060_+\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
CP027022.1\|AVH97626.1\|5140688_5141345_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	6.99252e-29
CP027022.1\|AVH97619.1\|5120113_5121199_+\|RNA-polymerase-subunit-sigma-70	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	2.12407e-166

>CP027022.1|AVH99801.1|5126769_5127081_-|hypothetical-protein
MRYKLTFVTGLALGYVIGTRAGREQYEKLKKSAKDISQNPAVRNAAESAAQTGRQVAGKAAHVVGDKVGDHLPPAVADKVHALRERGQSNGKVESEEWGTSNT
>CP027022.1|AVH97622.1|5125302_5126742_-|sugar-kinase
MGIVAGLDSSAEFTRIVVCDTDTGAVLRQGYAPHPGDPKAVDVDPQTWLLSLGEAATGGLLEGVEAIGVSAQQHGLVPLDAQGALVRPALMRNDKRAQVAAADLIDSLGGRQAWAEAVGSVPAAGQPVAKLRWLARTEPEQARRTALVLQPHDWLVWQLLGRPARRTTDRGAASATGYWSARTGAYRPDLVELALGHRAALPEVLGPSDAAGTTPEGLLISAGTGETMAAALGLGLGPGDAVVSLGASGSVMAVHHEALADPGGMITSFADATGMHLPVVSTSNAVRALRGTAEMLGLDSLDELSALALKSTPGASGLVLLPYLEGERTPNLPHAAGTLSGLRRESMKPEHLARAAFEGMLCALADALDVLRGRGVEVRRVFLLGPAAALHAVQALSPAIFGAQVVVPQPADYAALGAARQAAWALGVARGTLSPSAPPAWQGAATQVLEPADELAAGRAVRQQYTATREQIHPGAFGG
>CP027022.1|AVH97621.1|5123351_5125085_-|ABC-transporter-ATP-binding-protein
MLIRLLRTHLRPHRKPIALLVLLQFLQTCASLYLPTLNADIIDNGVVHGDTGYILRFGALMVGVSVVQIVCNVGAVYYGARTASALGRDVRGAVFDRVQSFSARELGHFGAPSLITRTTNDVQQVQMLVLMAFTLMVSAPIMCVGGIVMALGQDVPLSGVLLAVVPVLGVAVSLIVRRMRPLFRTMQTRLDTVNRVLREQITGNRVIRAFVKDGYEEERFRGANAELTDVSMATGRLMALMFPTVMTVVNVSSVAVVWFGAHRIDGGGMEIGALTAFLAYLMQIVMAVMMATFMFMMVPRAEVCAERIEEVLATESSVVPPAEPVTALDRRGHLEVRGAEFRYPGAEEPVLKDVGLVARPGETTAIIGSTGSGKSTLLGLVPRLFDATGGEVLVDGVDVRALDPALMARTVGLVPQKPYLFSGTVATNLRYGKPDATDEELWHALEVAQAADFVRKLEHGLDAPIAQGGTNVSGGQRQRLAIARTLVQRPEIYLFDDSFSALDYETDALLRAALAEETADSTVVIVAQRVSTIRDADRIVVLDEGRVVGTGRHHELMADNETYREIVLSQLTEAEAA
>CP027022.1|AVH97620.1|5121423_5123352_-|ABC-transporter-ATP-binding-protein
MAGPGGRMMAGGGPDQRSMDFKGSGKRLLRQLAPERGALWVMLIACVLSVAASVIGPKILGRATDLIFAGVVGRQTEPGATKAETLAGLRADGQDGMADMLSGVDFTPGQGIDFSAVGRVLLLVLAVYVAAGLLMLVATRLSITVINRTVYRMREDVQTKLARLPLSYFDKAKRGEVLSRATNDIDNVSQTLQQSMGQLINSLLTIVGVLAMMFWISPLLALVALVTVPVSVVVAARIGKRSQPHFVQQWRSTGTLNAHIEEMYTGHALVKVFGRQEESAKDFREQNEALYEAGFKAQFNSGVMQPVMFFISNINYVLVAVVGGLRVASGTLSIGDVQAFIQYSRQFSMPLTQVASMANLVQSGVASAERVFELLDAEEQEPDAPTDEKPLESRGRVALEHVSFRYEEDKPLIEDLSLTVEPGQTVAIVGPTGAGKTTLVNLLMRFYEVTGGRITLDGVDVARMSRERLRSGIGMVLQDTWLFGGTIADNIAYGATRPVTRAEIEEAARAAHADRFVRTLPDGYDTVLDDEGSGVSAGEKQLITIARAFLSDPVILVLDEATSSVDTRTEVLIQKAMARLAHGRTSFVIAHRLSTIRDADVILVMENGSIVEQGTHEDLLSSGGAYSRLYAAQFAQAVAEVD
>CP027022.1|AVH97619.1|5120113_5121199_+|RNA-polymerase-subunit-sigma-70
MCRTPHWMTVPFRSSWRSPAVQTQTVPQDRTESDENVEDAEEPAVVPAQRRRPDPGGNGPSSDLFRQYLREIGRIPLLTAEEEVELARRVEAGLFAEEKLANTPDLDTRLAGDLDRLVVLGRIAKRRLIEANLRLVVSVAKRYVGRGLTMLDLVQEGNLGLIRAVEKFDYARGYKFSTYATWWIRQAMSRALADQARTIRVPVHVVELINRVVRVQRRMLQERGYEPTPEEVAAQLDLPPERIGEVLRLAQEPVSLHTPVGEEEDVALGDLIEDGDATSPVESAAFLLLRRHLEDVLSTLGERERKVVQLRYGLDDGRPRTLEEIGQLFGVTRERIRQIESKTLGKLRDHAYADQLRGYLD
>CP027022.1|AVH97618.1|5118167_5120060_+|DNA-primase
MAGRINDDDVKAVRDAVPIDAVVSEYLQLRNAGGGNLKGLCPFHDEKSPSFQVSPSKGLFHCFGCQEGGDTIAFVMKIDHLSFSETVERLAAKAGITLRYEEGGYNPGHQRGERIRLIEAHQVAARYYADQLGSAEAEIGRKFLAERGFDQAAAEHFGVGYSPAGWDHLTRFLRGKGFSDKELILSGLSQDGRRGPIDRFRGRLMWPIKDVGGEIVGFGARKLRDDDNGPKYLNTPETPIYKKSQVLYGIDLAKKEIAKSSRAVVVEGYTDVMACHLAGVTTAIATCGTAFGGDHVKILRRLLMDNGSARVIFTFDGDAAGQKAALRAFEDDQKFAAETYIAVAPEGMDPCDLRLAKGDEAVADLVEPRTPLFEFALRQIVRRYDLETPAGRAAALDEAAPIVAKLKNLAVRHGVAVQLAGMLGIMDERFVVQRVSQIAHWQRDRGGRGRTDDHRPRRETPPIQAPVAPPGPALNLRSPAHRTERELLKLALQRPELVSPAFDAYGVDEFTAPPYAAVRQCVQDAGGATGAPADYLDAVRAAAPNDTVRALVTELAVETIFAKTVDEAYAGDQLVTVRLRAVDRRLREVQGALARLGPNGDPEKTAAVQNELWVLTQYGQSLRNNGAAAL
>CP027022.1|AVH97617.1|5116878_5118138_+|FAD-dependent-oxidoreductase
MVDADQTFVIVGGGLAGAKAAETLRAEGFNGRVILIGDERDHPYERPPLSKGYLTGAKERDSTLVHEPAWYAANDVELHLGQPVTAVDREARTVRLGDGTVIRYDKLLLATGSEPRRLDVPGTDLTGVHHLRRLAHADRLRQVLAGLGRDNGHLVIAGGGWIGLEVAAAARGYGAEVTVVEADPTPLHRVLGPELGQLFADLHSDHGVRFHFGARLTEIVGQDGLVLAVRTDDGEEHPAHAVLAAIGAAPRTALAENSGLALVDRADGGGVAVDESLRTSDPDVFAAGDVAAAHHPLLRTRLRVEHWANALNGGPAAARAMLGKPVSYDRVPYFFTDQYDLGMEYSGWAPPGSYDQVVVRGDTGKREFIAFWLKEGRVLAGMNVNVWDVTEPIQNLIRARTPVDPEALADPSVPLDGLI
>CP027022.1|AVH97616.1|5115427_5116750_+|deoxyguanosinetriphosphate-triphosphohydrolase
MEGIKDTKDSTDTPDIPGYDPAATERWDPEPDKQPGRTAFQRDRARVLHSAALRRLAGKTQVVTPGTRSHAWDASPRTRLTHSLECAQVGRELGAALGCDPDLVEAACLSHDMGHPPFGHNGEQALNDVAKDCGGFEGNAQSLRLLTRIEPKRFVKDADGELVSVGLNLTRAALDAATKYPWGRGGHPQDPGSPKFGVYEDDLPVFEWIRQGAPAHRKCFEAQVMDWSDDVAYSVHDFEDGLHAGHIDPNLLLAEPERADIWQVAIGRYVPEDTDPQELAEALDRLVDQEWWPHGYDGSAVAQARLKDATSQLIGRFCLAAEGATRQAYGSGRLTRYGAELVVPRETRNECAVLKAVAVRYVMQRAEQEALRADQRIVVAELAEALVNRAPDGLEPQFRAAYDKAPDDRARKRVVVDQIASLTDASARALHARFHHPRVR
>CP027022.1|AVH97615.1|5114614_5115391_+|sirohydrochlorin-chelatase
MHHRPAPAAARRPATLVAVGHGSRDPRARATLLRLLDRVRELRPGLDVRLAHIELNAPLLDETLAGLAAEGREAVLVPLLFAPGHHVTHDLPAAVAAVPGLRARVAAPLGAHPLLAEALADRLAEAGWTPGEDDRRTTGVVLAAAGSRDPRSGAETRRIAALLGERLGVPVVPAYASAAAPTVPEAVAALAARGRHRIAVASCFTAPGLFATRAAAHAPWIAAAPLGAHPALARLVLHRHDRALAAPAVVHGRELAAV
>CP027022.1|AVH97614.1|5113563_5114187_+|GNAT-family-N-acetyltransferase
MVEKIFRDSERKKGGGEGCGVRTIRTVKATKTDDRDDPTDRDALADRAGHADRPDRPDLVLRRAVGSDAAEAAEVWLRSYAAALPGVRRAHTDDEVGYWFRELLVPHRETWVATAGDATVAVMVLDGGELDQLYVDPPWRGRGVGDRLVDLAKRRSPAGLELWTFQVNAPARRFYERHGFVAAEHTDGSRNEEREPDVRYVWLPEPS
>CP027022.1|AVH99802.1|5128094_5129009_+|hypothetical-protein
MTLVSACGGEKEPAGSAASVAPGAAPGGYETESGSASASPSVSVSPSVSASASPSTPPSASASPSVSPSASRSASAKPSGSAAPRAKPTSGTAGGGTGEQTSAPAVAPDFPVPVNVGNATQVITVEAAGSYATVTAWQKGSTGWKAQFSTSAGRVGSNGVVDGSTRRQNTYTTPSGTYTITEGFGVQSGGTAMPYTKVDDRHWWVQDPESKFYNQMRTAEGADFPLTESGERGSEHLIDHSTQYAKALVIDFNRWPAVPGRGAGIFLHVNGSGATAGCVSVPRATMDRIMGWVEPSANPRIAIG
>CP027022.1|AVH97623.1|5129085_5130378_-|N-acetylmuramoyl-L-alanine-amidase
MSPRGARARRANGKKYATWLAAGVVVLGGTAVTAVAASAGGEGAGPGDGTRSAKAHALALDGKDPKRRALPRTGTPTFSLVGVSWEDSGDTFEGTAQIRTREAATGEWSEWHDLDFDIRAPESTEGEEPEVRGASEPLWVGPSDGVEARVVADGEETAVPEALRLDMIDPGETVKGKGNGKDNGGTQGGGKGDAEPPTSGAPTGPAPGAVPAQEPTGPAATTIPTAPTAPAVVSRAGWGADESLVQDPPSYLNEVDAVFVHHTAGTNDYTCADSPAVIRAILTYHVRTNGWNDVGYNFFVDKCGTVFEGRAGGVDRPVLGAHTYGFNSYSSGVSLLGDYENGGTPTAAARQAIADLAAWKLGLHGVDPEAEVALTAAADTGVWKKGQVATLNTISGHRDGYATLCPGATLYSALPGIRTTAGASPYAIGN
>CP027022.1|AVH97624.1|5130623_5131100_-|hypothetical-protein
MPSSEIAENAAPQESEHADTEGSPDRRGLLVAGIVLLACLGLVGYGMLDTEEPPKPRAVPTAEVTYEVTGTGTAEISYLARSEDGTATVEKGVTLPWKKSVRAPLGKAPAVAVVLDGKGGQAACALAIRGKHVQRATATGEYGRATCTGELLSGDGEG
>CP027022.1|AVH99803.1|5131400_5140091_+|sugar-binding-protein
MPKGIVVKVPHRRFLSCLVVSAVAGTLLPQAAHAAPASPSSGDDTGVFDTIAGWFQDDEKGEAKPPVGGALEIPSREKLPKGEKLPKAQRVKELTAKRTSQARYWQLSDGRIEAELTAVPTSYRSGTSWKPVETTVRATGDKGFDFANTTNTGKSWFGSDADGFMRFEAEGGGAVTLGLAGAGALKPEAKGDQVLYKDAVAGADLSYRVGNGQVKEDIVLAERPAGPVSFTFTLDTEGGLTPKAREDGSVAFFGEAPGTPVMVIPAPYMTDARKDPRSVTGGTYSTAVTQKLSRDADGKGWRLTLTPDAKWLAAKERQYPVVIDPTITITPIASVSEDTMVLSDQPGVNFNNTWKLSVGKTDTGIARSLIKFPLNEIPAGVKVDAARLSLYYDQSHTTNGNTVALEAHRATGAWNEAGATWTNTSALVGELSGTTVQLDDGDAGTAAVGEWPRGTTTGGAATNDDYAYNKNALTGESYAWQPRVPETDTYRVDVHHPAASDAATAAPYTVTHNGGTKNYTVDQTGTGGVWKTLDAAELSFAKGTAGKIVLGDTGSSTTRALADSVRLVNPAAITKAAWDYNKWHDFPVADTVQKWVSGTAANHGFVLKAKDETATAPTGGPRYEAADGNAYGGETSTYPRLTVTYGAVGTSLNSPTVVHSTGPELSWPAYTNGSGDTGLDIVEYQLHRSTQQAFTPSAATLIAPIPTGTTAYTDTTAVPTPDSSSAEIGKSYYYQLAVKTKNGQLLGSPTRIVGIPKAGRTMRIIQAGQVDTTLSSQQPTVNHDGLVSGKAQTWLSVGNNSGTYGKTRAALKFPTTSIPTTATVLENKMYMWGAETTSTTNGAIYELHSLTRDFTETQATWNNANSTAPWTTAGGDFSAAVSDTVPQITDEVGRHWWDATGLMQSWAKTPTTNKGVLVKLKDETTTGPQERTLFLSAEASDPQLRPYMQVIYVDATTEDTYYAPTTPSRMTPNSQYTVEFTVTNTTATAWAAGERQLSYTWKLPDGTDVTTGGNQLSTAIPALLPGKSATIQAQVKTPINSDNGNKRNEYVLGWDVRKIADGTWLSAGTGGIPSLKQNIAVEDPTSNTLGMEKFYAYTGKNTGAGSNFMNNLASGNGVWQYNAITNPGRGLSTFARFAYNSQDTSDTVAGHGWSFQLSGPVRLGAPLDFHPNPNPTEIRLPDGDGTTHVFRKQADGTWKAPAGVHYKATMKAGLDCKPTKDPVPDAWTLTRPDGTRFLFGCDGYLTSTVDKNGNTQTFTYEERKSNNKPTKFLKYINDPAGRQTLTVDYWTKGQSGYQYVNDSGVLTTDAGALNNSKIYDHIRSVTDVSGRKIEFHYTAKGLLGQLTDGVGSTQPKVFKFTYDATQGNKNVKLVKATDPRGNSTQFAYYAPQAGDDPKYHWWTKTITDRLGFLTGFAYKTNTANPEFTDTKVTDAEAHATDYVTDDFGRPVQTTNAKSQVAKMSWDADNNVTYAEEANGAKSAYCYDQKTGYPLWSRDAENNKGGVPPSSDCAPGTYPANSQQYSYQTRLDGFSADLLTKTSPEGRKWQFGYDSFGNLKTVTDPKGVATTTAGDYTTTYEYDAYGQLTKAIDANGNPTTNSEFGPTGYPATITDALGKASSFVYDERGQVRETVDALGKKTTQTYDTFGRPLTKVVPKDQAAGDLITLSAPEYDANDNVTKATAPNGAVSTAVFDAADQIASDTVPKDTATSAERKTVYTYDKVGNLRTKTEPKGVLTTGDATDHVITNTFDEIYQLTSVVNSAQQKISYEYDNVGNVVRIVDPKRNATADTTDYLSRTAYDLNHRVTTVTDPVGKSVTTTYDKDSLVIQTKDAEGNITYVDYDERGKQKEVRTPYEGTTFRKTQYEYDQAGNTTKVVSPRGAATATADDFTSRTEYDALNRPVKQYQPYDPADSRYNDPNVYTQTVYDAVGRVTKRSMPPSEGQTVRNDTVIEYFDNGWTRRSTDPWDITTTYDYTELGQQKARTLTSAGGSSDRTMTWSYYPDGKLKSKADDGVPVGKSVVLVDNSDSQHTSATGTWAKGDITGQQGYDHRTHAAGTGTDAFTWTLNVPKDGTYTAYVKYPKVTGAVTTARYTLSQGATTHPAVTKDQNAATGTWVQLGSYTLKQGNDAKLKLEQNSGGIVVADGVKLVRDTSGETDSEKKSFAYAYDVNGNLTSIDDTSSGAEVDAYTMVYSGLNQVAKVTEALAGTEKKSTSYTYDANGKPETVTHPDQFSKYTYDLRDLVRTTSVGKSSTDASPKVTSYTYTDRGLKLQETKNNKNTVDYTYYLDGAVKTSVEKKPNGTLVSSHTYAYDPNGNKAQDVAKKMNADSTSAYLESTTDYTYDPANRLAKSVKTGNGAGTETYVHDDNANVVSQTVKGTSTTYTYDRNRLVSATAGGSAATYNYDPFGRQESVTGGGQVIERSVYDGFDHVVESQKRDDAGSLKSTTYTFDPLDRTASKTADGKTTDFTYLGLSSEVLSEEVVGELTKSYQYSPWGERLSQVKHNTDGTGEDGYYGYNSHTDVETLTDKDGNAKATYGYTAYGSNDESEFTGIDKPDAGDPTKETYNPYRYNSKRWDSHAGTYDMGFRDYNPGLNRFTSRDMYNGALADMGLGSDPYTGNRYAFTSGNPTSFVELDGHIFGCDWCGDILDTMENVATAGVKKAGGGWKTVADTFLTGIGWYNETAPNGYESEYTGNRSKGRLVEPDGQWDWVGGDTLFPFQQEYCEDDESVVFYQALDKYDRAQGARACLNSGDFGWESGADKAVKGNPGSMIQGTQVPRPMRNFPETVTPGFKPGDDMNRGHLLGNQLGGSGTEMRNLVSLYATPNQTVMAPYENQVAAMVAKGQTVYYEVTANYTGKNAIPDSLTIKWLNLDTGEMPRDPITIWNTPSGLKP
>CP027022.1|AVH97625.1|5140176_5140692_+|hypothetical-protein
MWVQRLLEFTGWEPSAHSVDWAAAEEELRIPLPTDFKQLCEVFGGGTFSDSIAFYGRTAGFRFNFVLPWQAPLPPLPAEIGQYQKYTPGGKGYIKWASSEWGTEYCWLVDAQQPGTYPVLARGEAGEWREYDMSTSEFLYRVLADKDFQPFGIAQYGLDPTFQPGPEADGR
>CP027022.1|AVH97626.1|5140688_5141345_+|signal-peptidase-I
MRRVSTQQQSAGRGLRIAAWVLVPLGLVLVLGAVGGIVRGGGLEGERITVGGDAMRPTYSPGERLTVLRVGEGEIRRGDVVLVGVPGRYGNAPVLQRVIGLGGDRVESRDGVRVAVNGKRIDEPYVMRDPLGSAGAPYDVTVPEGRLFLLGDNRPVANDSRSFLDEQSGSVAASDVRGRVRAEGAVPLALWALAAFGALLALVGIGSGVRGYTTRRRP
>CP027022.1|AVH97627.1|5142382_5142898_+|hypothetical-protein
MTSCLTKDYVDSHPGSETDTRVFTPPGYRWAQRTAGFLGARPIRENINACHLLADRLTGSGTDPRNLAACARGADAKQLGSRQGDDDMAKHETDIAAAAQAGQDVYYSVTPRYSGRRTVPTGFAIHAQGTNLDGSAGISISTFIPNPLAGRNLGMFNDPATGRQVPTGSMG
>CP027022.1|AVH97628.1|5142928_5143543_+|hypothetical-protein
MTDLETLRRLMPPKAAPDTSVDWARMSESWGTEFPPDYRVFMEVWGPGAIDNFFQVQVPEPKTEELSSPYGGMLVETLTAEDVWVSFKKEPELEGARPRLIAWGSDAAADIVCWDASGDDPSAWPVLVYHRGKGIWQRHDCGMVEFLVRVLRAEFPANPLSDLSLWGRHPALFLSESEEERLLEQGLDPWAVPRARTPRRSRVQ
>CP027022.1|AVH97629.1|5143809_5144454_+|signal-peptidase-I
MTGRTRLRRVGRTVGVVGLAAAVGSIALLGTGYTAVAVQGDAMNPTYPQGARAFFERIDPVEVGRGDVVLHRMEDGHESRPALRRVIGIGGDHVRQSPGGPVTVNGEPLSEPYVKDGDPSGTTLAYDVTVPEGRLFLLGDHRANSNDSRFSLDTRSGSVAATTVQARALDDHTGLLLLVLTALLGVLGALAGLVAEIVGRVGRVSPPPPRHHAL
>CP027022.1|AVH97630.1|5144560_5145034_+|hypothetical-protein
MDSGEQTPRATGMRRCAAEFADGVTARTRLPLDYGVASLGVVDRIIDGLRRGGARRQDVDGPLLGLGAYVGEVLVRQAGAEWVDLAPGHPLRPVFGHPVAVRMPDGRLWNPLGRTVNRFEIGPQESLRTYFLTLHGRRPVRPVRRDCPSDGRATSLC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_16

5578094-5578181

Orphan

Consensus_repeat	Method
CACGCGCCTCCTCCCGGGAGGGCAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_16

>merge|CP027022|16|5578094-5578181|CRISPRCasFinder
CACGCGCCTCCTCCCGGGAGGGCAGGGGACCCATGAGGCGGGCCACTTCGACGGCGAACGACACGCGCCCCCTCCCGGGAGGGCAGGG

>CP027022|16|15|5578094-5578181|CRISPRCasFinder
CACGCGCCTCCTCCCGGGAGGGCAGGG	GACCCATGAGGCGGGCCACTTCGACGGCGAACGA
CACGCGCCCCCTCCCGGGAGGGCAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH97985.1\|5584089_5585475_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|99743
CP027022.1\|AVH97975.1\|5565847_5570410_+\|glutamate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236968
CP027022.1\|AVH97979.1\|5574621_5576100_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|170047
CP027022.1\|AVH99847.1\|5581090_5581375_+\|chorismate-mutase	unknown	unknown	gnl\|CDD\|181719
CP027022.1\|AVH97972.1\|5561692_5563063_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377122
CP027022.1\|AVH97984.1\|5581472_5583959_+\|aminopeptidase-N	unknown	unknown	gnl\|CDD\|274121
CP027022.1\|AVH97981.1\|5577222_5578005_+\|serine-protease	unknown	unknown	gnl\|CDD\|238113
CP027022.1\|AVH97977.1\|5572093_5572498_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH97988.1\|5589046_5590474_+\|pyruvate-kinase	unknown	unknown	gnl\|CDD\|180487
CP027022.1\|AVH97973.1\|5563425_5564421_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377122
CP027022.1\|AVH97982.1\|5578182_5579943_-\|beta-galactosidase	unknown	unknown	gnl\|CDD\|366567
CP027022.1\|AVH97987.1\|5586966_5588775_-\|bifunctional-metallophosphatase/5'-nucleotidase	unknown	unknown	gnl\|CDD\|236506
CP027022.1\|AVH97986.1\|5585471_5586953_+\|lysine-6-monooxygenase	unknown	unknown	gnl\|CDD\|226017
CP027022.1\|AVH97983.1\|5580086_5580974_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
CP027022.1\|AVH97974.1\|5564678_5565407_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153124
CP027022.1\|AVH97978.1\|5572827_5574504_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223587
CP027022.1\|AVH97990.1\|5591289_5592063_-\|transcriptional-regulator	unknown	unknown	unknown
CP027022.1\|AVH97989.1\|5590523_5591285_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	unknown	unknown	gnl\|CDD\|379346
CP027022.1\|AVH97976.1\|5570402_5571863_+\|glutamate-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|237213
CP027022.1\|AVH97980.1\|5576174_5577059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371473

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH97985.1\|5584089_5585475_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|99743	cd06450, DOPA_deC_like, DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine.	2.15904e-70
CP027022.1\|AVH97975.1\|5565847_5570410_+\|glutamate-synthase-large-subunit	gnl\|CDD\|236968	PRK11750, gltB, glutamate synthase subunit alpha; Provisional.	0
CP027022.1\|AVH97979.1\|5574621_5576100_-\|hypothetical-protein	gnl\|CDD\|170047	PRK09687, PRK09687, putative lyase; Provisional.	2.48298e-23
CP027022.1\|AVH99847.1\|5581090_5581375_+\|chorismate-mutase	gnl\|CDD\|181719	PRK09239, PRK09239, chorismate mutase; Provisional.	2.48288e-52
CP027022.1\|AVH97972.1\|5561692_5563063_-\|hypothetical-protein	gnl\|CDD\|377122	pfam03747, ADP_ribosyl_GH, ADP-ribosylglycohydrolase. This family includes enzymes that ADP-ribosylations, for example ADP-ribosylarginine hydrolase EC:3.2.2.19 cleaves ADP-ribose-L-arginine. The family also includes dinitrogenase reductase activating glycohydrolase. Most surprisingly the family also includes jellyfish crystallins, these proteins appear to have lost the presumed active site residues.	4.36363e-24
CP027022.1\|AVH97984.1\|5581472_5583959_+\|aminopeptidase-N	gnl\|CDD\|274121	TIGR02412, Aminopeptidase_N, aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).	0
CP027022.1\|AVH97981.1\|5577222_5578005_+\|serine-protease	gnl\|CDD\|238113	cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.	1.53265e-75
CP027022.1\|AVH97988.1\|5589046_5590474_+\|pyruvate-kinase	gnl\|CDD\|180487	PRK06247, PRK06247, pyruvate kinase; Provisional.	0
CP027022.1\|AVH97973.1\|5563425_5564421_-\|hypothetical-protein	gnl\|CDD\|377122	pfam03747, ADP_ribosyl_GH, ADP-ribosylglycohydrolase. This family includes enzymes that ADP-ribosylations, for example ADP-ribosylarginine hydrolase EC:3.2.2.19 cleaves ADP-ribose-L-arginine. The family also includes dinitrogenase reductase activating glycohydrolase. Most surprisingly the family also includes jellyfish crystallins, these proteins appear to have lost the presumed active site residues.	5.7474e-48
CP027022.1\|AVH97982.1\|5578182_5579943_-\|beta-galactosidase	gnl\|CDD\|366567	pfam01301, Glyco_hydro_35, Glycosyl hydrolases family 35.	3.75864e-133
CP027022.1\|AVH97987.1\|5586966_5588775_-\|bifunctional-metallophosphatase/5'-nucleotidase	gnl\|CDD\|236506	PRK09420, cpdB, bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.	4.16592e-130
CP027022.1\|AVH97986.1\|5585471_5586953_+\|lysine-6-monooxygenase	gnl\|CDD\|226017	COG3486, IucD, Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism].	7.51034e-159
CP027022.1\|AVH97983.1\|5580086_5580974_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.33592e-23
CP027022.1\|AVH97974.1\|5564678_5565407_+\|hypothetical-protein	gnl\|CDD\|153124	cd02433, Nodulin-21_like_2, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_2: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	2.64307e-88
CP027022.1\|AVH97978.1\|5572827_5574504_+\|ATP-dependent-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	2.9656e-122
CP027022.1\|AVH97989.1\|5590523_5591285_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	gnl\|CDD\|379346	pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase. This domain includes the enzyme Phosphoenolpyruvate phosphomutase (EC:5.4.2.9). This protein has been characterized as catalyzing the formation of a carbon-phosphorus bond by converting phosphoenolpyruvate (PEP) to phosphonopyruvate (P-Pyr). This enzyme has a TIM barrel fold.	1.27299e-73
CP027022.1\|AVH97976.1\|5570402_5571863_+\|glutamate-synthase-subunit-beta	gnl\|CDD\|237213	PRK12810, gltD, glutamate synthase subunit beta; Reviewed.	0
CP027022.1\|AVH97980.1\|5576174_5577059_-\|hypothetical-protein	gnl\|CDD\|371473	pfam11331, zinc_ribbon_12, Probable zinc-ribbon domain. This eukaryotic family of proteins has no known function.	0.000441033

>CP027022.1|AVH97981.1|5577222_5578005_+|serine-protease
MKKNRVVRALQKLAAAGAVVLAAVSLQPTTASAAPAPVVGGTRAAQGEFPWMVRLSMGCGGSLISPQVVLTAAHCVNGSGNNTSITATAGVVDLQSSSAIKVRSTKVLQAPGYNGKGKDWALIKLATPITSLPTLKLAETTAYNSGTFTVAGWGAAREGGAQQRYLLKANVPFVSDASCRASYGNDLVPSEEICAGYAQGGTDTCQGDSGGPMFRKDNAGAWVQVGIVSWGQGCARPNYPGVYTEVSTFAAAIKSAAATL
>CP027022.1|AVH97980.1|5576174_5577059_-|hypothetical-protein
MPHRHEADRVVHGFPHRAVVEASLTALHRRLSPDGVRAWPTSVTADDVALGDGEDLHLGTQRVARALVRHLRLPEARIVVTFRRMEHAGTVELAPGPEYFVEVHERFRTRRRDVGAVLAHEITHVLLHRLDLRFPRTAENEILTDVAAAYLGAGWLLLDAYREDGVEHQKLGYLTPEEFGYVLAKRAEVFGEDPSPWFTSQVAYDAWVRGRAEAARERTAPPLAGAGRIERGRYVWERRRGRAGEDAPYAFDGGAPATRVSFSCPVCRQRLRIPAGRTLRVRCGTCGTVLECAA
>CP027022.1|AVH97979.1|5574621_5576100_-|hypothetical-protein
MSTLFDAILHGDEDGAVRALREGADPEGREDGETALYRAAVGGEAGIVRVLLAAGADPGRGSGEEDGDLPLCGAACVGHTETVRALLAAGAAADQEEGYGFTALTWALRLGYADVARLLLEHGADPDRRGPDGLAPLLAAARRGSTGCVRALLDHGAGGREAALREARRWIGADIAAELRRGLVAGNEGGQTYEAVVRRVREDGGITVVVELLREDGAPGRGNDRQTGHAAIATLLEASLGVRTPVEELAARALRCGDPALDDWTTAVAELAGRADEETFVAAAGWCAYRDPLRRALGARVLGALPGFAQSAVPVLRRLAAEPAGAAGTAREPLLSVVTALGECGDPAAVPELLAAAGHPDAVVRGAVAGALAGIVPAGHVEALGVLLALSRDGDARVRDWATLALAELPDDTPLVREGLAERLADPDPETAAEAARGLAIRQDPRAVDALASVLGDGEADGAARETALAALEHVRDPRVRTRLEWTAPRRT
>CP027022.1|AVH97978.1|5572827_5574504_+|ATP-dependent-helicase
MTRSERPHKRGPRTAQAKSTSQPKASRGGRRPAAPPPPSEFTPPVSVTPALPPVASFADLDMPEGLLRTLGEQGVTEPFPIQAATLPNSLAGRDVLGRGRTGSGKTLAFGLALLARTAGRRAEPTAPLALVLVPTRELAQQVTDALTPYAGALRLRITTVVGGMSITRQSSSLRRGAEVLIATPGRLADLIDRGDCRLDQVAVTVLDEADQMADMGFLPQVTKLLKQVEPGGQRLLFSATLDRNIDRLVKMFLDDPVVHSVDPSAGAVTTMEHHVLYVADETDKKAVTLRIAARDGRTILFLDTKRSVDRLVKRLLANGVRASGLHGGRSQPQRNRTLDQFKNGQVTTLVATNVAARGIHVDDLDMVVNVDPPMDHKDYLHRGGRTARAGESGSVFTLVLPDQKRDMGRLMSNAGISPRTAQIKSSDEELAELTGAREPSGVPVVIETPQPTPPRKPAGSGAGAGNGGGRRRRRPAGSAPVGASTGSTRGSASGTGTGGGRGSGTGGGRAAGTGRGAGTGRAAASTSASASAGGGRGGRRTAGTGRPRAPRQRPADNT
>CP027022.1|AVH97977.1|5572093_5572498_-|hypothetical-protein
MAHLTVSGRAVAAPGRPGGALRGQAVASRSARLRSTQNSLPSGSARVAQPVPSGFRRSSRRAAPSPISRSTSSSRVRSCGWRSRWTRFFAAFGSGTWMKRREAPGDSTSASSSPGSSSSETLEPRTCAQKEARE
>CP027022.1|AVH97976.1|5570402_5571863_+|glutamate-synthase-subunit-beta
MADPKGFLTTGREVAETRPVAERVRDWNEVYVPGSLLPIISKQAGRCMDCGIPFCHNGCPLGNLIPEWNDYAYREDWSAAQERLHATNNFPEFTGRLCPAPCESACVLGINQPAVTIKNVEVSIIDKAWDGGDVKPQVPERLSGKTAAVIGSGPAGLAAAQQLTRAGHTVVVYERADRIGGLLRYGIPEFKMEKRHINRRIEQMRAEGTKFRTGVEVGRDITATDLRKRFDAVVIAAGATTARDLPVPGRELNGIHQAMEYLPLANKVVEGDFVAPPITAEGKHVVVIGGGDTGADCVGTAHRQGAASVTQLEIMPRPGEERNPGQPWPTFPMLYKVTSAHEEGGERVYSVSTTHFEGDEDGNVQFLHLVEVEFVDGKLTQKPGTERKIPAQLVTLAMGFTGTDVQNGLVSQFGLELDERGNIARDADFATNVDGVFVAGDAGRGQSLIVWAIAEGRSAARGVDRHLTGASSLPAPIRPTDRALTV
>CP027022.1|AVH97975.1|5565847_5570410_+|glutamate-synthase-large-subunit
MRSDAWSPMDGRPAPQGMYDPRNEHDACGVGFVATLTGVASHALVEQALTVLRNLEHRGATGAEADSGDGAGILLQVPDAFLREVAGFELPEAGAYAVGIAFLPEDGIDATVAKIEGIAAEEGLNVLGWREVPVAPELLGASARSTMPVFRQLFVADGQNTGIALDRKAFVLRKRAEREAATYFPSLSARTLVYKGMLTTGQLEPFFPDLSDRRCATAVALVHSRFSTNTFPSWPLAHPYRFVAHNGEINTVKGNRNWMTAREAQLASDTFGDGSLDRIFPICTPDASDSASFDEVLELLHLGGRSLPHAVLMMVPEAWENHESMDPARRAFYQYHSTMMEPWDGPACVTFTDGVQVGAVLDRNGLRPGRYWVTDDGLVVLSSEVGVLDIDPAKVVRKGRLQPGRMFLVDTAEHRIVEDDEIKAALAAEHPYAEWLETGEIELSDLPEREHVVHTHASVTRRQQTFGYTEEELRVILAPMARTGGEPLGSMGTDSPIAALSARPRLLFDYFTQLFAQVTNPPLDAIREELVTSLRSSLGPQGNLLEPTAVSCRSVTLPFPVIDNDELAKLVHINADGDMPGMKAATLSGLYRVSGGGDALAARIEEICAEADTAIEGGARLIVLSDRHSDAEHAPIPSLLLTAAVHHHLIRTKQRTKVGLLIEAGDVREVHHVALLIGYGAAAVNPYLAMESVEDLVRAGTFIEGLEPEQAIRNLIYALGKGVLKVMSKMGISTVASYRGAQVFEAVGLDDEFVATYFNGTATKIGGAGLDVVAQEVAARHAKAYPASGVPSAHRALEIGGEYQWRREGEPHLFDPETVFRLQHATRNKRYDIFKKYTDRVNEQSERLMTLRGLFGFATEGRTPISLDEVEPASEIVKRFSTGAMSYGSISKEAHETLAIAMNQLGGKSNTGEGGEDPERLYDPARRSSIKQVASGRFGVTSEYLVNADDIQIKMAQGAKPGEGGQLPGHKVYPWVAKTRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPVARIHVKLVSEVGVGTVAAGVSKAHADVVLISGHDGGTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIVVQTDGQLKTGRDVVIAALLGAEEFGFATAPLVVSGCVMMRVCHLDTCPVGIATQNPVLRDRFSGKAEYVVNFFEFIAEEVRELLAELGFRTLEEAVGHAELLDTSRAVTHWKAQGLDLEPLFHVPDLPEGAVRHALVEQDHGLEKALDNQLIELAAEALNAPSAEEAQPVRAQVAIRNINRTVGTMLGHQVTKKFGGAGLPADTIDITFTGSAGQSFGAFLPSGVTLRLEGDANDYVGKGLSGGRVIVRPDRGADHLAEYSTIAGNTIAYGATGGELFLRGRTGERFCVRNSGALVVSEGVGDHGCEYMTGGTAVVLGETGRNFAAGMSGGVAYVIDLDRDNVNSGNLGAIEALSDTDAAWLHDVVRRHHEETGSTVAEKLLADWDAAAARFSKIIPTTYKAVLAAKDAAELAGLSEAETTEKMMEAATHG
>CP027022.1|AVH97974.1|5564678_5565407_+|hypothetical-protein
MSVIEAQAPLHEAHRDNHTHRDVNGGWLRPAVFGAMDGLVSNLALMTGVAGGAVSSGTVAVTGLAGLAAGAFSMAAGEYTSVASQRELVQAELDVERSQLRKHPVDEMEELAALYVSRGVEPALAREVAMQLSKDPEQALEIHAREELGIDPDDLPSPAVAAVSSFGSFALGALLPVLPYLLGATALWPAVLLALLGLFACGALVARVTARGWLFSGLRQLALGGAAAAVTYGLGMLFGAAL
>CP027022.1|AVH97973.1|5563425_5564421_-|hypothetical-protein
MVTTTACDTRERARGALLGLAVGDALGAPAENMRPSEIRRRWGRIEGFVTESPAGTDDTEYAVFSGLLLARHGSALTVRHVERAWHRWIADLDEGPFRGAGFSERGTLENLRRGLAAPISAQHRHAWSDGLAMRAAPFGVFAAGRPAEAARLVAIDGSVSHEGEGIYGGQAVAAGVAAAMAGASVTSVIAAALSVVPMDSWTARSLRRAVVAAQRVHPDPLVRERRVRSAVVIGGYPWTDLAPEAVGLAFGAFAAARGDFRTAVLTAVNMGRDADTTAAVAGALAGAVSGVRAVPAEWATAIAPVTGSCLPSMRGYHVLDVADLLTPEEAA
>CP027022.1|AVH97972.1|5561692_5563063_-|hypothetical-protein
MPGTDLLDAIHEDPAAPPVRHPHDRASTPTAQVTTPTAQVTAQVTASRDAIEGLLLGIAAGDAAGWPAARHRAARMPEWTRRLTRELDTFAEQNATTTLPVPIALNQPPEPLRLGPSDDAEWAVFTAEAILASTSPALAGLPPERRLRAAVDLAWNALAGQVAAAADRAPEVESAVLPLRARISVRAGLGNLATGLRPPATGHDNPHYFDDAACVRAAVLALVHPGDPRAAAELAEFDARYTQDGDGVHGARATAAAIAAALGGASAEEAVGAALAELPPATEIGRNARHAVELARTAESAFALVPLLEHRIVDHVYSYGVAAAETVPVALALALAARGGMTAAVPAAACLSRVADSAPALAGALTGALGGGRSVPASWREACRTLAGCALPRLAGTDLVELAGLLGATEPATPGGQFRHGTHTGRAQPGCTHTEHTEHAEHTQHTDRTGGRSHPG
>CP027022.1|AVH97982.1|5578182_5579943_-|beta-galactosidase
MSTFAVGDEDFLLDGRPVRLLSGALHYFRVHEGHWEHRLGMLRAMGLDCVETYVPWNLYEPEPGRYGDVAALGRFLDAVGRAGMRAIVRPGPYICAEWENGGLPHWLTGPLGRRVRTRDPEFLAPVEAWFRRLLPQVVDRQVDRGGPVVLVQVENEYGSYGSDGEYLEWLAGLLRECGVSVPLFTSDGPEDHMLTGGSVPGVLATANFGSGAREGFAALRRHQPSGPLMCMEFWCGWFDHWGTEHAVRDAADAAAALREILECGASVNVYMAHGGTNFGGWAGANRDGELHDGPLRPTVTSYDYDAPVDEAGRPTEKFWRFREVLAEYAEGPLPEVPEPPARLAAPVRAGFEGRAPLDAVLEVLGDGEVVAVVPPTFEELGVDRGLVRYRVAVPGPRQPYPLGVTGLRDRAVVYVDGVLAGALDTGGGEDVALAEPVAGPAVVDLWVESLGRVNYGPRLAEPKGITGGVRHERQYVHGVRARALRLDAFGTAAVGKVPFGPVAGHGGPGLCRAVLDVAGAGDAVLRLPGATRGFVWVNGFCLGRYWSAGPQEALFVPGPVLREGANEVWVLELEGEAGSGVVLDPV
>CP027022.1|AVH97983.1|5580086_5580974_+|AraC-family-transcriptional-regulator
MYHTWMRYFTPGPVHHRLGLVCLGVGLQHGTLPTVGPRTLDHHVAVVVSAGGGWYRGADGRRTAVTAPALIWLTPGTPHHYGADPGTGWDEAFVDFSGPAAATYTELGYIEPDRPVVPLSDAAPARAAITRIARAARPGNPLLEVETGAAVHELLVALRRARADTNADGDPVLTALARDAFQPLSVAEHAARHGMTPAELRTAVRRAAGCSPKDYLLTVRLGRAKELLAATELPVSAVARRVGYDDPAYFSRLFTRRVGTAPIRFREQQGRSVPGGWSNRVPDPEHPPTIPPRSV
>CP027022.1|AVH99847.1|5581090_5581375_+|chorismate-mutase
MRAELTRLRDSIDNIDAAVVHMLAERFKCTQQVGVLKAEHQLPPADPAREARQIARLRELAESAKLDPAFAEKLLNFIIAEVIRHHETIADGTR
>CP027022.1|AVH97984.1|5581472_5583959_+|aminopeptidase-N
MSVLTRDEAQTRAQLLDVHRYRVDLDLTTGDETFESTSTVRFTARAAGDTFVELKPATLHSATLDGAPLDPAALDGNRLPLSLTEGEHELRVTATMRYSRTGEGMHRFTDPTDGESYVYTQLFMEDVQRVFAAFDQPDLKAVFEVAVTAPDDWTVLANGITERQPDGTWKAAPTPLLSTYFVCVAAGPWHSVRTEHAGLPFGIHCRRSLAPHLDADADEILAVTKACYDRYHEKFDEPYPFDSYDQAFVPEFNAGAMENPGLVTFRDEFVFRSAVTVTERQTRAMVIAHEMAHMWFGDLVTLRWWDDIWLNESFAEYMGYQTVNEACSDLFPDTWIDFGVTRKAWGYEADQRPSTHPVAPDPEAVPDTASALLNFDGISYAKGASALRQLVTWLGEKDFLAGINIHFKRHKFGNATLADFIDNLAAATDRDVHGWAEQWLRTTGVDTLTPRLDGEGLHWNLTVDRAGTRPHRISVGVYDRDPSGDLVLREHRELDVPQDAPAALTGPRPALVVLNDGDLTYTKLRFDEVSAESALRGLSRVPDPLTRAVVWNALRDQVRDGDLAPADHLAVAGAHLAEETELALVQGVLAFARHQIADRYVPADQRPAALATISGIARALLRRTEDGEAPGLRLTAVRAFVDSATTPDKIASWLDEGTVHGGPELDPELRWRILARLAVLGATDEAAIAAELERDPSATGREGAARCRAALPDPEAKAAAWSALFDSDDLSNYLFTATAQGFWQPEQADLVSEYVPRFYEAAVALGDRRGPAMAEAAGRYAFPAYAVDADSLALGERHLADTPMIPALRRKLVDQLDDLRRALKVREG
>CP027022.1|AVH97985.1|5584089_5585475_+|aspartate-aminotransferase-family-protein
MRAAPPPLAGGAPGADALRPLLGAVLDALRAGAEERGGPLPAGGPEAVARRTAALGAVLPETGTGPDEALRTLVHALAAGAADPADPLCAAHLHTPPLALAAAADLAASALNPSMDSWDQAPAASALETGVTAALAAEVFPDAPRPDALVTTGGTESNQLALLLARERHTGEGPLRTVVGANAHHSFRRAAWLLGLPAPVVVPTPRGTLDPEALDAALTATPGPLLVAATAGTTDEGLVDPLPALADVCAAHRADLHADAAYGGPLLFSRTHRRLLDGLDRARTVTVDLHKLGWQPAAAGLLAVRDTADLTPLAHTADYLNADDDTDAGLPDLLGRSPRTTRRPDALKAAVTLRALGRTGLGALVDTCMDLAQDLADRIEKTPALDLRARPALTTVLFRPHDADDTAVAAIRRTLLTDGRAVLGRARADGRLWLKATLLNPHATPGDLDQLITLVEGSAHR
>CP027022.1|AVH97986.1|5585471_5586953_+|lysine-6-monooxygenase
MTGTTPEQDTDRPPHPRDTPAPDHPHGQRPDADRPHDLVGIGIGPFNLSLAALAHGVPGGLSTAFYEQRPAFHWHPGLLIDGATLQVPFLADLVTLADPASPWTFLNYLKSRERLFPFYFAEKFHIHRAEYDAYCRWASERLPGLHFGHQVDSVRWNPERRLFEVDYTQIDPDGEAEALGRSYTRNVVLGVGTAPYVPEPLRPLADAPGVPVVHSADYLTHRDTLLAAGHVTVIGSGQSGAEIFLDLLRARPAGAEGIHWLTRTEAFAPMEYSKLGLEHFTPDYTRYFHALPEQVRDDLVPRQWQLHKGIDDATITAIHDELYRRTLHGGWPDAVLTPGVRVRTAGRVATTRIELHLEHVQQSARTRLTTDAVVLATGYRERPLDRLLAGLDPYVRHDSAGRPRVDEHHRLVLDPSITGAVHVQNAERHTHGVGAPDLGLAAWRSATILNAITGKEPYPLPRRTAFTSFGLETREAPGIPAQGRKLTPLAQNI
>CP027022.1|AVH97987.1|5586966_5588775_-|bifunctional-metallophosphatase/5'-nucleotidase
MPLNRRTFLEGSVAVGAGAALTAGAVAPAEAHGPGHGHRPKPARRYSFTVMGTTDLHGNVFNWDYFTDKEFDDKAHNDVGLAKISTLVERVRKEKGRRNTLLIDAGDTIQGTQLSYYYAKVDPITARRGPVHPMAQAMNAIGYDAAALGNHEFNYGIPVLRKFEEQCDFPLLGANALDAKTLRPAFAPYSMHRLRTPCGRDVKVAVLGLTNPGIAIWDKANVGGKMVFPGLEEQAAKWVPKLRSMGADVVVVSAHSGSSGTSSYGDQLPYVENAAGLVAEQVPGIDAILVGHAHTEIPEYRVANEKTGKDVVLSEPLKWGQRLTLFDFDLVWEKGRWTVEKVGAQVLNSNTVEEDRKIVRLLSDEHRKVVAYVNQVIGTSTAAMTTADAPWKDEPIIDLINVVQAETVKAALAGGAYAGLPVLSQASCFSRTARIPAGQVTIKDAAGLYPFENTLEARLLTGAQLKDYLEFSARYYVRTPAGAPVDTAKLTNADGTPDYNYDAVSGLTYEIDIAKEAGARIVNLAFEGRPVDPAAKFVLAVNNYRASGGGAFPHVANAPQLWADSDEIRNTIIRWVQARGTVDPGQFASVDWRLTRDGVPVF
>CP027022.1|AVH97988.1|5589046_5590474_+|pyruvate-kinase
MRRAKIVCTLGPATETYDQIKALIEAGMDVARLNLSHGTYAEHEDRYQRVRKASDETGHSVGVLADLQGPKIRLGRFREGPVLLERGDEFTITVEPVEGDRHTCGTTYTGLADDVTTGERILVDDGRVTLEVTAVDGPRVRTRVIEGGMVSDHKGLNLPGVAVSVPALSDKDIEDLRWALRTGADVIALSFVRSARDIEDVHRVMDEEGRRLPVIAKIEKPQAVENIEEIVAAFDGIMVARGDLGVEMPLEQVPIVQKRAIKLAKRNAKPVIVATQMLDSMIDNSRPTRAEASDVANAVIDGTDAVMLSGETSVGRFPVETVRTMSRIVEAAEEDVLAKGLPPLTERNKPRTQGGAVARAAAEMGDFLGAKFLVAFTQSGDTVRRLSRYRSPIPLLAFTPDPATRSQLNLTWGVETFLGPHVDSTDAMVAQVDEELLRIGRCAKGDTVVITAGSPPGVAGSTNLVRVHHIGDPLT
>CP027022.1|AVH97989.1|5590523_5591285_+|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein
MDLRTVTERARRLEQLHADHKPLVLPTVWDVWSARTAADAGFPALTIGSHPLADSRGADDHEGQTFEDVLAAVRPIAAAVDVPVSVDLEAGYGQKPADLIAGLTEAGGVGLNIEDTVHSDGGRVRDTQEHAHYIADLRAAADDAGIPVWINGRTDLFLHADDPSAVLDQAIERLRAMERAGADSVYPVGIQDDDDLLTAVVAAVTVPVNSTAHPVKHDLARFRRLGVGRVTYGPLLQFALTDAMKDMLKPWAP
>CP027022.1|AVH97990.1|5591289_5592063_-|transcriptional-regulator
MYDLAARAHALALLDSGRSLNSVSKQTGISRAALRTWQTCPEPLRRMDGPCPRCRPLPGPPDDIAAYAYLLGLHLGDGCISDHPRGGHYLRIACADAWPGLIEACRSAVLAVQSTGSACVLQKQGCVMVTSYGRHWKCLFPQHGPGKKHERKIALEPWQQSIVDAHPWEFVRGLVHSDGCRITNWTTRVVNGERKRYEYPRYFFTNVSDDIRRLYTDTLDGLGVEWTHCSRGGRPYNVSVARRASVALMDPHVGSKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_17

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_17

5653646-5653742

Orphan

Consensus_repeat	Method
GCGACGGGCGAGATCATGGAGGACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_17

>merge|CP027022|17|5653646-5653742|CRISPRCasFinder
GCGACGGGCGAGATCATGGAGGACGACGTGGCTCCCGCCCCGGCGGCCTCCGCCGCCCCCGTCGTGAACACCGCGACGGGGGAGATCATGGAGGACG

>CP027022|17|16|5653646-5653742|CRISPRCasFinder
GCGACGGGCGAGATCATGGAGGACG	ACGTGGCTCCCGCCCCGGCGGCCTCCGCCGCCCCCGTCGTGAACACC
GCGACGGGGGAGATCATGGAGGACG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH98038.1\|5654717_5655743_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|211689
CP027022.1\|AVH98030.1\|5641951_5643232_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
CP027022.1\|AVH98033.1\|5644897_5647924_+\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
CP027022.1\|AVH98034.1\|5648285_5648729_+\|Rieske-(2Fe-2S)-protein	unknown	unknown	gnl\|CDD\|239550
CP027022.1\|AVH98036.1\|5649901_5650489_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372083
CP027022.1\|AVH98039.1\|5655733_5656723_+\|DNA-binding-protein-WhiA	unknown	unknown	gnl\|CDD\|273194
CP027022.1\|AVH99851.1\|5650494_5651373_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH98042.1\|5661238_5662450_+\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
CP027022.1\|AVH99852.1\|5664173_5665826_+\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
CP027022.1\|AVH98045.1\|5663639_5663975_+\|RNA-polymerase-binding-protein-RbpA	unknown	unknown	gnl\|CDD\|379162
CP027022.1\|AVH98040.1\|5656932_5659881_+\|zinc-carboxypeptidase	unknown	unknown	gnl\|CDD\|349432
CP027022.1\|AVH98028.1\|5638502_5640629_+\|export-associated-protein	unknown	unknown	gnl\|CDD\|132992
CP027022.1\|AVH98029.1\|5640861_5641869_+\|tellurium-resistance-protein-TerC	unknown	unknown	gnl\|CDD\|274743
CP027022.1\|AVH98037.1\|5653812_5654721_+\|RNase-adapter-RapZ	unknown	unknown	gnl\|CDD\|235450
CP027022.1\|AVH98044.1\|5663331_5663562_+\|preprotein-translocase-subunit-SecG	unknown	unknown	gnl\|CDD\|235881
CP027022.1\|AVH98032.1\|5644030_5644732_-\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	unknown	unknown	gnl\|CDD\|236578
CP027022.1\|AVH98035.1\|5648746_5649676_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH98041.1\|5660121_5661132_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|223135
CP027022.1\|AVH98043.1\|5662457_5663234_+\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
CP027022.1\|AVH98031.1\|5643364_5644021_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293792

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH98038.1\|5654717_5655743_+\|hypothetical-protein	gnl\|CDD\|211689	TIGR01826, Putative_gluconeogenesis_factor, conserved hypothetical protein, cofD-related. This model represents a subfamily of conserved hypothetical proteins that forms a sister group to the family of CofD, (TIGR01819), LPPG:Fo 2-phospho-L-lactate transferase, an enzyme of cytochrome F420 biosynthesis. Both this family and TIGR01819 are within the scope of the pfam01933. [Hypothetical proteins, Conserved].	1.67015e-98
CP027022.1\|AVH98030.1\|5641951_5643232_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.11573e-151
CP027022.1\|AVH98033.1\|5644897_5647924_+\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
CP027022.1\|AVH98034.1\|5648285_5648729_+\|Rieske-(2Fe-2S)-protein	gnl\|CDD\|239550	cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. The Rieske domain can be divided into two subdomains, with an incomplete six-stranded, antiparallel beta-barrel at one end, and an iron-sulfur cluster binding subdomain at the other. The Rieske iron-sulfur center contains a [2Fe-2S] cluster, which is involved in electron transfer, and is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In RO systems, the N-terminal Rieske domain of the alpha subunit acts as an electron shuttle that accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron in the alpha subunit C-terminal domain to be used for catalysis.	6.19316e-24
CP027022.1\|AVH98036.1\|5649901_5650489_+\|hypothetical-protein	gnl\|CDD\|372083	pfam12385, Peptidase_C70, Papain-like cysteine protease AvrRpt2. This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes. Papain-like cysteine proteases play a crucial role in plant-pathogen/pest interactions. On entering the host they act on non-self substrates, thereby manipulating the host to evade proteolysis. AvrRpt2 from Pseudomonas syringae pv. tomato DC3000 triggers resistance to P. syringae-2-dependent defense responses, including hypersensitive cell death, by cleaving the Arabidopsis RIN4 protein which is monitored by the cognate resistance protein RPS2.	4.01921e-10
CP027022.1\|AVH98039.1\|5655733_5656723_+\|DNA-binding-protein-WhiA	gnl\|CDD\|273194	TIGR00647, DNA_bind_WhiA, DNA-binding protein WhiA. This family describes a DNA-binding protein widely conserved in Gram-positive bacteria, and occasionally occurring elsewhere, such as in Thermotoga. It is associated with cell division, and in sporulating organisms with sporulation. [Cellular processes, Cell division].	1.03085e-138
CP027022.1\|AVH98042.1\|5661238_5662450_+\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
CP027022.1\|AVH99852.1\|5664173_5665826_+\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
CP027022.1\|AVH98045.1\|5663639_5663975_+\|RNA-polymerase-binding-protein-RbpA	gnl\|CDD\|379162	pfam13397, RbpA, RNA polymerase-binding protein. RbpA is a family bacterial RNA polymerase-binding proteins. RbpA acts as a transcription factor by binding to the sigma subunit of RNA polymerase.	1.29748e-58
CP027022.1\|AVH98040.1\|5656932_5659881_+\|zinc-carboxypeptidase	gnl\|CDD\|349432	cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T subfamily. Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPT has moderate similarity to CPA and CPB, and exhibits dual-substrate specificity by cleaving C-terminal hydrophobic amino acid residues like CPA and C-terminal positively charged residues like CPB. CPA and CPB are M14 family peptidases but do not belong to this CPT group. The substrate specificity difference between CPT and CPA and CPB is ascribed to a few amino acid substitutions at the substrate-binding pocket while the spatial organization of the binding site remains the same as in all Zn-CPs. CPT has increased thermal stability in presence of Ca2+ ions, and two disulfide bridges which give an additional stabilization factor.	3.49663e-107
CP027022.1\|AVH98028.1\|5638502_5640629_+\|export-associated-protein	gnl\|CDD\|132992	cd06974, TerD_like, Uncharacterized proteins involved in stress response, similar to tellurium resistance terD. Tellurium resistance terD like proteins. This family is composed of uncharacterized proteins involved in stress response, such as the tellurium resistance proteins, chemical-damaging agent resistance proteins, and general stress proteins from a variety of organisms. The tellurium resistance proteins are homologous terA,-D,-E,-F,-Z,-X gene products, which confer tellurium resistance mediated by plasmids. Currently, the biochemical mechanism of tellurium resistance remains unknown. The family also contains several ter gene homologues, YceC, YceD, YceE, for which there is no clear evidence for any involvement in the tellurium resistance. A putative cAMP-binding protin CABP1 shows a significant similarity to the terD protein and is also included in this family.	1.54008e-26
CP027022.1\|AVH98029.1\|5640861_5641869_+\|tellurium-resistance-protein-TerC	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	3.34087e-139
CP027022.1\|AVH98037.1\|5653812_5654721_+\|RNase-adapter-RapZ	gnl\|CDD\|235450	PRK05416, PRK05416, RNase adapter RapZ.	1.2557e-167
CP027022.1\|AVH98044.1\|5663331_5663562_+\|preprotein-translocase-subunit-SecG	gnl\|CDD\|235881	PRK06870, secG, preprotein translocase subunit SecG; Reviewed.	2.51734e-13
CP027022.1\|AVH98032.1\|5644030_5644732_-\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	gnl\|CDD\|236578	PRK09583, PRK09583, mycothiol-dependent maleylpyruvate isomerase; Reviewed.	5.33465e-75
CP027022.1\|AVH98041.1\|5660121_5661132_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	0
CP027022.1\|AVH98043.1\|5662457_5663234_+\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	1.26451e-142
CP027022.1\|AVH98031.1\|5643364_5644021_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293792	cd06262, metallo-hydrolase-like_MBL-fold, mainly hydrolytic enzymes and related proteins which carry out various biological functions; MBL-fold metallohydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases which can catalyze the hydrolysis of a wide range of beta-lactam antibiotics, hydroxyacylglutathione hydrolases (also called glyoxalase II) which hydrolyze S-d-lactoylglutathione to d-lactate in the second step of the glycoxlase system, AHL lactonases which catalyze the hydrolysis and opening of the homoserine lactone rings of acyl homoserine lactones (AHLs), persulfide dioxygenase which catalyze the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria, flavodiiron proteins which catalyze the reduction of oxygen and/or nitric oxide to water or nitrous oxide respectively, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J which has both 5'-3' exoribonucleolytic and endonucleolytic activity and ribonuclease Z which catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors, cyclic nucleotide phosphodiesterases which decompose cyclic adenosine and guanosine 3', 5'-monophosphate (cAMP and cGMP) respectively, insecticide hydrolases, and proteins required for natural transformation competence. The diversity of biological roles is reflected in variations in the active site metallo-chemistry, for example classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, human persulfide dioxygenase ETHE1 is a mono-iron binding member of the superfamily; Arabidopsis thaliana hydroxyacylglutathione hydrolases incorporates iron, manganese, and zinc in its dinuclear metal binding site, and flavodiiron proteins contains a diiron site.	2.49209e-37

>CP027022.1|AVH99851.1|5650494_5651373_+|hypothetical-protein
MTTVIAATTTRARATAAGLLTAAALVALGAVPATAAESLPSAPTPERAASAPGTLDTLSRFFASDGAGAPAAARAADAGGAPRVEGASVPVRILSPDFVAGKAGAPVARVEFRASRAVAPDGRKASLWTVRGADGWQVVNIATGDDEIRYAEQGGRLLPGGLVFREPQIDAWYVQKGAKVLPLDEDAVRAVGKNGTSLAAYRERVARAYGDKLPGSAYAKKGAAGGYGPQEVPAREAAAQAAPAPRAAQAPRTDASGGSAATAAGVGAALALALTAGAAIRRHRTARSGPEA
>CP027022.1|AVH98036.1|5649901_5650489_+|hypothetical-protein
MRRRKLNLAALAAAALFLVPTTSASAAPAGEDASALASKRLNITMQAQQKSNWCWAAAGNTIATWFGRGYSQNQFCNAAFNRQQGYDCPNNQATLGNVQTGLSWAGVRPGSYVTGWLRYPTVQTEINADRPIETRIQWSSGGGHMHVIYGYDDASSWVYWGDPWPSSDRYNWASHAWYVDNNSFSWTHSLYRIGA
>CP027022.1|AVH98035.1|5648746_5649676_-|hypothetical-protein
MSHTEADLAQLLHTGPFHLALRTALAVRGLPLQRVQHHLAHRGVRVGVTSLSYWQQGARRPQRPESLKAVRALEEVLQLPGNSLLRLLTEDTAARSEAERPAGRSYRSLVEASGSVEELLAELECPTDGGLHTVGHHERVRIGAGRELVGRESQHVVRAHRDGVDRYLAIHHGDPGCDPSRVVVRAVENCRTGRVRWHAGTGVLVAELLFDARLRAGDTYLFSYGFEDGTAGASGEYVRGFSFAGGQYVLQVRFDEAALPVRCRRFAQVSAGAPRGGRAELTLSGRHRTVHLVEQGVRPGILGIDWDWS
>CP027022.1|AVH98034.1|5648285_5648729_+|Rieske-(2Fe-2S)-protein
MSGQSSRRTVLKGAALAGAAGLGVAACSTESKLGHAEVPTPTAPVSLGAPDEVPVGGAKLYREQRLVVSCPAEGQYKAFSAQCTHAGCVLDKVEENEGNCPCHGSRFDVTTGKALRGPATVPLPEVPVRVEGGRLVAGPEAAETPKA
>CP027022.1|AVH98033.1|5644897_5647924_+|excinuclease-ABC-subunit-UvrA
MADRLIVRGAREHNLKNVSLDLPRDSLIVFTGLSGSGKSSLAFDTIFAEGQRRYVESLSSYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTSRNPRSTVGTITEVYDYLRLLFARIGKPHCPECHRPISRQSPQAIVDRVLELPEGSRFQVLSPLVRERKGEFVDLFADLQTKGYSRARVDGQTVQLSEPPTLKKQEKHTIEVVVDRLTVKDSAKRRLTDSVETALGLSGGMVVLDFVDLPEDDPEREKMYSEHLYCPYDDLSFEELEPRSFSFNSPFGACPDCTGIGTRMEVDPELIVPDEDKSLDEGAIHPWSHGHTKEYFGRLIGGLSQALGFRTDIPYAGLPQRAKKALMHGHKTQVEVRYRNRYGRERAYTTPAFEGAVSFVKRRHTEAESDSSRERFEGYMREVPCPTCEGTRLKPIVLAVTVMDKSIAEVSAMSISDCAEFLSRLTLNARDKKIAERVLKEVNERLRFLVDVGLDYLSLNRAAGTLSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNHRLIETLVRLRDMGNTLIVVEHDEDTIKVADWVVDIGPGAGEHGGKVVHSGSLKELLANEQSMTGQYLSGRRAITTPDARRPVDPERRLTVHGARENNLRDIDVSFPLGVLTAVTGVSGSGKSTLVNDILYTHLARELNGAKSVPGRHTRVDGDELVDKVVHVDQSPIGRTPRSNPATYTGVFDHVRRLFAETMEAKVRGYLPGRFSFNVKGGRCENCSGDGTIKIEMNFLPDVYVPCEVCHGDRYNRETLEVHYKGKSIAEVLNMPIEEALDFFEAVPTIARHLRTLTEVGLGYVRLGQPAPTLSGGEAQRVKLASELQKRSTGRTVYVLDEPTTGLHFEDISKLIKVLSGLVDKGNSVIVIEHNLDVIKTADWVIDMGPEGGSGGGVVVAEGTPEEVASVPASHTGKFLREILGADRISDAAIPAARGTKKTAAKKTATAKKAATTKAAPAKKAAATKATAAKTAAKKTATRARKA
>CP027022.1|AVH98032.1|5644030_5644732_-|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme
MIDHERDLVSLREATDRLLDAASSWDNAATAEPSRLPGWTRGHVLAHLARNADALVNVFEGRPMYPDAATREADIERDAYRPLDVQLADVRESAERLRAVCEKPADWGRTVELRNGVTDSASRVPFRRWVEVELHHVDLGAGYDLDDLPEEFVLREIEFLADRWSGRPEVPPVTLRIGRDGTGPGWRTGGTEGTPVVLAGTGPELLGWLSGRGDKGAGLAVLSGDGLPELPPL
>CP027022.1|AVH98031.1|5643364_5644021_-|MBL-fold-metallo-hydrolase
MTYSGVVKVGGPADVHELADLMISKVAVGPMDNNAYLLRCRATGEQLLIDAANDAGTLLTLIGDDGVGAVVTTHRHGDHWQALAEVVAATGARTYAGAYDAEGIPVATDVPVEDGDTIRVGRVELTARRLVGHTPGSIALVYDDPHGHPHVFTGDCLFPGGVGNTRKDPEAFASLLHDVETKLFDVLPDESWVYPGHGRDTTLGDERPHLGEWRERGW
>CP027022.1|AVH98030.1|5641951_5643232_-|MFS-transporter
MGRIAAASLIGTAIEFFDFYVYGTAAALVLGPLFFPGSSPLAGTLAAFGTFAVGFVARPLGSVLFGHVGDRYGRRPVLFASLLLTGCATVAVGCLPTYATLGIAAPVLLLLLRFLQGLGLGGEWGGAVLLTAEHAPEGRRALWASFPQIGPSVGFLLANGVMLGLTAGLSDAEFRSWGWRVPFWAAGLLAAGGLLLRSSLAETPQFEELSASGRRAGAPLTEVVRDHWRLVLLTAGALAVGYAVFYAVSTWALAYGTGRLGLSGPVMLGCVMAAVAVMGAATPFAALLADRWGRRTLCLAGCAGCALWMFPMVALLHTARPALMFLGFLGALLAFITMFAVVSAYLPELYEPRVRCTGAAVGYNLAGVLGGALTPLAATALSEGGSGPPWGVAAYLTLVALVSLGCFALLPETLPARTAAKEPAPA
>CP027022.1|AVH98029.1|5640861_5641869_+|tellurium-resistance-protein-TerC
MDVSTTLWVLTILGLGALIAADFFIGRKPHDVSVKEAGIWTIVWIVLAVLFGLGLLFFGTAQASGEFFAGYITEKSLSVDNLFVFVLIMAKFSVPSHLQQRVLLIGVLIALVLRAIFIAAGAAIIASFSWVFYIFGAFLIYTAWKLIQEARADEEEDEFEENRLLKSVEKKFGVADRYHGTKLFIRVNGKRVLTPLMVVMLAIGTTDILFALDSIPAIFGLTQDPYIVFTANAFALMGLRQLYFLIGGLLKKLVHLSYGLSVILGFIGVKLVLHALHESGVHVPEISIPVSLAVICGVLIITTITSLIASKRQAEREAAQSVADAEGTEKDSIGA
>CP027022.1|AVH98028.1|5638502_5640629_+|export-associated-protein
MTAELVRGQNHPLPDTRLEIRVSAGHPVLAGATLADEAGRVPGAEWIAHPGAPSLPGVDVPRAAAADHRLSVDLGAMPGTVHRVSVLLALTGHGAARFGAVAAPFVAVAGPDGDEIASYTLTGLDSETAVVALELYRRQGAWKVRAMGQGYEGGLADLLGDQGLERPADAAAAILAAAAPEPAPAVTAPQPRVPEPERVPQPTPPAPDPARPTAPAPDAVLPTAPAPGPASPAAPDTTLPAAPVLPAGSDHPTPLATPAVPAPASPAAPDPTPPPLPPVVSDPAPTVPVTPPQGTGTDTNERTPGGPIDYSHPRRRPAAAPEPSRTPPQAPPVPVAGDASGWSMDERLYNQVWGMFEDLARTAAAYRSACDFAESRLDRELDQTLSDYRARNGGANDAARAAARARHDELVERAREVLDRDLAQLAAESEVVEPALPPAYARWDNPVWHAYRVPAEEPMAVRLGDLHLPERAELRIPMLVRLPLERGLWVDSGRGHSEAAGLLDETELRRLALDSAVAHTARLLAAHPAGGFTVHVLDAAGAGAASLAPLVDSGVLAAPPARGAAGVSAVLEQLTERVDLLQMAVRAGAADALPPGLATARQLLVVHDFPHGFDDRAVTRLRYLADEGPSVGVHLLMVADRADAAAYGPLLDPLWRSLLRLTPVADDHLADPWVGHAWSYEPPVLPPGSGVLRQVLAQVADARRGRQP
>CP027022.1|AVH98037.1|5653812_5654721_+|RNase-adapter-RapZ
MSTGTKETPGDNGAEAAIPELVIISGMSGAGRSTAAKCLEDLGWFVVDNLPPALIPTMVELGARSQGNVARIAVVVDVRGRQFFDNLRESLADLDAKQVTRRIVFLESSDEALVRRFESVRRPHPLQGDGRITDGIAAERDLLRELRGDADLVIDTSSLNVHELRAKMDAQFAGDEEPELRATVMSFGFKYGLPVDADLVVDMRFLPNPHWVPELRPFTGLNEEVSNYVYNQPGAKEFLDRYTELLQLIAAGYRREGKRYVTIAVGCTGGKHRSVATAERLAARLAAEGVETVVVHRDMGRE
>CP027022.1|AVH98038.1|5654717_5655743_+|hypothetical-protein
MKPYRRRASTLTVRRTLRRRGAQPKVVALGGGMGLSASLAALRRITGDLTAVVTVADDGGSSGRLREELGVLPPGDLRKALAALCGDDDWGQTWARVIQHRFQSKGEINGHAVGNLLIVALWEQLGDPVQALDLVGLLLGAQGRVLPMSAVPLELQALVKGHDPERPDDVDTVAGQATVALTPGEVQSVHLVPNDPPAVPEAVAAVLDADWVVLGPGSWFSSVIPHLLVPELLDALVETKARKVLSLNLAPQPGETDGFSPQRHLEVLGRHAPKLALDVVLADEAAVPDRDSLADAAKRFGAAVELAPVAGPDGSAKHDPELLAAAYDRIFRMHGRIGPWR
>CP027022.1|AVH98039.1|5655733_5656723_+|DNA-binding-protein-WhiA
MAMTAAVKDEISRLPVTRTCCRKAEVSSILRFAGGLHLVSGRIVIEAELDTAMAARRLKRDILEIFGHSSELIVMAPGGLRRGSRFVVRVVAGGDQLARQTGLVDGRGRPIRGLPPQVVSGATCDAEAAWRGAFLAHGSLTEPGRSSSLEVTCPGPEAALALVGAARRLSIAAKAREVRGVDRVVVRDGDAIGALLTRLGAHESVLAWEERRMRREVRATANRLANFDDANLRRSARAAVAAGARVQRALEILGEEVPEHLAAAGRLRMEHKQASLEELGALADPPLTKDAVAGRIRRLLAMADKRAQDLGIPGTESNLTEELDDSLVG
>CP027022.1|AVH98040.1|5656932_5659881_+|zinc-carboxypeptidase
MRRRAGSILAAASLLIAGAAAAPVAGARPDDRNADALSVWHAEVTKEQVPLLLEAGADAHELTERVPAQGSATVELFLTGDQAGRLRGRGVELAEHTLSDGAENRVAAAGDGVFRPYGGTGGLKQEILDTARTHPGLTKVVSIGKTLKGQDILALKVSKGAQRAKDGSKPATLYMSNQHAREWITPEMTRRLMHHYLDGYGKDERITRIVDTTELWFVLSANPDGYDHTHADPANRQWRKNLRDNNGDGRTGPGDGVDLNRNFAYKWGYDNEGSSPDPADETFRGKGPMSEPETRAIDAFQKRIGFAYGINYHSAAQLLLYGVGWQVATDTPDDVALRALAGTPENSAVPGYRPQVSSELYTTNGEADGHAANVNGMQMFTPEMSTCATASRVDPNDAWNPADCASVFTFPDDEKLIRAEFAKNVPFALAVAESSAHPDRPVSPVGVEAPDFTPKAFATSYARGGEQEVAVTARKSLRGKTLEYRINGGRVHREELRAWKGGETYGGEDNLYFDEYRAEVEGARPGDSVEVRFTARTREGRATASAPFTYEVAERARGDVLVLADEGGTTAGRHTAAYVKALADGGRKAAVWDVAVQGAPDALGVLSHFDAVVWYTGAQRPSGDAELAVRSYLNEGGKLVNAGEKAGGLTRVGAAETNDFAQYYLGAHHRAGLKNPSAFAGAGAFGGVRATLGAAPGNPLDDAGAYTVTSDTLKPKDFPQFASSASAGDYPGVRTPFEPAEGATFAAVKHADDTWARLSRTVDLTGVPASAKPRLDFQVSHDTEPGYDNLVVEAHTVGQDDWTTLPDTNGGTSAAPPADCGEGYYVRGHPFLAHYLTVGEDGCAPTGTTGSWNAFTGPSNGWRQASVDLSAWAGKKVELSLSYVSDPGTGETGAFVDDVRLVTGTTTEAEGFETSLGAWSTPGAPAGSPGNGSDWTRSAALFHSQAAVTTRDTVLLGFGLEHVPGTAERARLLGRALKALHR
>CP027022.1|AVH98041.1|5660121_5661132_+|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MTIRVGINGFGRIGRNYFRALLEQGADIEIVAVNDLGDTATTAHLLKYDTILGRLKAEVTHTADTITVDGHTIKVLSERNPADIPWGELGVDIVIESTGIFTKKADAEKHLAGGAKKVLISAPASDEDITIVMGVNQDKYDAAKHDIISNASCTTNCVAPMAKVLDENFGIVKGLMTTVHAYTNDQRILDFPHKDLRRARAAAENIIPTTTGAAKATALVLPQLKGKLDGIAMRVPVPTGSATDLVVTLDREVTKDEVNAAFKKAAEDGDLKGVLFYTEDPIVSSDIVGDPASCTFDASLTMVQDGKSVKILGWYDNEWGYSNRLVDLTVFVGGQL
>CP027022.1|AVH98042.1|5661238_5662450_+|phosphoglycerate-kinase
MKTIDELLHEGVEGKRVFVRADLNVPLDGTTITDDGRIRAVVPTVEALADAGARVVVASHLGRPKGAPDPAFSLAPAAARLGELLGADVAFATDTVGDSATETVAGLGNGQVAVLENLRFNPGETAKDDAERGAFADRLAALADLYVGDGFGAVHRKHASVYDLPARLPHAAGHLIATEVGVLKKLTDDVQRPYVVALGGAKVSDKLGVIDHLLEKADRILIGGGMAYTFLKAQGHEVGISLLQEDQIPAVQEYLARAKERGVEFVLPVDVLVASEFPDLKTKAPANPTTVAADAIPADEEGLDIGPETRKLYASKLADAATVFWNGPMGVFEHPDYAEGTKAVAQALVDSPAFTVVGGGDSAAAVRTLGFDENAFGHISTGGGASLEYLEGKTLPGLAALED
>CP027022.1|AVH98043.1|5662457_5663234_+|triose-phosphate-isomerase
MTTRTPLMAGNWKMNLNHLEAIAHVQKLAFALTDKDYDAVEVAVLVPFTDLRSVQTLVDGDKLKIKYGAQDISAHDSGAYTGEISGPMLSKLKAAFVAVGHSERRQYHAEDDEVCNAKVKAAFKHGITPILCVGEGLDVRKAGKQVEHTLAQLDGGLKDVPAEQAETIVIAYEPVWAIGTGEVATPEDAQEVCGAIRGRLAELYSQELADKVRIQYGGSVKSGNVAAIMAQPDVDGALVGGAALDADEFVKIVRFRDQ
>CP027022.1|AVH98044.1|5663331_5663562_+|preprotein-translocase-subunit-SecG
MGFSIALIVFSALLMLLVLMHKGKGGGLSDMFGGGMQSSVGGSSVAERNLDRITVVVGLLWFACIVVLGLLMKLDG
>CP027022.1|AVH98045.1|5663639_5663975_+|RNA-polymerase-binding-protein-RbpA
MASGNAIRGSRVGAGPMGEAERGESAPRLRISFWCSNGHETQPSFASDAQVPDTWDCPRCGFPAGQDRDNPPDPPRTEPYKTHLAYVRERRSDADGEAILAEALAKLRGEI
>CP027022.1|AVH99852.1|5664173_5665826_+|glucose-6-phosphate-isomerase
MTGEGRTRLNRLPEWAALGKHREQLGEPHLRELFAADPTRGTDLTLRVGDLYLDYSKHLVTGETLTLLRELAAATGVAELRDAMFRGEKINTTEDRAVLHTALRAPRDAVIEVDGENVVPGVHAVLDRMGDFADKVRAGEWTGHTGRPIKNVVNIGIGGSDLGPAMAYEVLRSYTRRDLTLRFVSNVDGADLHEAVHDLDPAETLFVVASKTFTTIETITNATSARDWLLTGLDAGQEAVARHFVALSTNAEKVEQFGIDTANMFEFWDWVGGRYSYDSAIGLSLMIAIGPERFREMLDGFHLVDEHFRTAPPEENAPLLLGLLGVWYGNFFDAQSHAVLPYSHYLSKFTAYLQQLDMESNGKSVDREGNRVDWQTGPVVWGTPGTNGQHAYYQLIHQGTKLVPADFIGFARPVDDLEPGLVAQHDLLMANFFAQTQALAFGKTPEEVRAEGVPEELVPHKTFRGDHPTTTILADALTPSVLGQLIALYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRIEPVLTTGEGAEELDGSTAGLVAAYRSLRGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_18

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_18

5678392-5678516

Orphan

Consensus_repeat	Method
TCATGACCTCAGCTCCTTGCCCGTGAGCTCCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_18

>merge|CP027022|18|5678392-5678516|CRISPRCasFinder
TCATGACCTCAGCTCCTTGCCCGTGAGCTCCAGGCTGTGCCGACCCGGGGGGCGCCCCCCGGACCCCCGGCAGATCCCGTCGGTGGCCGGCTTCATGACCTCAGCTCCTTGCCGGTGAGCTCCAG

>CP027022|18|17|5678392-5678516|CRISPRCasFinder
TCATGACCTCAGCTCCTTGCCCGTGAGCTCCAG	GCTGTGCCGACCCGGGGGGCGCCCCCCGGACCCCCGGCAGATCCCGTCGGTGGCCGGCT
TCATGACCTCAGCTCCTTGCCGGTGAGCTCCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH98056.1\|5679590_5680316_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
CP027022.1\|AVH98062.1\|5685335_5685809_+\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
CP027022.1\|AVH98057.1\|5680312_5681728_+\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
CP027022.1\|AVH98046.1\|5665830_5666331_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225937
CP027022.1\|AVH98064.1\|5686192_5686558_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|380093
CP027022.1\|AVH98058.1\|5681788_5682970_+\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
CP027022.1\|AVH99854.1\|5675088_5676036_+\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
CP027022.1\|AVH98059.1\|5682969_5683287_+\|bifunctional-3-phenylpropionate/cinnamic-acid-dioxygenase-ferredoxin-subunit	unknown	unknown	gnl\|CDD\|239604
CP027022.1\|AVH98048.1\|5668883_5669966_-\|glucose-6-phosphate-dehydrogenase-assembly-protein-OpcA	unknown	unknown	gnl\|CDD\|213538
CP027022.1\|AVH98061.1\|5684055_5685324_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
CP027022.1\|AVH98060.1\|5683294_5684059_+\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
CP027022.1\|AVH98053.1\|5676556_5677516_-\|heme-A-synthase	unknown	unknown	gnl\|CDD\|224528
CP027022.1\|AVH98063.1\|5685805_5686144_+\|metal-sulfur-cluster-assembly-factor	unknown	unknown	gnl\|CDD\|225062
CP027022.1\|AVH99853.1\|5666426_5668073_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225962
CP027022.1\|AVH99855.1\|5686588_5687641_-\|oxidoreductase	unknown	unknown	unknown
CP027022.1\|AVH98049.1\|5669962_5671495_-\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
CP027022.1\|AVH98047.1\|5668107_5668887_-\|6-phosphogluconolactonase	unknown	unknown	gnl\|CDD\|273494
CP027022.1\|AVH98051.1\|5672655_5674743_-\|transketolase	unknown	unknown	gnl\|CDD\|223100
CP027022.1\|AVH98050.1\|5671499_5672618_-\|transaldolase	unknown	unknown	gnl\|CDD\|235117
CP027022.1\|AVH98052.1\|5676133_5676478_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH98056.1\|5679590_5680316_+\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	1.043e-53
CP027022.1\|AVH98062.1\|5685335_5685809_+\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	1.07401e-60
CP027022.1\|AVH98057.1\|5680312_5681728_+\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
CP027022.1\|AVH98046.1\|5665830_5666331_+\|hypothetical-protein	gnl\|CDD\|225937	COG3402, COG3402, Uncharacterized conserved protein [Function unknown].	8.75807e-26
CP027022.1\|AVH98064.1\|5686192_5686558_+\|VOC-family-protein	gnl\|CDD\|380093	pfam18029, Glyoxalase_6, Glyoxalase-like domain. This entry comprises a diverse set of domains related to the Glyoxalase domain. The exact specificity of these proteins is uncertain.	3.9961e-32
CP027022.1\|AVH98058.1\|5681788_5682970_+\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	6.85249e-87
CP027022.1\|AVH99854.1\|5675088_5676036_+\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	4.16892e-146
CP027022.1\|AVH98059.1\|5682969_5683287_+\|bifunctional-3-phenylpropionate/cinnamic-acid-dioxygenase-ferredoxin-subunit	gnl\|CDD\|239604	cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the insertions that give other Rieske proteins unique structural features are missing. CARDO catalyzes dihydroxylation at the C1 and C9a positions of carbazole. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.	1.67164e-50
CP027022.1\|AVH98048.1\|5668883_5669966_-\|glucose-6-phosphate-dehydrogenase-assembly-protein-OpcA	gnl\|CDD\|213538	TIGR00534, Putative_OxPP_cycle_protein_OpcA, glucose-6-phosphate dehydrogenase assembly protein OpcA. The opcA gene is found immediately downstream of zwf, the glucose-6-phosphate dehydrogenase (G6PDH) gene, in a number of species, including Mycobacterium tuberculosis, Streptomyces coelicolor, Nostoc punctiforme, and Synechococcus sp. PCC 7942. In the latter, disruption of opcA was shown to block assembly of G6PDH into active oligomeric forms. [Protein fate, Protein folding and stabilization].	5.87273e-96
CP027022.1\|AVH98061.1\|5684055_5685324_+\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
CP027022.1\|AVH98060.1\|5683294_5684059_+\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.53975e-145
CP027022.1\|AVH98053.1\|5676556_5677516_-\|heme-A-synthase	gnl\|CDD\|224528	COG1612, CtaA, Uncharacterized protein required for cytochrome oxidase assembly [Posttranslational modification, protein turnover, chaperones].	3.86478e-30
CP027022.1\|AVH98063.1\|5685805_5686144_+\|metal-sulfur-cluster-assembly-factor	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	8.77774e-32
CP027022.1\|AVH99853.1\|5666426_5668073_+\|hypothetical-protein	gnl\|CDD\|225962	COG3428, COG3428, Predicted membrane protein [Function unknown].	1.06842e-53
CP027022.1\|AVH98049.1\|5669962_5671495_-\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
CP027022.1\|AVH98047.1\|5668107_5668887_-\|6-phosphogluconolactonase	gnl\|CDD\|273494	TIGR01198, 6-phosphogluconolactonase_6PGL., 6-phosphogluconolactonase. This enzyme of the pentose phosphate pathway is often found as a part of a multifunctional protein with [Energy metabolism, Pentose phosphate pathway].	2.99647e-84
CP027022.1\|AVH98051.1\|5672655_5674743_-\|transketolase	gnl\|CDD\|223100	COG0021, TktA, Transketolase [Carbohydrate transport and metabolism].	0
CP027022.1\|AVH98050.1\|5671499_5672618_-\|transaldolase	gnl\|CDD\|235117	PRK03343, PRK03343, transaldolase; Validated.	0

>CP027022.1|AVH98053.1|5676556_5677516_-|heme-A-synthase
MLNPLASIARRWTPSPRTLRRAALSAVVMSVLIIVTGGAVRLTGSGLGCDTWPKCTDDSLFATPEQGLHGAIEFGNRMLTYVLSAAVGWAIVSVRSVKPRRRGLTRLAWVQFWIVLSNAVLGGITVWMGLNPWTVAGHFLAANALLTVAVVTWHRTGEGDTAPRPRVPRPVRRLSWAIAITSGLLIALGTAVTGSGKHAGDSSDVPRMPWDWTNAAHLHAIAAWIVCALAVAMWLVLRAVDAPDDTRARARDLLIVLLLQGGIGYVQYFTGVPEILVGAHMLGSSLMWIAVVRLALSMRERPLSTPAIPAQTDPELAKA
>CP027022.1|AVH98052.1|5676133_5676478_+|hypothetical-protein
MADTQADTKADTKKDERRVARLTKQIQAFSKEHGGSEGHLEHIGQAGTRIVLVGTDGLWGDLVAPTYAIAERAAEKAGLTLHEEFDGEFAAKVVTGPYEWSRMAGIQIGGPSDR
>CP027022.1|AVH99854.1|5675088_5676036_+|protoheme-IX-farnesyltransferase
MTAVESRPAGVVLTPSPGGHRPFGARVKAFVALTKPRIIELLLITTVPVMFLAEQGVPNLWLVLATCFGGYLSAGGANALNMYIDRDIDALMDRTSQRPLVTGMVSPREGLVFGLTLAVVSTLWFGLLVNWLSAWLSLGALLFYVVVYTMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSMSWAAVILFMVIFFWTPPHYWPLSMKVKDDYARVGVPMLPVIASNKVVAKQIVAYSWVMVAVSLLLTPLGYTGWFYTAVALVTGGWWLWEAHGLLNRAKDGATGAKLKEMRLFHWSITYVSLLFVAVAVDPFLR
>CP027022.1|AVH98051.1|5672655_5674743_-|transketolase
MSTKPTTTDLEWTELDQRAVDTARILAADAVQKVGNGHPGTAMSLAPVAYTLFQKVMRHDPADPEWVGRDRFVLSAGHSSLTLYTQLYLGGFGLELDDLKAFRTWGSKTPGHPEYGHTAAVETTTGPLGQGVANAVGMAMAARFERGLFDPEAPAGTSPFDHRVYAIAGDGCLQEGISAEASSLAGHQKLGNLILLWDDNHISIEGDTETAVSEDTLKRYEAYGWHVQRVEPQENGDLDPAGLYAAIRAAEAETERPSFIAMRSIIAWPAPNAQNTEAAHGSALGDDEVAATKRVLGFDPEKTFEVSDEVIAHTRALGERGREARVEWEKQLAEWRTANPERAAEFDRIEANELPEGWAEKLPVFEPGKGVATRAASGQVLKALGAVIPELWGGSADLAGSNNTTIDKDSSFLPEGNPLPEADPYGRTIHFGIREHAMAAEMNGIALHGNTRIYGGTFLVFSDYMRNAVRLSALMHLPVTYVWTHDSIGLGEDGPTHQPVEHLASLRAIPGLNLVRPADANETALAWREIMQRHTKVYGKGAPHGLALTRQGVPTYAPNEGTVKGGYVLFDAEGGEPEVVLIATGSEVHLAVEAREQLQAAGTPTRVVSMPSVEWFEEQDQAYKDSVLPPSVRARVAVEAGIGLTWHKYVGDAGRIVSLEHFGASADAKVLFREFGFTPEAVVAAARESIDAAAR
>CP027022.1|AVH98050.1|5671499_5672618_-|transaldolase
MTDALKRLSDEGVAIWLDDLSRQRITSGNLAELIDQSHVVGVTTNPSIFQKAISEGHGYDQQVSDLAARRVTVEEAIRMITTADVRDAADILRPVFDATDGQDGRVSIEVDPRLAHDTKATVAEAKQLAWLVDRPNTLIKIPATEAGLPAITEVIGLGISVNVTLIFSLERYRLVMDAYLAGLEKARERGLDLAKIHSVASFFVSRVDTEIDKRLDGIGTDEAKALKGKAALANARLAYEAYEEVFSSERWAALDKAHANKQRPLWASTGVKDPAYKDTLYVVDLVAPGTVNTMPEATLEATADHGEVTGNTVAGTYDDSRAVLEAVAKLGIGYDEVVQLLEDEGVQKFEASWNDLLTSTEAELKRLAPSEA
>CP027022.1|AVH98049.1|5669962_5671495_-|glucose-6-phosphate-dehydrogenase
MSAAHGANPLRDAADRRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPGFSLVGFARREWQDEDFAQEVYEAVKQHSRTPFREEVWQQLIQGMRFVQGDFDDDEAFEQLKTTVEELDKAQGTGGNFAFYLSVPPKFFPKVVQQLKKHGLADQKDGSWRRAVIEKPFGHDLASAKELNEVVHEVFPPHEVFRIDHYLGKETVQNILALRFANTLFEPIWNRSYVDHVQITMAEDIGIGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPASFDADALAAEKTKVLGAVKLPRDLGASTVRGQYAAGWQGGEKAVGYLQEEGIDPNSKTDTYAAVKLEIDNRRWAGVPFYLRTGKRLGRRVTEIAVVFQRAPHSPFDHTATEELGRNAIVIRVQPDEGVTVRFGSKVPGTQMEIRDVSMDFAYGESFTESSPEAYERLILDVLLGDSNLFPRVEEVELSWKILDPIERFWDEHGKPAQYQSGTWGPVEADEMLARDGRSWRRP
>CP027022.1|AVH98048.1|5668883_5669966_-|glucose-6-phosphate-dehydrogenase-assembly-protein-OpcA
MKTDLTDTTSSKINKALVLGRRAIGAPAVGMVLTLVIVTDEENAYDALKAANEASREHPSRTLVVIKRVSRSPRDRAKARLDAEVRLGTDASAGETVVLRLYGEVVDHAQSVVLPLLLPDAPVVVWWPVDAPTDPAKDPLGALAQRRVTDTYASEQPIEELTARAETYTPGDTDLSWTRITPWRSMLAAALDQVVCRVSAAEVEGEEFNPSVELLAMWVADRLKVPVRRSKSAGPGLTSVRLETDCGPIVLDRPDGSLATLSIEGQPDRGVALKRRDTAELIAEELRRLDPDDTYAAALKFGVGRLDERAAVTAPEPEEEVEVTVVETAPETAPDASPAEEKPAAKSGAKKAPARKAAAR
>CP027022.1|AVH98047.1|5668107_5668887_-|6-phosphogluconolactonase
MSAPQLVVHRDKELMAQAAAARLITRIVDAQAARGSASVVLTGGRNGNGLLAALGSAPARDAVDWSRLDLWWGDERYLPDGDPERNVTQAREALLDRVPLDPARVHAMPASDGPYGDDVEAAAAAYAEELAAAAGPGDGGVPAFDVLMLGVGPDTHVASLFPELPAVHETERTVVGVRGAPKPPPVRISLTLPAIRAAREVWLLAAGEDKAKAAAIALSGAGELQAPAAGARGRSRTLWLLDSAAASELPRSLYPPATA
>CP027022.1|AVH99853.1|5666426_5668073_+|hypothetical-protein
MRPGAPEEEEQPRSGTERQRPGAPEDGERPRPGVPEEEWRRLDPRTLLATAAVLCGVAGGAGVPVALGLAGSRPLWQAVAWVLAGALLLLLGGTGADSVRLRRTRYRVGPDRIDLHTGLLHLKRRSLARERIRSVDLTANPLQRVLGLVKVRIGTGEHSGGDAALALELVARAEGERLRRALLARAAAPEDPRHDGALAVLDPRWIRYAPVSFVAPALGGAAAGAVMQVSEWFGAQGEVIDWIGERFSSVAIPWMILWLVLVATAVGAVGALGLWIEMWWNYRLEREPGGTLRVNRGLLTARSVSIEERRLRGVELVEPLGVRLFGAARVDAVATGLAEKDEDRHGDLKNLMPAAPRPLADRVAAQVLREPEPPTATPLAPHPRAARNRRIRWALWSVLAPAALLAGLGLLLTPVLLYVAAGWTAVLTPLALLLARDAYRNLGHGVGGGYLVTRSGTVRRTTVALQRSGVIGWTVKQSYFQRRAGLLTLTATTAAGTGAYEILDAGRSQGLAFAAEAVPGLLTPFLEPVGTPETPKTPETPEARSTEG
>CP027022.1|AVH98046.1|5665830_5666331_+|hypothetical-protein
MRGEDAVRLRPPGNAVDGRAVTWWRTQLLVTTAVPVVVLGVLGALIGPARTWLLVAAGAVAAAGLACTAFFPAWWFRVHRWEATDEAVYVRTGALWQEWRIAPMSRIQTVDTSRGPLEQYFRLATVTVTTASSEGAIRIEGLDHELAADLAERLTAVTQATPGDAT
>CP027022.1|AVH98056.1|5679590_5680316_+|transcriptional-regulator
MKNVGAAPVEELATRERSTRNRVARSILDHGPSTVADLAERLGLTQAAVRRHLDSLVAENVVEAREKRVYGNRGRGRPAKVFALTDCGRDAFDQSYDSLAVEALRWIERNAGGEEAVAAFARDRIESQGGAYREAVEAAEPARRTEALAKALTADGYAATARNAPVGEQLCQHHCPVAHVAEQYPQLCEAETEFFSRLLGTHVQRLATIAHGDGVCTTFIPHGTPQTTESASARTAGRNPA
>CP027022.1|AVH98057.1|5680312_5681728_+|Fe-S-cluster-assembly-protein-SufB
MTTEISHPELEGLGRYEYGWADSDAAGATAKRGLNEDVVRDISAKKNEPDWMLKLRLKGLRLFGKKPMPTWGSDLSGIDFDNIKYFVRSTEKQAESWEDLPEDIKNTYDKLGIPEAEKQRLVAGVAAQYESEVVYHQIREDLEEQGVIFVDTDTALKEHEELFKEYFGTVIPVGDNKFASLNTAVWSGGSFIYVPKGVHVEIPLQAYFRINTENMGQFERTLIIVDEDAYVHYVEGCTAPIYSSDSLHSAVVEIIVKKGGRCRYTTIQNWSNNVYNLVTKRAVAYEGATMEWVDGNIGSKVTMKYPAVYLMGEHAKGETLSIAFAGEGQHQDAGAKMVHMAPNTSSNIVSKSVARGGGRTSYRGLIEIGEGAPGAKSNVLCDALLVDTISRSDTYPYVDVREDDVSMGHEATVSKVSEDQLFYLMSRGLTEFEAMAMIVRGFVEPIAKELPMEYALELNRLIELQMEGAVG
>CP027022.1|AVH98058.1|5681788_5682970_+|Fe-S-cluster-assembly-protein-SufD
MAEAQNIPAGSTTAGSIAVAAESTVATRMSAPPSFDVADFPVPHGREEEWRFTPLERLRGLHDGTAVATGEGVKVDIEAPEGVTVETVGRDDERLGRAGKPVDRVAAQAYSSFEKASVVTVAKDAVLTEPIRIAVHGHGGTAFGHQVIELGAFAEAVVVIDHTGDAVLAANVDYVLGDGAKLTVVSVQDWDEKAVHVAQHNALVGRDASFKSVVVTFGGDVVRIHPRVAYAAPGGEAELFGLYFTDAGQHQEHRLLVDHNTPHCKSNVAYKGALQGEGAHAVWIGDVLIQAAAEGTDTYELNRNLVLTDGARVDSVPNLEIETGEIAGAGHASATGRFDDEQLFYLMARGIPETEARRLVVRGFFAELVQQIGLPDVQERLIAKIEAELEASV
>CP027022.1|AVH98059.1|5682969_5683287_+|bifunctional-3-phenylpropionate/cinnamic-acid-dioxygenase-ferredoxin-subunit
MAFVRVCALSELETDTPKRVEVDGTPVSVVHTEGEVFAINDICSHANVSLSEGEVEDCAIECWLHGSSFDLRTGKPSGLPATRPVPVYPVKIEGDDVLVSVTQES
>CP027022.1|AVH98060.1|5683294_5684059_+|Fe-S-cluster-assembly-ATPase-SufC
MATLEIHDLHVSVEAENGPREILKGVDLTIKQGETHAVMGPNGSGKSTLAYSLAGHPKYTVTGGTVTLDGEDVLEMSVDERARAGVFLAMQYPVEVPGVSVSNFLRTSATAVRGEAPKLRTWVKEVKEAMAELQMDPAFAERNVNEGFSGGEKKRHEILQLELLKPKIAILDETDSGLDVDALRIVSEGVNRVRESGEVGTLLITHYTRILRYIKPDFVHVFANGRIAESGGAELADQLENEGYDKYVKGGASA
>CP027022.1|AVH98061.1|5684055_5685324_+|cysteine-desulfurase
MTSAHQGLSGLLDTEAIRKDFPLLDRTVHDGKKIVYLDSAATSQKPRQVLDALNAYYERHNANVHRGVYTVAEEATALYEGSRDKVAAFINAPSRDEVIFTKNASESLNLVANMLGWADEPYRVDHETEIAITEMEHHSNIVPWQLLSQRTGAKLKWFGLTDDGRLDLSNIEEVITEKTKIVSFTLVSNLLGTFNPVETIIRRAQEVGALVCIDASQAAPHMVLDVQALQADFVAFTGHKMCGPTGIGVLWGRQELLEDLPPFLGGGEMIETVSMHSSTYAPAPHKFEAGTPPIAQAVGLGAAVDYLSAIGMENIHRHEQAITEYAVRRLQEVPDLRIIGPTTAEDRGAAISFTLGDIHPHDVGQVLDEQGIAVRVGHHCARPVCLRYGIPATTRASFYLYSTPAEVDALVEGLEHVRNFFG
>CP027022.1|AVH98062.1|5685335_5685809_+|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MKLDSMYQDVILDHYKHPHGRGLRDGDAEVHHVNPTCGDEITLRVKYDGSRVEDVSYEGQGCSISQASASVLNELLVGKELAEAQKIQGTFLELMQSKGQIEPDEAMEEVLEDAVAFAGVSKYPARVKCALLSWMAWKDATAQALGDDDQKSERKSA
>CP027022.1|AVH98063.1|5685805_5686144_+|metal-sulfur-cluster-assembly-factor
MTENAGATMKPASEEEVREALYDVVDPELGIDVVNLGLIYGIHIDDSNVATLDMTLTSAACPLTDVIEDQAKSATDGIVNELKINWVWMPPWGPDKITDDGREQLRALGFNV
>CP027022.1|AVH98064.1|5686192_5686558_+|VOC-family-protein
MAVRMYHLAVDAHDICAQARFWAAVLDWKVLYEDEHEVVIGADEHALPGMCFLPVPESKTVKNRLHIDLSPDDRDAEVERILALGATRIDVGQGEDATWVTLADPEGNEFCVLRPKRSLTD
>CP027022.1|AVH99855.1|5686588_5687641_-|oxidoreductase
MTYPTGPYGYGHTPPPPPPKPGVIPLRPLALSEVLTAAFATLGRHWKQLVGVTGVAYGFALLLVGAAFGIGYLFVADNVPRVFDLREGREASPDDLVPVMVAFGCVWLVAVIGMLVATAVVSAAVPVVLQEAVVGGRLTFGTVWGRAWARTPAVLGTLLLTTLVVLVPFLLVLGLFAGLMTLLIANETGPAVTLLLFPLFFLVLAPLGTWFWVKLAFAPTVTVIERQGPMASLRRSWHLVTGTWWRTFGGLLVAFVLTSVVSMVFQQVLGALAAAPLSFHDGPAPESAGEVLALVGPMLIVMIVGSLIAQVFAALFPPLVSGLLYVDQRIRRENLAPTLARTAAARAYGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_19

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_19

6027978-6028073

Orphan

Consensus_repeat	Method
ACGGGTCCTAGCCGTACACCGGCCCCGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027022_19

>merge|CP027022|19|6027978-6028073|CRISPRCasFinder
ACGGGTCCTAGCCGTACACCGGCCCCGTGGCTGTTGTCTTCCGGGGGGCGACCCCCGTACCCCCGCGACGGGTCCTAGCCGTACACCGGCCCCGTG

>CP027022|19|18|6027978-6028073|CRISPRCasFinder
ACGGGTCCTAGCCGTACACCGGCCCCGTG	GCTGTTGTCTTCCGGGGGGCGACCCCCGTACCCCCGCG
ACGGGTCCTAGCCGTACACCGGCCCCGTG

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH98334.1\|6032871_6033999_+\|phenylalanine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|234780
CP027022.1\|AVH98332.1\|6029883_6030270_+\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
CP027022.1\|AVH98324.1\|6020935_6022312_+\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|365919
CP027022.1\|AVH98338.1\|6037814_6039443_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH98339.1\|6040046_6041111_+\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
CP027022.1\|AVH98331.1\|6029582_6029777_+\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
CP027022.1\|AVH98336.1\|6036681_6037050_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH98328.1\|6027238_6027973_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377787
CP027022.1\|AVH98325.1\|6022308_6023094_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|180371
CP027022.1\|AVH98322.1\|6018756_6019485_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
CP027022.1\|AVH98330.1\|6028756_6029455_+\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|234582
CP027022.1\|AVH99888.1\|6025222_6025996_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH98321.1\|6017147_6018629_-\|ethanolamine-permease	unknown	unknown	gnl\|CDD\|129986
CP027022.1\|AVH98320.1\|6016424_6017117_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase	unknown	unknown	gnl\|CDD\|336781
CP027022.1\|AVH98323.1\|6019574_6020939_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP027022.1\|AVH98333.1\|6030478_6031318_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223640
CP027022.1\|AVH98327.1\|6025992_6027174_+\|type-VII-secretion-associated-serine-protease-mycosin	unknown	unknown	gnl\|CDD\|274856
CP027022.1\|AVH98326.1\|6023161_6024364_-\|amino-acid-deaminase/aldolase	unknown	unknown	gnl\|CDD\|143488
CP027022.1\|AVH98335.1\|6033998_6036527_+\|phenylalanine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234804
CP027022.1\|AVH98337.1\|6037176_6037644_+\|DUF4240-domain-containing-protein	unknown	unknown	gnl\|CDD\|379426

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH98334.1\|6032871_6033999_+\|phenylalanine--tRNA-ligase-subunit-alpha	gnl\|CDD\|234780	PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated.	0
CP027022.1\|AVH98332.1\|6029883_6030270_+\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	4.08146e-60
CP027022.1\|AVH98324.1\|6020935_6022312_+\|aldehyde-dehydrogenase	gnl\|CDD\|365919	pfam00171, Aldedh, Aldehyde dehydrogenase family. This family of dehydrogenases act on aldehyde substrates. Members use NADP as a cofactor. The family includes the following members: The prototypical members are the aldehyde dehydrogenases EC:1.2.1.3. Succinate-semialdehyde dehydrogenase EC:1.2.1.16. Lactaldehyde dehydrogenase EC:1.2.1.22. Benzaldehyde dehydrogenase EC:1.2.1.28. Methylmalonate-semialdehyde dehydrogenase EC:1.2.1.27. Glyceraldehyde-3-phosphate dehydrogenase EC:1.2.1.9. Delta-1-pyrroline-5-carboxylate dehydrogenase EC: 1.5.1.12. Acetaldehyde dehydrogenase EC:1.2.1.10. Glutamate-5-semialdehyde dehydrogenase EC:1.2.1.41. This family also includes omega crystallin, an eye lens protein from squid and octopus that has little aldehyde dehydrogenase activity.	0
CP027022.1\|AVH98338.1\|6037814_6039443_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	4.74128e-84
CP027022.1\|AVH98339.1\|6040046_6041111_+\|serine/threonine-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	5.88422e-36
CP027022.1\|AVH98331.1\|6029582_6029777_+\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	1.31411e-21
CP027022.1\|AVH98328.1\|6027238_6027973_+\|hypothetical-protein	gnl\|CDD\|377787	pfam07179, SseB, SseB protein N-terminal domain. This family consists of several SseB proteins which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon. This entry contains the presumed N-terminal domain of SseB.	3.49375e-19
CP027022.1\|AVH98325.1\|6022308_6023094_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|180371	PRK06057, PRK06057, short chain dehydrogenase; Provisional.	0
CP027022.1\|AVH98322.1\|6018756_6019485_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	2.80959e-33
CP027022.1\|AVH98320.1\|6016424_6017117_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	3.40762e-82
CP027022.1\|AVH98321.1\|6017147_6018629_-\|ethanolamine-permease	gnl\|CDD\|129986	TIGR00908, putative_ethanolamine_permease, ethanolamine permease. The three genes used as the seed for this model (from Burkholderia pseudomallei, Pseudomonas aeruginosa and Clostridium acetobutylicum are all adjacent to genes for the catabolism of ethanolamine. Most if not all of the hits to this model have a similar arrangement of genes. This group is a member of the Amino Acid-Polyamine-Organocation (APC) Superfamily. [Transport and binding proteins, Amino acids, peptides and amines].	1.26623e-136
CP027022.1\|AVH98330.1\|6028756_6029455_+\|translation-initiation-factor-IF-3	gnl\|CDD\|234582	PRK00028, infC, translation initiation factor IF-3; Reviewed.	2.88588e-98
CP027022.1\|AVH98323.1\|6019574_6020939_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.12555e-144
CP027022.1\|AVH98333.1\|6030478_6031318_+\|RNA-methyltransferase	gnl\|CDD\|223640	COG0566, SpoU, rRNA methylases [Translation, ribosomal structure and biogenesis].	4.95054e-65
CP027022.1\|AVH98327.1\|6025992_6027174_+\|type-VII-secretion-associated-serine-protease-mycosin	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	4.1826e-93
CP027022.1\|AVH98326.1\|6023161_6024364_-\|amino-acid-deaminase/aldolase	gnl\|CDD\|143488	cd06813, PLPDE_III_DSD_D-TA_like_2, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible members of this family also form dimers in solution.	0
CP027022.1\|AVH98335.1\|6033998_6036527_+\|phenylalanine--tRNA-ligase-subunit-beta	gnl\|CDD\|234804	PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed.	0
CP027022.1\|AVH98337.1\|6037176_6037644_+\|DUF4240-domain-containing-protein	gnl\|CDD\|379426	pfam14024, DUF4240, Protein of unknown function (DUF4240). This presumed domain is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 169 and 263 amino acids in length. This domain is often associated with the WGR domain pfam05406.	1.37562e-16

>CP027022.1|AVH98328.1|6027238_6027973_+|hypothetical-protein
MALKNIPDPGFSDDDGTADPRLAAALAAWAEDRTAHGPVLEALRGARLLVPVVAVLGEVETDENGLRREKTSDMAVPTLTAGDRRALPAFTSTASLALWDPQARPVAVPLHQALQAVAHEKADTLLLDLAGPVPYQVTGPALLALAEGRTSADPLDDPAVREAVRAAVAAEPAVLRAHLGPGTADGTLALVLAGDASPAEAAQRVARALAADETLRARLVRGLDLALLPASATPPGEPFYVRNV
>CP027022.1|AVH98327.1|6025992_6027174_+|type-VII-secretion-associated-serine-protease-mycosin
MNRSVRRRARAGAAVLLAAAFSVLPATTAPAHADTIRARQWGLEALRTTEAWRTTRGEGITVAVLDTGVDAEHPDLEGSVLPGHDLIGFGAARGDRAWAQHGTAMAGIIAGHGHGPDGEDGVLGIAPEAEILPVRVILESSDKARDKARKSRGTALAQGIRWAADHGADVINLSLGDDSESAHPDAGEDAAVQYALSKGVAVVASAGNGGEKGDHASYPAAYPGVIAVTAVDRYGTRASFSTRRWYATVSAPGVDIVMAYPDRRYYEGWGTSAAAAFVSGAVALVRAAHPDLTPAQIKTLLIDTARSRPEGGRSDAKGYGTVDPAAAIEAGARLKGGDPKNTAAGYQGRHFGPGPTAPAEEPRSFGLLAPLLGGLGALLLLTAVVLRRTPRAD
>CP027022.1|AVH99888.1|6025222_6025996_+|hypothetical-protein
MRPVRDRRSAGRTAAAAACAVLGFGLIGGALAGVWLAASEPGKPAEPVGYAEARELWHNAPVDALFPQTLPGPGAGPGAADRTWTRIVVAPDAPCSPAVLAKGLLAAVEPLGCERVLRATYTDATASSVITVGLVFTRADATAQRTLGEGLTARLGQDVPPALSGPSTVAARFGDRQRASWWTSAPADLPVVVTAVSGFADGRAVDAPQPADKATAKGRTDAVAQSGLGHEAKGITERLERLLRTTATTAAKEKEAR
>CP027022.1|AVH98326.1|6023161_6024364_-|amino-acid-deaminase/aldolase
MTPRAGDRARYDRATAHLDAPVAIVDLEAFDANAADLVRRAGGKPIRVASKSVRCRALLERALAREGFAGIMSFTLDESLWLARAGFEDVLLAYPSADRAGFGELARDPKLAAAVTVMVDDVAQLDLVDASRAGGTEEVRVCLELDTALSLLGGRIRIGARRSPLREPAELAELARSVVRRPGFRLVGIMAYEGHVAGVGDAVAGRPLRSRAIRLMQSAARRELAERRAAVVRAVRAVAPDLEFVNGGGTGSVQHTAAEEAVTEIAAGSGFFVPRLFDHYTSFSGRPAALFAQPVVRRPGVGVVTVLGGGYPASGVAGPDRLPVPYLPEGLRYDPQEGAGEVQTPLLGSPADDLRIGDKVWFRHAKAGELCERFESLHLVEGDRITATVPTYRGEGRTFL
>CP027022.1|AVH98325.1|6022308_6023094_+|3-oxoacyl-ACP-reductase
MTTEEIICRRLVGRTAVITGAGSGIGLATARRLASEGANVVCGDIDETAGKAAAEEVGGTFVRVDVTDPEQVEALFRTAFDTYGSVDVAFNNAGISPPDDDSILETGLEAWKRVQDVNLTSVYLCCKAALPYMRRQGRGSIINTASFVAIMGAATSQISYTASKGGVLAMSRELGVQFAREGIRVNALCPGPVNTPLLQELFAKDPERAARRLVHIPVGRFAEADEIAAAVAFLASDDSSFVNATDFLVDGGIAGAYVTPL
>CP027022.1|AVH98324.1|6020935_6022312_+|aldehyde-dehydrogenase
MRKELLQVLNPATEEHVADVPAATPADVDAAVTRAAAAQRGWAAAAPADRARLLRRFAAAVDEHVEELARLEVTEAGHTLGNARWEAGNVRDLLEFSAGGVERLNGRQIPVAGGLDVTILEPLGVVGVIAPWNFPMPIAAWATAPALAAGNAVILKPAETTPLTALRLAELALEAGLPEGLFQVLPGTGPVAGNALVEHPGVAKIVFTGSTRVGKAVMAKCAERVKRVTLELGGKSPNVVFADADLEAAAAAAPMSFLDNSGQDCCARTRILVQRSAYDRFLELLAPAIEEIVVGDPSDERTQMGPLISRAQLDRVRSYVPDTLEGIRGKAPEGPGFWFPPTVLTGLPEDAPCAVEEVFGPVAVVLPFEDEADAVRLANATEYGLSGSIWTRDLGRALRVSRAVRAGNLSVNSHSSVRYWTPFGGYQQSGLGRELGPDALTAFTETKNVFLSTEARTA
>CP027022.1|AVH98323.1|6019574_6020939_+|glutamine-synthetase
MADRTPPLRVEELRALVASGEIDTVVLAFPDMQGRLQGKRFAARFFLDDVLGHGTEGCNYLLAVDTEMNTVDGYEMSSWDRGYGDFAMHPDLTTLRRVPWNEATAMVTADLAWADGTPVAAAPRQILRRQLERLAEHGLTAHVGTELEFIVFKDSYEQAWDANYRGLTPVNQYNVDYSVLGTGRVEPLLRRIRNEMTAAGLTVESAKGECNPGQHEIAFKYDEALTTCDQHAVYKTGAKEIAAQEGHSLTFMAKYNEREGNSCHIHLSLQNAAGENVMAGDDEHGMSGTMRHFLAGQLAALRDFSLLYAPNINSYKRFQPGSFAPTAVAWGHDNRTCALRVVGHGRSTRFENRLPGGDVNPYLAVAGLVAAGLHGIEQRLELPEPCTGNAYAADYAHVPTTLREAAELWETSEIAKAAFGPEVVAHYRNMARVELDAFDAAVTDWELRRSFERL
>CP027022.1|AVH98322.1|6018756_6019485_-|FadR-family-transcriptional-regulator
MASTSESADRLTPVLRPVRAGNGFEEALEQILQVVRLGLVPDGERLPAERELAERMGISRVTLREVLKVLQEQGLVESRRGRYGGTFVLPRVRTGDEDELRRRIASVDVEDTLRFREVLEVGAAGLCAAHGLDAAGAERLRSALAATHDAPLGDYRRQDTLLHLTLAELSGSPSLTARYAAVRATVNDLLDCIPLLVRNLEHSQHQHTALVEAVLDGDADAAREVMREHCAGTAALLRGFLT
>CP027022.1|AVH98321.1|6017147_6018629_-|ethanolamine-permease
MTLEDTTGSTSGKTPGDGKTPGAPPEDDYLKRRALRRGSAGWLLLTGLGVAYVVSGDFSGWNIGLSKGGFGGLAVATVLMGAMYACLVFALAELSAILPTAGGGYGFARRALGTWGGFLTGTAILIEYILAPAAISIFIGDYVESLGLFGLESGWPVYLVCFALFIGIHLWGVGEALRFSLVVTAIAVAALVVFALGAFTDFRVDGLNDIPVDGEAFGSNSWLPFGLLGIWAAFPFGMWFFLGVEGVPLAAEEAKDPVRSMPRALAISLGVLVLLAVMTFFAATGARGAAAIQEAGNPLVVALQGDGEPTALSRFVNYAGLAGLVASFFSLIYAGSRQLFALSRAGYLPRFLSLTSRRKSPYPGLLIPGAIGFALAAGTGNGARMLNIAVFGATISYALMALSHIVLRRREPHLHRPYRTPGGTLTSSTAFVLALSALVATFLVDRTAAFMALGVYVIALAYFAFYSRHHLVAKAPEEEFAALAAAEAELERG
>CP027022.1|AVH98320.1|6016424_6017117_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase
MSEPLIGVTTYLDRARWGVWDMEAALLPAPYPRLVRESGGLAVLLPPDRPAVAATVVARLDGLVVAGGADVEPVRYGAEPDPRTGPPARARDSWELALIDAALAAGTPLLGICRGMQLLNVALGGTLVQHLDGHVEAVGVIGRHKVEPVPGTRYASLVPETAEVPTYHHQAVDRLGAGLTASAHAEDGTVEAVELAAPAWALGVQWHPEMGEDTRVMRGLVQAAAARGRT
>CP027022.1|AVH98330.1|6028756_6029455_+|translation-initiation-factor-IF-3
MTCPSAKAVAWCYRGGSISAEPRINERIRVPEVRLVGPSGEQVGIVPLAKALELAQEYDLDLVEVAANARPPVCKLMDYGKFKYESAMKAREARKNQAHTVIKEMKLRPKIDPHDYDTKKGHVVRFLKQGDKVKITIMFRGREQSRPELGYRLLQRLAEDVQELGFIESNPKQDGRNMIMVLGPHKKKTEAMAEAREAQAARKAERQGGSSEAAAEAPEATAPETPAENAEA
>CP027022.1|AVH98331.1|6029582_6029777_+|50S-ribosomal-protein-L35
MPKNKTHSGAKKRFKVTGSGKILRERAGKRHLLEHKSSKLTRRLTGNAEMAPGDAAKIKKMLGI
>CP027022.1|AVH98332.1|6029883_6030270_+|50S-ribosomal-protein-L20
MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQLWIQRINAAARLNGMTYNRLIQGLKAANIEVDRKILAELAVNDANAFAALVEVAQKALPADVNAPKAAA
>CP027022.1|AVH98333.1|6030478_6031318_+|RNA-methyltransferase
MVTPELISPRSPRVVAARRLAKRNFRGKDRLFIAEGPQAVREAVEHRGPGGEPTLVELFTTVEAAERYAAIVDAARAAGARVHHASDAVLAEVSQTVTPQGLVGVCRFLDSPFEEIVAARPKLVAVLAHVRDPGNAGTVLRCADAAGADAVVLTDASVDLYNPKSVRASVGSLFHLPVAVGVPVEQAVAGLKAAGVRILAADGAGRDDLDDELDAGTMGGPTAWIFGNEAWGLPEETRALADAVVRVPIHGKAESLNLATAAAVCLYASARAQRPRTSA
>CP027022.1|AVH98334.1|6032871_6033999_+|phenylalanine--tRNA-ligase-subunit-alpha
MSAPNKSYDPVEVEALKPEEIERMRDEALAAFAAAGDLDALAHAKTAHTGGTSPLALANREIGALPPQAKAAAGKLVGQARGVVSKALAARQAELEAERDARVLVEEAVDVTLPYDRVPAGARHPLTTLMERVSDVFVSMGYEVAEGPEVEAEWFNFDALNFVPDHPARQMQDTFFVEGPEGTTGDESGVVLRTHTSPVQARTLIDREPPVYVVCPGRVYRTDELDATHTPVFHQIELLAVDEGLTMADLKGTLDHMVQALFGPDMKTRLRPNFFPFTEPSAEMDMLCYICRGESVGNPDRPCRTCGSEGWIELGGCGMVNPKVLVACGVDPEKYSGFAFGFGIERMLMFRHNVEDMRDMVEGDVRFTRPFGMEI
>CP027022.1|AVH98335.1|6033998_6036527_+|phenylalanine--tRNA-ligase-subunit-beta
MRVPLSWLREYVDLPATETGRDVQAKLISAGLEVETVEQLGAGLSGPLVVGRVLTIEELTEFKKPIRFCTVDVGQANGTGEPQEIICGARNFAEGDKVVVALPGAVLPGDFRIAERKTYGRVSRGMICSGDELGMGDDGSHGIIVLPPEHEVGTDATVLLELFDEVLDIAVTPDRGYCLSMRGVARETATAYGLPLRDPALLDVPAPNSYGYPVQITDPIGCDRFTARTVVGLAPEARSPIWLQRRLQKAGMRPISLAVDVTNYVMLELGQPLHAYDRTRLDGPIGVRRAEAGEKITTLDGTVRVLDAADLVITDNRGPIGIAGVMGGANTEIADPVLDPETGVVTGTSEVVVEAAHFDPISIARTARRHKLSSEASKRFERGVDPQAAAAAAQRTVDLLVLLAGGTAEAGVTEVVAPSAPRTIVIPADHPDKVAGVAYGRETVVRRLQEVGCDVYGQDELVVTVPSWRPDLNEPNDLAEEVIRLEGYENLPSTLPKPPAGRGLTERQRVHRRVGRALAGAGYVEALNYPFIGEQALDNLGLDADDARRRLVKLVNPLSDEEPALRTTLLPGLLGALRRNDSRGGHDLALFETGLVFRPEGRPGVAVRLPVDRRPTDEEIAEVNAVLPAQPRRVAVVLAGAREQAGWWGKGRPSDWADAVEAGRTVAAEAGVELIISADQHAPWHPGRCAAFHVEADGEKVLVGHAGELHPRVVKAFGLPARTCAMEIDLDLLEKANEGPLRAPRISSFPVATQDVALVVADGVPAAEVEAALREGAGELLESIRLFDVYTGDQLGEGTKSLAYALKFRAPDRTLTVDEATAARDAAVALATDRTGAVLRGA
>CP027022.1|AVH98336.1|6036681_6037050_-|hypothetical-protein
MAEVARDVKAGISGPECAGAVEMYPESLLRSTDSALETFEAEMRGLVEPSDEEVFGVVERVVLALNAVDDANHGGVGYCTEEREQLCEYIDLTLGEHGVDVVALAARKGIDRAEITDAWRDW
>CP027022.1|AVH98337.1|6037176_6037644_+|DUF4240-domain-containing-protein
MTWADFWALIATLDGEATQESCRHLAEELSRRPVPDIIGFAERHAEALYRLDQEKFGTLPVTDLTDRDGSPFPQSSDVFLYARCAVVAAGRTVWESVFFDVDRFAPYTSTEYDGEWLLYVPDKAYELATGEEWNRSTRYCYESYSNRDGWPHLRD
>CP027022.1|AVH98338.1|6037814_6039443_+|serine/threonine-protein-kinase
MPTRVRPAHPGDPSRVGPYRIIGRLGAGGMGTVHAALDPAGRRVALKLIHSAQADDGEFRARFKREVALSRRVSGPCLVALLDADTDAGHPWLATEYVPGPTLGQRVATDGPLTGAQLYALAAGTAAALAAIHEAGVVHRDIKPANVILAPSGPRVLDFGIAHALDGTSVTRTGVMTGTAGWISPEYYRTGTAGAAGDVFAWGALIAYAATGRLPFGTGAPDVVAFRVMSDEPDTAGVPDDLLAVVMSSLAKEPGDRPTPVVLAEKCTALLATQATSVLPLNANVPTVIGDFVAAHWGMPTQDDPAWTLARRRPLRRRAGLLAIAGLMAFAVAMGATYALRGQHPATPASPTAIRSGDRPVPAPKSPTSPVPTSPSTGTLPGAGASATCLPVTYKFPDGESSCASKKEICADGAPWYVSDIDALCGEHSSTRVVHLVSQPETGGDPGTPFCIAWIGEGTGADRSGALLLNAPGYQCGATLVGAVDGQAVHLDGGPGVFYDSPQDCTPSYPGTRLTYPAILDYSRLDVEMPPAHVCLLEHVGA
>CP027022.1|AVH98339.1|6040046_6041111_+|serine/threonine-protein-phosphatase
MIRTRSLDSDGSRLRRLAPLAPPAAWGAVAVAWKFACPSAREPGLPIRIATSVVFLSVGIGLVLGVRRGLARELARARAVAEATQQVLLRPPPGRLEGLTLAAGQLSASRGASVGGDLYEAVATPYGVRIVVGDVRGHGLAALGAVVALLGSFREAAHDEPELAGVLRRLERALERHLRERARDEHPARAGTDPEHPAAEEFVTLLLLEIGPDGRLSVFNCGHPGPYRLGREAERLPVGDPLPPLGVLPLPAGLAPYTAARLLPGETLVLHTDGAEEARDHRGRFFALDAALAGPPGEAPAALVRRVHAELLHHTGGRLADDIALLVVRNDRARVPAQPAEPGLRRPRPAPSSP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027022_23

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027022_23

7089486-7089635

Orphan

Consensus_repeat	Method
GACCCGGCCACGCGCGCGGGTACGGCAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP027022_23

>merge|CP027022|23|7089486-7089635|CRISPRCasFinder
GACCCGGCCACGCGCGCGGGTACGGCACTCGTCCGGTTCGTCCTTGGGCTCGTCGTCCGGCGACCCGGCCACGCGCGCCGGTACGGCACCGGATCCTCGTCACCGTCACTGGCCGGCCCGACGGCCCGGCCACGCGCGCGGATACGGCAC

>CP027022|23|22|7089486-7089635|CRISPRCasFinder
GACCCGGCCACGCGCGCGGGTACGGCAC	TCGTCCGGTTCGTCCTTGGGCTCGTCGTCCGGC
GACCCGGCCACGCGCGCCGGTACGGCAC	CGGATCCTCGTCACCGTCACTGGCCGGCCCGAC
GGCCCGGCCACGCGCGCGGATACGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP027022.1\|AVH99100.1\|7098358_7098958_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378696
CP027022.1\|AVH99089.1\|7082185_7082680_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
CP027022.1\|AVH99992.1\|7098005_7098314_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH99087.1\|7077955_7079077_+\|ATPase	unknown	unknown	gnl\|CDD\|336785
CP027022.1\|AVH99103.1\|7101718_7102105_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365997
CP027022.1\|AVH99088.1\|7079073_7082046_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH99093.1\|7086196_7088263_+\|NAD-dependent-DNA-ligase-LigA	unknown	unknown	gnl\|CDD\|236137
CP027022.1\|AVH99104.1\|7102258_7103749_+\|sugar-porter-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340917
CP027022.1\|AVH99092.1\|7085027_7085906_-\|peptidoglycan-binding-protein	unknown	unknown	gnl\|CDD\|366659
CP027022.1\|AVH99086.1\|7076501_7077896_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|283431
CP027022.1\|AVH99090.1\|7082690_7083362_-\|RNA-2',3'-cyclic-phosphodiesterase	unknown	unknown	gnl\|CDD\|274058
CP027022.1\|AVH99098.1\|7096305_7096593_-\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH99102.1\|7100594_7101614_+\|DUF4073-domain-containing-protein	unknown	unknown	gnl\|CDD\|277347
CP027022.1\|AVH99091.1\|7083541_7084972_-\|choice-of-anchor-A-family-protein	unknown	unknown	gnl\|CDD\|275059
CP027022.1\|AVH99097.1\|7094350_7096309_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|270916
CP027022.1\|AVH99096.1\|7091419_7094086_+\|alanine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234701
CP027022.1\|AVH99094.1\|7088419_7089256_-\|DUF2071-domain-containing-protein	unknown	unknown	gnl\|CDD\|378271
CP027022.1\|AVH99099.1\|7096721_7097777_-\|mechanosensitive-ion-channel-protein	unknown	unknown	gnl\|CDD\|366370
CP027022.1\|AVH99990.1\|7075071_7076505_+\|hypothetical-protein	unknown	unknown	unknown
CP027022.1\|AVH99101.1\|7098996_7100397_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863

Protein	Function_ID	Function_description	E-value
CP027022.1\|AVH99100.1\|7098358_7098958_-\|hypothetical-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	2.06592e-06
CP027022.1\|AVH99089.1\|7082185_7082680_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	4.54221e-08
CP027022.1\|AVH99087.1\|7077955_7079077_+\|ATPase	gnl\|CDD\|336785	pfam07728, AAA_5, AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.	6.59376e-42
CP027022.1\|AVH99103.1\|7101718_7102105_+\|hypothetical-protein	gnl\|CDD\|365997	pfam00280, potato_inhibit, Potato inhibitor I family.	4.34019e-21
CP027022.1\|AVH99102.1\|7100594_7101614_+\|DUF4073-domain-containing-protein	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.43746e-11
CP027022.1\|AVH99093.1\|7086196_7088263_+\|NAD-dependent-DNA-ligase-LigA	gnl\|CDD\|236137	PRK07956, ligA, NAD-dependent DNA ligase LigA; Validated.	0
CP027022.1\|AVH99104.1\|7102258_7103749_+\|sugar-porter-family-MFS-transporter	gnl\|CDD\|340917	cd17359, MFS_XylE_like, D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily. This subfamily includes bacterial transporters such as D-xylose-proton symporter (XylE or XylT), arabinose-proton symporter (AraE), galactose-proton symporter (GalP), major myo-inositol transporter IolT, glucose transport protein, putative metabolite transport proteins YfiG, YncC, and YwtG, and similar proteins. The symporters XylE, AraE, and GalP facilitate the uptake of D-xylose, arabinose, and galactose, respectively, across the boundary membrane with the concomitant transport of protons into the cell. IolT is involved in polyol metabolism and myo-inositol degradation into acetyl-CoA. The XylE-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.14537e-132
CP027022.1\|AVH99092.1\|7085027_7085906_-\|peptidoglycan-binding-protein	gnl\|CDD\|366659	pfam01471, PG_binding_1, Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.	1.62927e-13
CP027022.1\|AVH99086.1\|7076501_7077896_+\|VWA-domain-containing-protein	gnl\|CDD\|283431	pfam05762, VWA_CoxE, VWA domain containing CoxE-like protein. This family is annotated by SMART as containing a VWA (von Willebrand factor type A) domain. The exact function of this family is unknown. It is found as part of a CO oxidising (Cox) system operon is several bacteria.	8.83621e-18
CP027022.1\|AVH99090.1\|7082690_7083362_-\|RNA-2',3'-cyclic-phosphodiesterase	gnl\|CDD\|274058	TIGR02258, UPF0097_protein_AF_2157, 2'-5' RNA ligase. This protein family consists of bacterial and archaeal proteins with two tandem copies of Pfam domain pfam02834. Members for which activity has been measured perform a reversible, ATP-independent 2'-5'-ligation of what is presumably a non-phyiological substrate: half-tRNA splice intermediates from an intron-containing yeast tRNA. The physiological substrate(s) in prokaryotes may include small 2'-5'-link-containing oligonucleotides, perhaps with regulatory or biosynthetic roles. [Transcription, RNA processing].	2.04295e-31
CP027022.1\|AVH99101.1\|7098996_7100397_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.93e-15
CP027022.1\|AVH99091.1\|7083541_7084972_-\|choice-of-anchor-A-family-protein	gnl\|CDD\|275059	TIGR04215, conserved_hypothetical_protein, choice-of-anchor A domain. This domain may occur as essentially the full length of a protein, except for an N-terminal sequence and a C-terminal protein-sorting signal such as PEP-CTERM or LPXTG. Most often, the putative surface protein is longer and contains repetitive sequence regions. This is one of very few domains for which both anchoring domains occur, and designated choice-of-anchor A domain. The best characterized member is Bacillus anthracis protein BA0871, a collagen-binding protein with five CNA-family protein B-type repeats toward the C-terminus and an LPXTG cell wall attachment motif.	8.5795e-42
CP027022.1\|AVH99097.1\|7094350_7096309_+\|MFS-transporter	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	2.30745e-76
CP027022.1\|AVH99096.1\|7091419_7094086_+\|alanine--tRNA-ligase	gnl\|CDD\|234701	PRK00252, alaS, alanyl-tRNA synthetase; Reviewed.	0
CP027022.1\|AVH99094.1\|7088419_7089256_-\|DUF2071-domain-containing-protein	gnl\|CDD\|378271	pfam09844, DUF2071, Uncharacterized conserved protein (COG2071). This conserved protein (similar to YgjF), found in various prokaryotes, has no known function.	3.16871e-87
CP027022.1\|AVH99099.1\|7096721_7097777_-\|mechanosensitive-ion-channel-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	8.49694e-26

>CP027022.1|AVH99094.1|7088419_7089256_-|DUF2071-domain-containing-protein
MPPTQTAPEPEPVSADPPSRTGRTLLTQSWLDLAFLHWPVEPAEVAPLLPAGTAPDTLDGVTYVGLVAFRMHRVGWFRLPGLPYLGSFPETNVRLYSVDAHGRRGVVFRSLDASRLVPVAVGRWAFRIPYVWSRMSVRYDGSTVAYESSRRWPGPRGARSAIAVEVGEPVEEPTALEHFLTARWGMHSAFRGRPLYLPNTHPRWPLHRARLLRCDETLVEAAGLHRPLGEPVSVLYSPGVPVRFGGPPRLPAGVSVPRPRSGGDRAVGGEGSPPRPRP
>CP027022.1|AVH99093.1|7086196_7088263_+|NAD-dependent-DNA-ligase-LigA
MTNVSAVEAPFRMSGRAEYEAAVQRLRDASRTYYGAGYSLMDDAAYDRLRLAVLDWEAEHPDETAPDSPTGRVADGAAPAGDVAHTARLLSLDNVFTPEQLTAWGASLRRRLGHEPAGGFTVEPKMDGAAVAARYRDGRLTQIITRGDGTHGEDASHVIGTVVGLPEQLPVPATFEARGEVLFTQEQFEAANETRAAHGAGVFANPRNGTAGTLRAKDRPYRLAMTFWAYGAVELDGVPFLPAGAGHAETLAAVARAGVRTTADTPAGLHTVATLDEAQEKVDAIAALRASLPFGIDGVVVKADSATEQATAGFGTRFPYWAVAYKLPAVERQTVLQDVFWEVGRTGVLAPTAVLAPVELDGSTVTRATLHNPADILRRDLHIGDTVTVYKAGDIIPRVQAAVVELRPQDAVPVPLPHECPHCGGGIDKSQERWRCAKGTACALAPLIEYAAGRDILDIDGLGRKYVDALIASGDVGDVADLFTLTEEQLTAASGSAKRGARLAEQIRLAKTRPLSRVFCALGVPGTGRSMSRRIAAHFGTMEAIRAADADTLQDVEGIGPEKAPVVVEQVAVLAPVIDKLIAAGVTMTEPRPERAEDAAEGPLSGKTVVVTGKMTGPLDGWGRSEMGALIERAGGRMGGSVNSRTAFLVAAPTAGGKPSSKAVKAQEAGVEVLTPEDFAALVADHLE
>CP027022.1|AVH99092.1|7085027_7085906_-|peptidoglycan-binding-protein
MRNRAAPTTAAASVTRESAGAEHRGERVFGKVAEPRPDGTGARGQDIELFDATVRLPKVPSGAAEAPAPGPRRSRRARAAAPAWRSMPLPLMLAGALSAGFGAAVAVWVSAEPDSVPASHPSVSLPVLATRAPSPAPEAASDASPSPAASTARTTPSAPPAPGPSDSSSKTPSPSATPPTSSPSTTAASSPATTPTPTPSSSHRHRPSHPDRDEEERHEGKRGGIARGSTGPEVADLQRRLQEVESYAGPADGIFDETLETALRRYQASRYIPQEDGVYGPLTRAVLRAETD
>CP027022.1|AVH99091.1|7083541_7084972_-|choice-of-anchor-A-family-protein
MSNTGRARARLSSAVAVALVLGLTTAGNALAVPSAPAPGTTRTCPAPGQEPGIGHEPRFLDANVALYAGGDYTADGATAEAEGLLVIGGDATFAKGSGGTFNVGRVGAGSGILPDSGAVMLSVGGNLTIAEGTRVDVGHGLTAGPRYGGAVRVGGEIDEKGALETNGGSRASGLGARGALAPYDTFGDTVRGESASLGALKTTGTSVRSGGTVTFTGGGSGGPQVFEISAEELDGASSFDFRSIPEGASVVVNVTGGGSVGISPLSVAFNGERVDVYGSARFGEAASRILYNFVAAPSIALGGGGNFMGSILAPKASADLTASTNGRVYVGGDLRTHGSGNETHNYPWNGSSTFSCKTTPGGPGTTPAPTPTKPGTEPSAPAPSATPSAGEPTPPGTPETTAPGTSEPSAPPTEDASAPAVPGTTAPSPSATDDGDGSLATTGAQFTPYAVAAGVLAAAGAGILVLTRRRRALGRH
>CP027022.1|AVH99090.1|7082690_7083362_-|RNA-2',3'-cyclic-phosphodiesterase
MGEGPGRVARSDGRAGAGEVGEVGGTDGVGGDEQARSATVRVFIALAPPDDAKGELAEALGPAYEAYPRMRWNRIEDWHITLAFLGELPVATVPLLRAPLADLAASRRPVELALRGGGHFDDRVLWSGIDGDLEGLHGLATEVRAVVGECGIPFEGRPLRPHLTLARARRDDPSSVLEAAAGLAGFSGRRWRAARLHLVGSDFGRGPGPIRYRDVESWPFGGA
>CP027022.1|AVH99089.1|7082185_7082680_+|hypothetical-protein
MHARRTAYLLTAVLLTAGCVAVPHGPAPDPTDRPAALAPAAERAPAPLPTWPDPTPAAPREALATTEPRTAPAPAPASPRPAAAPPPERTRKETGRKKEPTKKNRTRAVLRPPKKNQPPKKDRPRSRPSAPAAGQPELRRLCRQAERIDAPMGAADLCRRVYGP
>CP027022.1|AVH99088.1|7079073_7082046_+|hypothetical-protein
MSAAPDPRTAPGAGTGPGRVFASLRAQLHAAAEEFAGGPDALEGILLGMVDDVDRTVREPLEIFPVCHHSPASALAMARRLREKRPKVVYLELCEDMAPLLTELRNCRLPVAVQAFASDIDGFPPDWAPLSVVAPITEASAEYQAVAYALDTPGVELVLVDRSSDHVFQWDARRPAGDDQEEETREDGAALHGEAVGVEIGDLRPRFAELEEHLLRHGRVRHWSEWWHQYVEVPLGDGDHDTYRQVMFLIGSLFRRLAPGDGDRVRVDEDRERHMWTRMREHLAATGTDPADCLYVCGAFHAASRVEEFGVHGADGFEISPRTTTTWQYGLIPSSHAAIEAQFGLASGSVSIAAAQWAKNLRRTRVKPYRLEGQAGTKKTPEKKTPAERAAAPAAIPDLGPAPAPAPAEDRLSGFLRRPPVLDTLDEAELLGWSVDVVRAARRNGYLASTADAIAVFETSILLAGMRDRAKPTPYDFQDAAVTCIEKDGVPGRRDVRRIVEIMMGGDRIGRVGYEALPPLARDVHDRLAPLELNLQQRGVRRALLDMASRPELRSCSDVLWMLRRLMPHGAARPVMGERRLGERSVQESWDLALGTHQRALIELGYEGVSLEQVLEQRLRRTAHGARATTAEVLAAVEDATLYLGGRRLADELGHRALEVLAGERTVDGAPEVLRRVRGLLAYYRTAEPVLPPWIESFVRTGYAHYCTLLPTAFQDEDATTGQVAAMLGFLFSMEGLALSLGCDRTQLELAVAQSHPKDPAKTALLWAAQVQLGTLSRQELRARCDELLASPLVVPSYPRYLSGFVHALEPVPGLADVVVEAVSNAFGRLPDAVLLPWLPVLITTLRSNAGDLAPLLIREAGRIFPARLPALDDWIPPWRRPPAAPRAARPGPAVGAPRGAALLPAHPATCDALAELLGCAGEWAPAGGPPPAATGAALLPVHPDTCDALARLLGCDEPWAPAGTAPRPPSLTGRHPDTAHAVAALLADR
>CP027022.1|AVH99087.1|7077955_7079077_+|ATPase
MSDLLRAPAEIKYAEELDWLESIDDSPKPFSWRLSPKMVRLFVLGSERADGLDREVAQKWFGDRSFVERSIVTLASDRGLLLIGDPGTGKSWLAELLAAAISRNSTQVVQGTAGTTEDHIKYSWNVSMVIAKGQSRASMIPSPIMTAMETGTIGRFEELTRSTSDVQDALISILSEKYISVPELDGADGENIVFAKPGFSVIATANSRDRGVNDLSSALKRRFNFVRIPVVTNKKSEAEIVRFRTEELLRRHRIELDVPPTLLDVLLQSFADLRASAAAAGGDDEKLESALSTAEQIGVLEDSILHGNFFGERTLTARTLAASLVGTLARREPEDLAILNKYLHGVVEPRSKEEGGSWPEFLEGGREAIAKLA
>CP027022.1|AVH99086.1|7076501_7077896_+|VWA-domain-containing-protein
MTDPTAPASAGTSSTGTASTAPAPVPDPDDNRRQVLYWRLLARLFDPEEQPALESASLAVVEDIGLPPALLDPGASVDSVVQRHPDLADEFDGLMTPEAEPDGDRDRAAEVRRAALASKLLLNVFSTGSGAVSAGQLARWQSDTGWLERALGCPPGGLRGGRATGPVGGLGPELGSLEADLVSRMRLREVLADPKLAARLTPSMSLIEQLLRDKGNLSGVALANAKSLIRRYVDQVAEVLRTQVEKATAGELDRSVPPKRVFRNLDLDRTIWKNLTNWSPEEERLYVDRLYYRHTTRRTTPQRLIVVVDQSGSMVDSMVNCTILASIFAGLPKVDVHLVAYDTRAIDLTPWVRDPFDVLLRTNLGGGNDGPVAMAMARPKIAEPKNTVMVWISDFYEFDRSQPLYEGIEAVHRSGVRFIPVGSVTSSGRQEVNPWFRERFKALGTPVVSGRVDKLVHELKTFLT
>CP027022.1|AVH99990.1|7075071_7076505_+|hypothetical-protein
MVPADEGGGLMRVDLLTDPLDGLDEALDAVDAFDRVLVAGLLRPGPEQADGLAALVDAVAGTPLATRVAEAADKAAAGAAGEDHFVALAAARTALMGSAHDALTARVADATGRPPAEPTPPGSVGAVEEEPAAHVLAAARAWLCDLARAGWRGIDHDLVGGAAPVVSALLPDPALRRQATLLDGFAAELAASCPGTTLERVPVRRWADLWTRALLLTLPGATRPAAVSTATGRLLPLGIDLQEHATAVQAQVHAVFEPADGTAPRLVRAAVSAPKPDTVVGAGLWQLLRPRMSLLAAAGEGRSVELDAVPLTAGGDLLWDDGRARTGEPADPFATARVILSTATDPVTAPLDRHPSRIAVPVLLEGYAAERTDDGPTVLTVAGHRLAVDTDRIPDAGPLTPEAVAASGACLGLLRWDAGEFVLQPLAVETTVRKKTTAVHAGAWAGGTTDKAGVRAEKAATDAVAVLRERAGKLLRT
>CP027022.1|AVH99096.1|7091419_7094086_+|alanine--tRNA-ligase
MRTADIRQRFLDYFAARGHTVVPSAPLPTPDPTLLFVNAGMVPFKPYFTGEAAPLWQRATSVQKCVRTLDIEEVGKTTRHGSFFQMNGNFSFGDYFKEEAVAFAWDLSTKPWTEGGYGLDPERIWVTVHHSDTDARGIWREVAGLPDERIVARGDEDNFWSMGVPGPCGPCSELYYDRGPALGREGGPAVDEDRYMEFWNLVFMQYERGEGPGKTGYPILGDLPRRNIDTGMGLERMATLLQGVDNLYEIDETRPVLDRAADLAGVRYGADAESDVRLRVVADHVRTALMLLADGTAPGNEGRGYVLRRILRRSVRSMRQLGFQAPALPELLPVARDCMAPSYPEVVASYARISDQAYGEEDAFRATLKQGTTVLDTAVAGVKADGGRSLPGAQAFLLHDTYGFPIDLTLEMAAEQGVEVDREGFTALMNEQRERARTDARARKSGGTADTAALRTVLDAHGPTDWRAWDTLTTESRVLALLGAEGPVPVARTGDLVTVVLDRTPFYAESGGQDSDAGLLSGASVEAGVVDVQRPLPGLVVHRVRITAGELAVDDTVHAAVDPEWRLGARQAHSGTHVLHAALREVLGPTALQSGSYNRPGYLRLDFPWRGALSPAVRSEVEEAANRALRRDLPVGVRWTTLSEAKELGALALFDETYGEKVRVVEIGGPWSRELCGGTHVDHASQIGTVALTAESSVGAGMRRLEAAVGIEGFGYLARERDLVGRIAEQLNAPRTELPEKIAGLLDRLKAADRENARLKAKATAGRAAELAGQAVEAGDTLVVTATVDGAADEARALALAVRDRLPPARPGVVAVATSSGGLVLTVNAPAREAGRNASETVKQLLGGRGGGSPEIAQGGGVPAGDLAAILADLPRVVPGGHGQSEGG
>CP027022.1|AVH99097.1|7094350_7096309_+|MFS-transporter
MEQLTGTDPAHIGPYRLIARLGAGGMGLVYLGRSDLGRTVAVKVVQAEHAQHTEFRRRFAREVAAARRVGGAWTADVLDADTEAEVPWVATQYIPGPDLTTVVAEDFGPLPEASVRTLANRLALALQAVHEAGLIHRDLKPSNVLVTVDGPRVIDFGIARAMDGLAGDSLHTRTGMLIGSPGFMSPEQVRGLELTPASDVFCLGALLVYAATGRLLFGATDSGLNAHLFRIAEEEPDLAGVPDALVDLVRACLHKDPARRPTPREVASRTAADQDGEWLPGPVLAQLGRRAAHLLDYAPAVPAGADAAAVRPTPRPHPAAPTPPPPAYVPTVPAQSAAPGFGAPADPPPGSWNASTTPAAAPEAPLPRRWWGLVALALAQALVLADAAFSSRAMLWWGAGSDLGLAAGMKVTSTVYLDVMPVAHALAFAGVLLFGTRVADLVGRKRMLVIGLLGFAVAAALGGAATSSTVWITGRALQGAFAALISSSVPALLSTSFTDPRERRKAFGIHTAIAGGAPALGLLAFWLFPIGPNWRWCLFGAVPLALAVVIAVAVLVHDRPGRVGLRFDGPWVLLGAAGIIGIGGAVPYFEGHLLLVPVAGVLLAAFVWRQTRTAAALATPPGPGAPRGSFLAAALANALAAVLLMAVGLLHF
>CP027022.1|AVH99098.1|7096305_7096593_-|hypothetical-protein
MLSLALVVLAVVAVFGSFVLCVVTVTRMRELPTWRRFLPLTLLLIALSASLLRAADIRWVAEAIAFPLNLAVVLLSTYEIRARRLRNRREAAKAA
>CP027022.1|AVH99099.1|7096721_7097777_-|mechanosensitive-ion-channel-protein
MESVLRLVASVGGSALVAFVVVRAVDLLARHADARHHETPLWGLLRRCRTPLFVVLLTALLRWTYPASAFSVLEEHADVVGHVLLLCLIGGGAWLAIRATSAVVESSYARYAGRARDAARLRRVRTQVTLIMRVVSAAVGVLAGAAALVTFPSFRTLGTSLLASAGIIGIVAGVAAQSTLGNLFAGFQIAFGDMVRIGDTVVVDGEWGTVEEVTLTFLTVRTWDERRVTLPVSYFTSRPFENWSRGGVQMTGSVFVHCDHSTPVALMRAHLREFLADCPTWDGRGWDLAVTDTSPTSITVRAIVTAKDPDDLWTTRCAVREELVRWIAREHPGALPRVVTASAPGESDKAA
>CP027022.1|AVH99992.1|7098005_7098314_+|hypothetical-protein
MRGDRSGRTFRRVDIPLTFRWVFVALVVLQLVALVPVLRRLCDPAPERRTEARLRLLDAAGSVTFLAGFALDHPALVLSGLVCVGAVYAAKGVLWYRARERT
>CP027022.1|AVH99100.1|7098358_7098958_-|hypothetical-protein
MRYILPVSFPLDDRSARHSVQTTARRTVDLVNALSGDSSDPAEVAAVLRAYGEAEPLDLTAHDVAGMRAAAALLREVFAAEDVGGAAAVLNRLLREHTGPLRLSSHGGGSPWHPHLDSDDDAPWDEWLLASSCMALTVLLWDRRRAPGGVCASSGCRNVFLAQGAGQERRYCSRRCATRERVAAHRRSRAAGREGGVPR
>CP027022.1|AVH99101.1|7098996_7100397_+|MFS-transporter
MKRRYSFPVHLTGAAVARTGDEMAGPALVLAGLALTGSAADASLLLAGVTVSSVLGGPVLGSLLDRAERPGRLLAAALALYAAGLTAVLVGLGRLPFALTLAAAVLTGLLGPALSGGWTAQLPAAVRDDRLDRANALDAMTFGAAGLAGPALAGGTAEALGAPTAVVVSAALVALALPAAWALPARTDPTPKSPTRGGRPRPVPSGPVPPGPVPPVPVLSDPAPPVPAPPVPVPPVPVPSDPVPPGSAPSVPVPSGPLVGPAVGLAVGLAVDLAAGLRAVVRSPALARATLTSVVSCTAQGMLTACLALLGERVLGGAGRGAMLLSCAAVSALAANAVLARFPRAIAPDTLLWTGALLQAAAPAAAVLGHPTVLVAAAFVAGIGEGPQLTALFAVRHREAPERLRSQIFTTGAGLKITGFALGAVVAGPVAARSLTGALLLATGTAVLAALAFFAVPAARGRAAPA
>CP027022.1|AVH99102.1|7100594_7101614_+|DUF4073-domain-containing-protein
MDRRSLLTAATGAVGAVAASQVPAGAATPAHTGPGRPVTAFNVISDIQGDLRDLGVALEDMHRTNPRSSGLAVAGDITPRGYDAEYAEVSAELARHPHARTVAWAIGNHEFYVPKWRDPSTLAQDTWPNGTTEDSLFRSFHRFAGRNTVHAEHSFGGIPVLSLGTEKYMHYHDPKLWDEVWLSEAQFSWLEQRLAYWARRRRPVMVVTHHPLPNTVSGSHNRLYSRDYLQADRLLGILGRHRDVFLFCGHTHWDLALSDWYVRRVVPGTANLDGFSVVNTGAVQTGFTDDGKGGEVAVPGTFNQGLQVEVFHDRVVVRARDFAAGRWLKRITVPLSTWI
>CP027022.1|AVH99103.1|7101718_7102105_+|hypothetical-protein
MVLPDVKKTLLAALAAASATALIAPAVATAAPEPADVAATTATAVPAALAAAALPGAPAADHAGTRTQWPETLGLPKAWAEKVILRDRPDLEIEHIPEGALVTMDYREDRVRIVHNALGLVSQVPAIG
>CP027022.1|AVH99104.1|7102258_7103749_+|sugar-porter-family-MFS-transporter
MVQGFSREPGTHGPLTEVAPEGIRRITLWAAAIALGGFLFGFDTGVVSGALLYIKEDFDLNSFEQGSVVSVLLIGAVVGATSAGRLADRLGRRKALRLIGVVFVVGTAIAALANGYLTLMAGRIVLGLSVGAASATVPVYLSEISPTKIRGRLLTMNQLMITIGILVAYLVNLAFASSEAWRAMFAVGAIPALLMIAATLWLLPESPQWLIAHGQEDVARRGIAELTDEATADELIRRGRQRMAEDREKQRRNEAAGGKGTRRLLAPDVRPALVVGLTLAAVQQFAGINTIIYYAPTIIQQTGLDASNAILYSVFIGLINLVMTLVAIRLVDRVGRRPMVLVSLALMTVSIFMLGLAFVVGMNSELTLVFMVIYIAAFAGGLGPVFWTLIGEIFPPSVRAEGSSLSTAVNWVSNFVVSLAFLPLANLIGQGETFWIFAGICLFAFLFVGRYLPETRGRDPEQIEEALDARFKHRPDHPDRPGGPGKTASPQKGRSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP027022_7	7.2\|2013261\|15\|CP027022\|CRISPRCasFinder	2013261-2013275	15	CP027024.1	57251-57265	2	0.867
CP027022_7	7.2\|2013261\|15\|CP027022\|CRISPRCasFinder	2013261-2013275	15	CP027024.1	106480-106494	2	0.867

1. spacer 7.2|2013261|15|CP027022|CRISPRCasFinder matches to position: 57251-57265, mismatch: 2, identity: 0.867

cgaccgccgaagccg	CRISPR spacer
cgaccgccgacggcg	Protospacer
********** * **

2. spacer 7.2|2013261|15|CP027022|CRISPRCasFinder matches to position: 106480-106494, mismatch: 2, identity: 0.867

cgaccgccgaagccg	CRISPR spacer
cgaccgcggaggccg	Protospacer
******* **.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027022_2	2.1\|83137\|37\|CP027022\|CRISPRCasFinder	83137-83173	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	100028-100064	0	1.0
CP027022_2	2.2\|83197\|19\|CP027022\|CRISPRCasFinder	83197-83215	19	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99986-100004	0	1.0
CP027022_2	2.3\|83239\|37\|CP027022\|CRISPRCasFinder	83239-83275	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99926-99962	0	1.0
CP027022_2	2.4\|83299\|43\|CP027022\|CRISPRCasFinder	83299-83341	43	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99860-99902	0	1.0
CP027022_3	3.1\|83674\|37\|CP027022\|CRISPRCasFinder	83674-83710	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99491-99527	0	1.0
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1219087-1219113	2	0.926
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NC_020489	Rhodobacter phage RcapNL, complete genome	34032-34054	2	0.913
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	JF974309	Rhodobacter phage RcNL1, * SEQUENCING IN PROGRESS *, 5 unordered pieces	44183-44205	2	0.913
CP027022_7	7.3\|2013300\|24\|CP027022\|CRISPRCasFinder	2013300-2013323	24	NZ_CP025436	Gordonia sp. YC-JH1 plasmid pGOR1, complete sequence	66023-66046	3	0.875
CP027022_7	7.3\|2013300\|24\|CP027022\|CRISPRCasFinder	2013300-2013323	24	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	264364-264387	3	0.875
CP027022_7	7.3\|2013300\|24\|CP027022\|CRISPRCasFinder	2013300-2013323	24	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	93813-93836	3	0.875
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1512930-1512956	3	0.889
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP011053	Halomonas sp. KO116 plasmid unnamed1, complete sequence	22709-22735	3	0.889
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	622239-622265	3	0.889
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	392440-392466	3	0.889
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	234542-234568	3	0.889
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1376285-1376308	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	199621-199644	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1338530-1338553	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP040720	Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence	179831-179854	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	513155-513178	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	524886-524909	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	527971-527994	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	628546-628569	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	183485-183508	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	532999-533022	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1530240-1530263	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	529234-529257	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	540705-540728	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	526359-526382	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	427006-427029	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	525453-525476	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	529251-529274	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	545374-545397	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	628572-628595	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	523399-523422	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	523403-523426	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	523403-523426	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	540688-540711	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	540641-540664	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	575071-575094	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	532465-532488	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	523403-523426	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	622849-622872	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	545373-545396	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	523403-523426	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	523403-523426	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	545376-545399	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	KM597530	Mycobacterium phage Bipolar, complete genome	33711-33734	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	KM101122	Mycobacterium phage Hades, complete genome	34315-34338	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	MH669014	Mycobacterium phage Spikelee, complete genome	35483-35506	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	MG770213	Mycobacterium phage OldBen, complete genome	34130-34153	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	FJ174693	Mycobacterium phage Ramsey, complete genome	34926-34949	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	MN062708	Mycobacteriumphage NothingSpecial, complete genome	20209-20232	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_023728	Mycobacterium virus DeadP, complete genome	34915-34938	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	MT114167	Mycobacterium phage Phanphagia, complete genome	33370-33393	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	97037-97060	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1392065-1392088	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1650074-1650097	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	542148-542171	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1463081-1463104	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1568652-1568675	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	MK937603	Gordonia phage Bakery, complete genome	31922-31945	3	0.875
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	KC736071	Mycobacterium phage WIVsmall, complete genome	20264-20287	3	0.875
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	130287-130309	3	0.87
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	130287-130309	3	0.87
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4810671-4810693	3	0.87
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	476613-476635	3	0.87
CP027022_20	20.1\|6093348\|23\|CP027022\|CRISPRCasFinder	6093348-6093370	23	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	110768-110790	3	0.87
CP027022_7	7.3\|2013300\|24\|CP027022\|CRISPRCasFinder	2013300-2013323	24	AP018486	Mycobacterium phage PP DNA, complete genome	8225-8248	4	0.833
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_001396	Xanthomonas phage Cf1c, complete genome	432-458	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	AB910602	Xanthomonas phage XacF1 DNA, complete genome	1730-1756	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	U41819	Xanthomonas virus Cf1c B coat protein and A coat protein genes, complete cds	432-458	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	M57538	Xanthomonas phage Cf1c unknown gene	432-458	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	70737-70763	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP022419	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-4, complete sequence	43443-43469	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	153422-153448	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	297801-297827	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	673371-673397	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	155615-155641	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MN908691	Gordonia phage DatBoi, complete genome	56300-56326	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP014812	Methylorubrum populi strain P-1M plasmid pMPPM03, complete sequence	28358-28384	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	443300-443326	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	443309-443335	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	549167-549193	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	235345-235371	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	235343-235369	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	444052-444078	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	421116-421142	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1766974-1767000	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1783664-1783690	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	25336-25362	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	60016-60042	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	482539-482565	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1746897-1746923	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_014819	Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence	89453-89479	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	785683-785709	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1027392-1027418	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	426007-426033	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	708790-708816	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	371277-371303	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	306982-307008	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	715959-715985	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	46383-46409	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	105135-105161	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP003951	Rhodococcus opacus PD630 plasmid 2, complete sequence	88576-88602	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP003951	Rhodococcus opacus PD630 plasmid 2, complete sequence	88867-88893	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP003951	Rhodococcus opacus PD630 plasmid 2, complete sequence	89219-89245	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MF377441	Arthrobacter phage Timinator, complete genome	31283-31309	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MT310895	Arthrobacter phage StevieBAY, complete genome	31278-31304	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KU647629	Arthrobacter phage BarretLemon, complete genome	31281-31307	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_025133	Sphingobium wenxiniae strain JZ-1 plasmid pPBA, complete sequence	29354-29380	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP005192	Sphingobium sp. MI1205 plasmid pMI3, complete sequence	82869-82895	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	AB244976	Uncultured bacterium plasmid pLB1 DNA, complete sequence	60493-60519	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP005089	Sphingobium sp. TKS plasmid pTK5, complete sequence	38167-38193	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	421219-421245	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MH001451	Mycobacterium phage Nairb, complete genome	26679-26705	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MF155936	Mycobacterium phage ZenTime222, complete genome	26679-26705	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MK494089	Mycobacterium phage Ibrahim, complete genome	26679-26705	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_024135	Mycobacterium phage Bernal13, complete genome	26679-26705	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KM591905	Mycobacterium phage RonRayGun, complete genome	26679-26705	4	0.852
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MN735432	Mycobacteriophage Whitty, complete genome	26679-26705	4	0.852
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1376153-1376176	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	629607-629630	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1606122-1606145	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	824787-824810	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	12908-12931	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	489909-489932	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	29366-29389	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	207147-207170	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1307593-1307616	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	86875-86898	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	436532-436555	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	NC_048860	Microbacterium phage Arete, complete genome	29960-29983	4	0.833
CP027022_7	7.5\|2013399\|24\|CP027022\|CRISPRCasFinder	2013399-2013422	24	KC252997	Halovirus PH1, complete genome	1757-1780	4	0.833
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	652346-652372	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	680213-680239	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MT361768	Ralstonia phage RPZH6, complete genome	31411-31437	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MT361768	Ralstonia phage RPZH6, complete genome	31882-31908	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210895-2210921	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	67855-67881	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	CP000618	Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence	42670-42696	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MK305888	Streptomyces phage Austintatious, complete genome	34188-34214	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	554023-554049	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	20484-20510	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	331035-331061	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	339601-339627	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1306046-1306072	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP018918	Serratia marcescens strain UMH5 plasmid unnamed2, complete sequence	19146-19172	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	403263-403289	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	439920-439946	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	323224-323250	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	197388-197414	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	324784-324810	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	35613-35639	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	507155-507181	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP020333	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM170, complete sequence	130218-130244	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	160828-160854	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_021278	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence	18467-18493	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP010894	Pseudomonas sp. MRSN12121 plasmid, complete sequence	5455-5481	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KY555147	Caulobacter phage Ccr34, complete genome	41971-41997	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MF668280	Mycobacterium phage Phabba, complete genome	108689-108715	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MF377442	Arthrobacter phage Franzy, complete genome	30935-30961	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_041930	Arthrobacter phage Brent, complete genome	30936-30962	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KY555146	Caulobacter phage Ccr32, complete genome	42005-42031	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_048047	Caulobacter phage CcrBL9, complete genome	70050-70076	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP053379	Serratia marcescens strain FY plasmid p1, complete sequence	5494-5520	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP033895	Serratia liquefaciens strain FG3 plasmid p2-125, complete sequence	25821-25847	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1389280-1389306	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	51711-51737	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP018916	Serratia marcescens strain UMH1 plasmid unnamed1, complete sequence	50377-50403	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP041653	Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence	86402-86428	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	182028-182054	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	104212-104238	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1367246-1367272	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	517561-517587	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	244042-244068	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KM083128	Mycobacterium phage Sparky, complete genome	56688-56714	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	JX163858	Caulobacter phage phiCbK, complete genome	165826-165852	5	0.815
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	1070677-1070703	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	520649-520675	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	224837-224863	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KY249644	Synechococcus virus S-ESS1, complete genome	59383-59409	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KY249644	Synechococcus virus S-ESS1, complete genome	59410-59436	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	87722-87748	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	47515-47541	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	74930-74956	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KY092483	Streptomyces phage Bioscum, complete genome	35824-35850	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	35811-35837	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	174565-174591	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	89941-89967	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	996901-996927	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	109976-110002	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	167349-167375	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	493458-493484	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP046101	Rhodococcus sp. AQ5-07 plasmid unnamed2, complete sequence	3924-3950	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	383174-383200	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP024609	Massilia violaceinigra strain B2 plasmid unnamed, complete sequence	19062-19088	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP040246	Mycobacterium avium subsp. hominissuis strain 101034 plasmid pFLAC0181_CHOP1, complete sequence	20479-20505	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	173296-173322	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	291160-291186	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	499883-499909	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	649878-649904	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	863893-863919	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013052	Sinorhizobium americanum CCGM7 plasmid A, complete sequence	39611-39637	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	764440-764466	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	166666-166692	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP020385	Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence	131515-131541	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1743140-1743166	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MT740738	Ralstonia phage Gamede, complete genome	50142-50168	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MT740736	Ralstonia phage Eline, complete genome	52623-52649	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KU160664	Arthrobacter phage Salgado, complete genome	10008-10034	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MH727549	Mycobacterium phage Gancho, complete genome	21803-21829	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MF140418	Arthrobacter phage LiSara, complete genome	10034-10060	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	KU160654	Arthrobacter phage Laroye, complete genome	10000-10026	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	885604-885630	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	85063-85089	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP023150	Mycobacterium intracellulare strain FLAC0181 plasmid pFLAC0181, complete sequence	7577-7603	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	85071-85097	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP040254	Mycobacterium avium subsp. hominissuis strain 101115 plasmid pFLAC0181_CHOP101, complete sequence	19943-19969	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	19237-19263	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1701800-1701826	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_019730	Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.02, complete sequence	149245-149271	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	249716-249742	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP040248	Mycobacterium avium subsp. hominissuis strain 101174 plasmid pFLAC0181_CHOP101, complete sequence	22194-22220	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP033037	Agrobacterium fabrum strain 12D13 plasmid pAt12D13b, complete sequence	54647-54673	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	76527-76553	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	577799-577825	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP053709	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence	336197-336223	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP031358	Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence	188896-188922	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	124863-124889	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	84374-84400	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1268491-1268517	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	634658-634684	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	196068-196094	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MN813684	Microbacterium phage Terij, complete genome	20880-20906	6	0.778
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MK977705	Gordonia Phage Mollymur, complete genome	57278-57304	6	0.778
CP027022_8	8.1\|2555184\|31\|CP027022\|CRISPRCasFinder	2555184-2555214	31	MT310862	Streptomyces phage Itza, complete genome	27654-27684	6	0.806
CP027022_8	8.1\|2555184\|31\|CP027022\|CRISPRCasFinder	2555184-2555214	31	MN062705	Streptomyces phage Celia, complete genome	27740-27770	6	0.806
CP027022_8	8.1\|2555184\|31\|CP027022\|CRISPRCasFinder	2555184-2555214	31	MN234189	Streptomyces phage Urza, complete genome	27675-27705	6	0.806
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP021372	Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence	237694-237725	6	0.812
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	669917-669948	6	0.812
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_AF331043	Arthrobacter keyseri strain 12B plasmid pRE1, complete sequence	7888-7919	6	0.812
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_015147	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE302, complete sequence	48282-48313	6	0.812
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	112984-113015	6	0.812
CP027022_23	23.1\|7089514\|33\|CP027022\|CRISPRCasFinder	7089514-7089546	33	NC_016435	Gordonia phage GRU1, complete genome	42392-42424	6	0.818
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	102434-102460	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	92664-92690	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP006588	Hymenobacter sp. APR13 plasmid pHA, complete sequence	88944-88970	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2293842-2293868	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	42520-42546	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	MH834619	Arthrobacter phage Maureen, complete genome	35922-35948	7	0.741
CP027022_7	7.4\|2013348\|27\|CP027022\|CRISPRCasFinder	2013348-2013374	27	NC_048115	Arthrobacter phage Liebe, complete genome	35922-35948	7	0.741
CP027022_8	8.1\|2555184\|31\|CP027022\|CRISPRCasFinder	2555184-2555214	31	MN585980	Microbacterium phage Gina, complete genome	24782-24812	7	0.774
CP027022_8	8.1\|2555184\|31\|CP027022\|CRISPRCasFinder	2555184-2555214	31	MN586059	Microbacterium phage Teamocil, complete genome	24881-24911	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP025432	Paracoccus zhejiangensis strain J6 plasmid pPZ02, complete sequence	127072-127102	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	776239-776269	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	392200-392230	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1057615-1057645	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	659345-659375	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	316601-316631	7	0.774
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	234062-234092	7	0.774
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	186419-186450	7	0.781
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	741625-741656	7	0.781
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	700675-700706	7	0.781
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	236836-236867	7	0.781
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	484184-484215	7	0.781
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	356668-356699	7	0.781
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	160005-160035	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	474119-474149	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP011667	Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence	28141-28171	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NC_042350	Salinibacter virus M8CR30-2, complete genome	12933-12963	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MF580958	Salinibacter virus M8CR30-4, partial genome	13097-13127	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NC_042348	Salinibacter virus M1EM-1, partial genome	12535-12565	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	448270-448300	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	212930-212960	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	436625-436655	8	0.742
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MK814757	Gordonia phage Fairfaxidum, complete genome	42113-42143	8	0.742
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	410558-410589	8	0.75
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	672280-672311	8	0.75
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1371572-1371603	8	0.75
CP027022_23	23.1\|7089514\|33\|CP027022\|CRISPRCasFinder	7089514-7089546	33	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	336376-336408	8	0.758
CP027022_23	23.1\|7089514\|33\|CP027022\|CRISPRCasFinder	7089514-7089546	33	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1065851-1065883	8	0.758
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	NZ_CP023455	Rhodobacteraceae bacterium QY30 plasmid unnamed, complete sequence	14939-14969	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MF324912	Mycobacterium phage Phrank, complete genome	32123-32153	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MF324908	Mycobacterium phage Unicorn, complete genome	32163-32193	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MN369762	Mycobacterium phage Bryler, complete genome	32146-32176	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MF324909	Mycobacterium phage PhelpsODU, complete genome	32163-32193	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MF324913	Mycobacterium phage Cain, complete genome	32134-32164	9	0.71
CP027022_11	11.2\|3257475\|31\|CP027022\|CRISPRCasFinder	3257475-3257505	31	MN234176	Mycobacterium phage Yuna, complete genome	34036-34066	9	0.71
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	558460-558491	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	261648-261679	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP050100	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence	148077-148108	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	128780-128811	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	222019-222050	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_012854	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete sequence	181282-181313	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	167215-167246	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	162086-162117	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP016291	Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence	255625-255656	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	101334-101365	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP048284	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248b, complete sequence	149421-149452	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP032053	Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence	10100-10131	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP054036	Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence	11611-11642	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP022568	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence	195258-195289	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MK977708	Mycobacterium phage Fulbright, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MG099948	Mycobacterium phage Philonius, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH926055	Mycobacterium phage Chewbacca, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	KF986246	Mycobacterium phage MichelleMyBell, complete genome	9745-9776	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MT723932	Mycobacterium phage Schnauzer, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	KU935726	Mycobacterium phage Xerxes, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	KU935730	Mycobacterium phage Pipsqueaks, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH316570	Mycobacterium phage Silvafighter, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MK524518	Mycobacterium phage Smurph, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MK524515	Mycobacterium phage Parmesanjohn, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH697585	Mycobacterium phage Gex, complete genome	9705-9736	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH399787	Mycobacterium phage Rubeelu, complete genome	9726-9757	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	KM588359	Mycobacterium phage Carcharodon, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH697576	Mycobacterium phage Aggie, complete genome	9707-9738	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_021061	Mycobacterium phage Butters, complete genome	9726-9757	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MH697593	Mycobacterium phage Tapioca, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MK524500	Mycobacterium phage Kevin1, complete genome	9726-9757	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	MG099936	Mycobacterium phage Andies, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NC_031243	Mycobacterium phage Xeno, complete genome	9706-9737	9	0.719
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	JN256079	Mycobacterium phage Charlie, complete genome	9706-9737	9	0.719
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MT498048	Mycobacterium phage Raymond7, complete genome	40949-40982	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MK524522	Mycobacterium phage Purgamenstris, complete genome	41161-41194	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MT498042	Mycobacterium phage Rebel, complete genome	39145-39178	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MK392367	Mycobacterium phage BabeRuth, complete genome	41161-41194	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MK524520	Mycobacterium phage Nenae, complete genome	41163-41196	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	JN624851	Mycobacterium phage Redi, complete genome	41160-41193	9	0.735
CP027022_16	16.1\|5578121\|34\|CP027022\|CRISPRCasFinder	5578121-5578154	34	MK524528	Mycobacterium phage ShrimpFriedEgg, complete genome	41160-41193	9	0.735
CP027022_9	9.2\|2972525\|37\|CP027022\|PILER-CR	2972525-2972561	37	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1791923-1791959	10	0.73
CP027022_11	11.1\|3257421\|31\|CP027022\|CRISPRCasFinder	3257421-3257451	31	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	885171-885201	10	0.677
CP027022_11	11.1\|3257421\|31\|CP027022\|CRISPRCasFinder	3257421-3257451	31	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	45787-45817	10	0.677
CP027022_12	12.2\|3302283\|32\|CP027022\|CRISPRCasFinder	3302283-3302314	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	368067-368098	10	0.688
CP027022_23	23.1\|7089514\|33\|CP027022\|CRISPRCasFinder	7089514-7089546	33	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	827010-827042	10	0.697

1. spacer 2.1|83137|37|CP027022|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gtctgcgccaacgcttaccgaggcgagctggtttttc	CRISPR spacer
gtctgcgccaacgcttaccgaggcgagctggtttttc	Protospacer
*************************************

2. spacer 2.2|83197|19|CP027022|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccattcgatgtctggttg	CRISPR spacer
gccattcgatgtctggttg	Protospacer
*******************

3. spacer 2.3|83239|37|CP027022|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gcggttggagccacctgtggtttcgctggtgagctgg	CRISPR spacer
gcggttggagccacctgtggtttcgctggtgagctgg	Protospacer
*************************************

4. spacer 2.4|83299|43|CP027022|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ggtggctgtgccagctttggtctgggtggtgcggttgccgacc	CRISPR spacer
ggtggctgtgccagctttggtctgggtggtgcggttgccgacc	Protospacer
*******************************************

5. spacer 3.1|83674|37|CP027022|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccggctgttccggtctggctggtgcggcggccgtcg	CRISPR spacer
gccggctgttccggtctggctggtgcggcggccgtcg	Protospacer
*************************************

6. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 2, identity: 0.926

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgcagccgccgccgccgccg	Protospacer
********* *************.***

7. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NC_020489 (Rhodobacter phage RcapNL, complete genome) position: , mismatch: 2, identity: 0.913

tgtggcggggccggaggcgggct	CRISPR spacer
tgcggcgggcccggaggcgggct	Protospacer
**.****** *************

8. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to JF974309 (Rhodobacter phage RcNL1, *** SEQUENCING IN PROGRESS ***, 5 unordered pieces) position: , mismatch: 2, identity: 0.913

tgtggcggggccggaggcgggct	CRISPR spacer
tgcggcgggcccggaggcgggct	Protospacer
**.****** *************

9. spacer 7.3|2013300|24|CP027022|CRISPRCasFinder matches to NZ_CP025436 (Gordonia sp. YC-JH1 plasmid pGOR1, complete sequence) position: , mismatch: 3, identity: 0.875

ccaccgccgggaccacccggacga	CRISPR spacer
gcaccgccgagaccgcccggacga	Protospacer
 ********.****.*********

10. spacer 7.3|2013300|24|CP027022|CRISPRCasFinder matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ccaccgccgggaccacccggacga	CRISPR spacer
ccagcgccgggaacacccggacgt	Protospacer
*** ******** **********

11. spacer 7.3|2013300|24|CP027022|CRISPRCasFinder matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 3, identity: 0.875

ccaccgccgggaccacccggacga	CRISPR spacer
ccagcgccgggaacacccggacgt	Protospacer
*** ******** **********

12. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 3, identity: 0.889

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccggcgaagccgccgccgccgccg	Protospacer
. *********************.***

13. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP011053 (Halomonas sp. KO116 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccaccgaagccgccgccgccaccg	Protospacer
* ***. ********************

14. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.889

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctgccggcgaagccctcgccgccaccg	Protospacer
* ************ .***********

15. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.889

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaatccgccgccgcgaccg	Protospacer
* ********* ********** ****

16. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 3, identity: 0.889

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaatccgccgccgcgaccg	Protospacer
* ********* ********** ****

17. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
ccaccgggacgaccgccgccgcca	Protospacer
  .*********************

18. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
cagccaggacgaccgccgccgcct	Protospacer
 ****.*****************

19. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
ccgccgggacgatcgccgccgcca	Protospacer
  **********.***********

20. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP040720 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggacgaccgccgacgctg	Protospacer
****************** ***..

21. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

22. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

23. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

24. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

25. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

26. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

27. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

28. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

29. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

30. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

31. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

32. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

33. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

34. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

35. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

36. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

37. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

38. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

39. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

40. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

41. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

42. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

43. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

44. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

45. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

46. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

47. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

48. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

49. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

50. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

51. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

52. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

53. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

54. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

55. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

56. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

57. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to KM597530 (Mycobacterium phage Bipolar, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

58. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to KM101122 (Mycobacterium phage Hades, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

59. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to MH669014 (Mycobacterium phage Spikelee, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

60. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to MG770213 (Mycobacterium phage OldBen, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

61. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to FJ174693 (Mycobacterium phage Ramsey, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

62. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to MN062708 (Mycobacteriumphage NothingSpecial, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
cagcctggacgaccgccgcagcca	Protospacer
 **** ************* ****

63. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_023728 (Mycobacterium virus DeadP, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

64. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

65. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

66. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

67. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

68. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

69. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

70. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgggccggccgccgccgccc	Protospacer
******** **.***********

71. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to MK937603 (Gordonia phage Bakery, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgtgacgaccgctgccgccg	Protospacer
****** *********.******.

72. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 3, identity: 0.875

aagccgggacgaccgccgccgcca	CRISPR spacer
aagccgagacgaccgcagccgccg	Protospacer
******.********* ******.

73. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.87

tgtggcggggccggaggcgggct	CRISPR spacer
cgtggcggggccggtggcgggca	Protospacer
.************* *******

74. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.87

tgtggcggggccggaggcgggct	CRISPR spacer
cgtggcggggccggtggcgggca	Protospacer
.************* *******

75. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.87

tgtggcggggccggaggcgggct	CRISPR spacer
cgtggcggggctggaggcgggcg	Protospacer
.**********.**********

76. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 3, identity: 0.87

tgtggcggggccggaggcgggct	CRISPR spacer
ggtggcggagccggaggcgggcg	Protospacer
 *******.*************

77. spacer 20.1|6093348|23|CP027022|CRISPRCasFinder matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.87

tgtggcggggccggaggcgggct	CRISPR spacer
cgtggcggggccggtggcgggca	Protospacer
.************* *******

78. spacer 7.3|2013300|24|CP027022|CRISPRCasFinder matches to AP018486 (Mycobacterium phage PP DNA, complete genome) position: , mismatch: 4, identity: 0.833

ccaccgccgggaccacccggacga	CRISPR spacer
gcaccgccgggaccacccgcacag	Protospacer
 ****************** **..

79. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_001396 (Xanthomonas phage Cf1c, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagtcgccgccgccaccg	Protospacer
  **** *****.**************

80. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to AB910602 (Xanthomonas phage XacF1 DNA, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagtcgccgccgccaccg	Protospacer
  **** *****.**************

81. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to U41819 (Xanthomonas virus Cf1c B coat protein and A coat protein genes, complete cds) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagtcgccgccgccaccg	Protospacer
  **** *****.**************

82. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to M57538 (Xanthomonas phage Cf1c unknown gene) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagtcgccgccgccaccg	Protospacer
  **** *****.**************

83. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccgccgaaaccgccgccgccaccg	Protospacer
. **** ****.***************

84. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP022419 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-4, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggcgtgcgaagccgccgccgccacac	Protospacer
****  *******************

85. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccgccgaaaccgccgccgccaccg	Protospacer
. **** ****.***************

86. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
acgccggcgaagctgccggcgccaccg	Protospacer
  ***********.**** ********

87. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 4, identity: 0.852

--cggccggcgaagccgccgccgccaccg	CRISPR spacer
atcga--ggcgaagccgccgccgccaccc	Protospacer
  **.  *********************

88. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gcgccgccgaggccgccgccgccaccg	Protospacer
  **** ***.****************

89. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MN908691 (Gordonia phage DatBoi, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgccgccgaagccgccgccgccgccg	Protospacer
. **** ****************.***

90. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP014812 (Methylorubrum populi strain P-1M plasmid pMPPM03, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tggccggccaagccgcagccgccactg	Protospacer
.******* ******* ********.*

91. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

92. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

93. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgacgccgccgtcgccaggg	Protospacer
********** *******.*****  *

94. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

95. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

96. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

97. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

98. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

99. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

100. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccaccggcaaagcggccgccgccaccg	Protospacer
* .*****.**** *************

101. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgcagccgccgccgcgccag	Protospacer
********* ************  * *

102. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagccgcagccgcagcag	Protospacer
**************** ***** .* *

103. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccggcgaagccgccgccgcgcgcg	Protospacer
* ********************   **

104. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_014819 (Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgatgccgtcgccgcccctg	Protospacer
********** ****.******* *.*

105. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccg-ccaccg	CRISPR spacer
cggccggcgaggccgccgccgatcagc-	Protospacer
**********.********** .** *

106. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccg-ccaccg	CRISPR spacer
cggccggcgaggccgccgccgatcagc-	Protospacer
**********.********** .** *

107. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctgccggcgaaggcgccgccggcacgg	Protospacer
* ********** ******** *** *

108. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgtagccgccaccgccggcg	Protospacer
********* *******.*****. **

109. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggcgggcgatgccgccgccgccttcg	Protospacer
**** ***** ************ .**

110. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgacgaagccgccgccgtcgctg	Protospacer
******.**************.*.*.*

111. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctgccggcccagccgccgccgccactg	Protospacer
* ******  ***************.*

112. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgccgaagccgcagccgccgacg	Protospacer
****** ********* ******. **

113. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctgccggcccagccgccgccgccactg	Protospacer
* ******  ***************.*

114. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP003951 (Rhodococcus opacus PD630 plasmid 2, complete sequence) position: , mismatch: 4, identity: 0.852

cggcc--ggcgaagccgccgccgccaccg	CRISPR spacer
--gccatggctaagccgccgccgccacca	Protospacer
  ***  *** *****************.

115. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP003951 (Rhodococcus opacus PD630 plasmid 2, complete sequence) position: , mismatch: 4, identity: 0.852

cggcc--ggcgaagccgccgccgccaccg	CRISPR spacer
--gccatggctaagccgccgccgccacca	Protospacer
  ***  *** *****************.

116. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP003951 (Rhodococcus opacus PD630 plasmid 2, complete sequence) position: , mismatch: 4, identity: 0.852

cggcc--ggcgaagccgccgccgccaccg	CRISPR spacer
--gccatggctaagccgccgccgccacca	Protospacer
  ***  *** *****************.

117. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MF377441 (Arthrobacter phage Timinator, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgcccccacgg	Protospacer
* **** ************* **** *

118. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MT310895 (Arthrobacter phage StevieBAY, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgcccccactg	Protospacer
* **** ************* ****.*

119. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KU647629 (Arthrobacter phage BarretLemon, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgcccccacgg	Protospacer
* **** ************* **** *

120. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_025133 (Sphingobium wenxiniae strain JZ-1 plasmid pPBA, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgccgtagccgccgccgccgctg	Protospacer
****** ** *************.*.*

121. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP005192 (Sphingobium sp. MI1205 plasmid pMI3, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgccgtagccgccgccgccgctg	Protospacer
****** ** *************.*.*

122. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to AB244976 (Uncultured bacterium plasmid pLB1 DNA, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgccgtagccgccgccgccgctg	Protospacer
****** ** *************.*.*

123. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP005089 (Sphingobium sp. TKS plasmid pTK5, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgccgtagccgccgccgccgctg	Protospacer
****** ** *************.*.*

124. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccgacgaagccgccgccgtcgctg	Protospacer
******.**************.*.*.*

125. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

126. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

127. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

128. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

129. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

130. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 4, identity: 0.852

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgttgccgccgccgccggcg	Protospacer
*********  ************. **

131. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
tgaccgggacgaccaccgccgcca	Protospacer
 ..***********.*********

132. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcggccc	Protospacer
. ***************** ***

133. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
tcgccgcgacgaccgccgccgccg	Protospacer
  **** ****************.

134. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcagccc	Protospacer
. ***************** ***

135. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
tggccgagacgaccgccgccgccg	Protospacer
 .****.****************.

136. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcggccc	Protospacer
. ***************** ***

137. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcggccc	Protospacer
. ***************** ***

138. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
tcgccgcgacgaccgccgccgccg	Protospacer
  **** ****************.

139. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcagccc	Protospacer
. ***************** ***

140. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
cggccgggacgacggccgccgccc	Protospacer
 .*********** *********

141. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggacgaccgccgcggccc	Protospacer
. ***************** ***

142. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to NC_048860 (Microbacterium phage Arete, complete genome) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
cagccgggacgacctccgccgcgc	Protospacer
 ************* *******

143. spacer 7.5|2013399|24|CP027022|CRISPRCasFinder matches to KC252997 (Halovirus PH1, complete genome) position: , mismatch: 4, identity: 0.833

aagccgggacgaccgccgccgcca	CRISPR spacer
gcgccgggccgaccgccgccgccg	Protospacer
. ****** **************.

144. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
agatcgacgaggccgccgccgccaccg	Protospacer
 *..**.***.****************

145. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctggtcgcgatgccgccgccgccaccg	Protospacer
* * . **** ****************

146. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MT361768 (Ralstonia phage RPZH6, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagacgccgccgcctgac	Protospacer
************ **********

147. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MT361768 (Ralstonia phage RPZH6, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagacgccgccgcctgac	Protospacer
************ **********

148. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tagtcgccgaagccgccgccgccgccg	Protospacer
..*.** ****************.***

149. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
atgtcgtcgaagccgccgccgccacca	Protospacer
  *.** *******************.

150. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to CP000618 (Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gaaccggcgtcgccgccgccgccaccg	Protospacer
 ..******  ****************

151. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MK305888 (Streptomyces phage Austintatious, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggcgaggccgccgccgccgtca	Protospacer
 *********.************..*.

152. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgtcgccgaagccgccgctgccaccg	Protospacer
. *.** ************.*******

153. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgcagcggccgccgccgcat	Protospacer
********* *** *********.*

154. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
taggcggcgatgccgccgccgacaccg	Protospacer
..* ****** ********** *****

155. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccgaag	Protospacer
* **** ****************.  *

156. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggcaaagccgccgccgacaatg	Protospacer
 *******.************ ** .*

157. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP018918 (Serratia marcescens strain UMH5 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgccggcgaagccggcgccgcaacgg	Protospacer
. ************* ****** ** *

158. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgcagccgccgccgggccag	Protospacer
********* ***********   * *

159. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg-	CRISPR spacer
tgggcggcgaagccgccgccg-cgctgc	Protospacer
.** ***************** *.*.*

160. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
agatcgacgaggccgccgccgccaccg	Protospacer
 *..**.***.****************

161. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tgatcgacgaagccgccgccgccgccg	Protospacer
.*..**.****************.***

162. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcggcggcgtagccgccaccgccaccg	Protospacer
. * ***** *******.*********

163. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcggagacgccgccgccgagg	Protospacer
*********.** **********.  *

164. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggtcggcgaagccgccgctgccgttg	Protospacer
***.***************.***...*

165. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP020333 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM170, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tgcgcggcgatgacgccgccgccaccg	Protospacer
.*  ****** * **************

166. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tgatcgacgaagccgccgccgccgccg	Protospacer
.*..**.****************.***

167. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_021278 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcggcggcgacgccgccgccgtcaccg	Protospacer
. * ****** **********.*****

168. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP010894 (Pseudomonas sp. MRSN12121 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgatgccgccgccgtggcgg	Protospacer
********** **********. .* *

169. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
atgacggtgtagccgccgccgccaccg	Protospacer
  * ***.* *****************

170. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgcccggagaagccgccgccgcccttg	Protospacer
** **** *************** ..*

171. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MF377442 (Arthrobacter phage Franzy, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccgttg	Protospacer
* **** ****************...*

172. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_041930 (Arthrobacter phage Brent, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccgttg	Protospacer
* **** ****************...*

173. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
atgacggtgtagccgccgccgccaccg	Protospacer
  * ***.* *****************

174. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_048047 (Caulobacter phage CcrBL9, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cctgcggcgtagccgccgccgccgccg	Protospacer
*   ***** *************.***

175. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP053379 (Serratia marcescens strain FY plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgccggcgaagccggcgccgcaacgg	Protospacer
. ************* ****** ** *

176. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP033895 (Serratia liquefaciens strain FG3 plasmid p2-125, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgccggcgaagccggcgccgcaacgg	Protospacer
. ************* ****** ** *

177. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccgacgaagccgccgccgacaatg	Protospacer
 *****.************** ** .*

178. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_010183 (Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccagcgaaaccgccgccgccacaa	Protospacer
* ***.*****.************* .

179. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP018916 (Serratia marcescens strain UMH1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgccggcgaagccggcgccgcaacgg	Protospacer
. ************* ****** ** *

180. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP041653 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cccccggcgaagccgtcgccgccgccc	Protospacer
*  ************.*******.**

181. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggtcggcgaagccgccgctgccgttg	Protospacer
***.***************.***...*

182. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcggcggcgtagccgccaccgccaccg	Protospacer
. * ***** *******.*********

183. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccgacgaagccgccgccgacaatg	Protospacer
 *****.************** ** .*

184. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagccgctgtcgccggtg	Protospacer
****************.*.****. .*

185. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tgatcgacgaagccgccgccgccgccg	Protospacer
.*..**.****************.***

186. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KM083128 (Mycobacterium phage Sparky, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggcccgcgaagccgccgccgcgtacg	Protospacer
 **** ****************   **

187. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 5, identity: 0.815

cggccggcgaagccgccgccgccaccg	CRISPR spacer
atgacggtgtagccgccgccgccaccg	Protospacer
  * ***.* *****************

188. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggacggcgatgccgccgccgccctgc	Protospacer
*** ****** ************ .

189. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagccgccgccgcccgcc	Protospacer
  **** ****************  *

190. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagacgccgcggccggga	Protospacer
************ ****** ***.  .

191. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KY249644 (Synechococcus virus S-ESS1, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tggccgccgaagccgccgccgccgaac	Protospacer
.***** ****************.

192. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KY249644 (Synechococcus virus S-ESS1, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tggccgccgaagccgccgccgccgaac	Protospacer
.***** ****************.

193. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
acctcggcgaagccgccgtcgccaccc	Protospacer
   .**************.*******

194. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggacggcgaagccgccgccgcgcgtt	Protospacer
*** ******************   .

195. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggacggcgaagccgccgccgcgcgtt	Protospacer
*** ******************   .

196. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggcgaggccgccgccgccgtta	Protospacer
 *********.************....

197. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggcgaggccgccgccgccgtta	Protospacer
 *********.************....

198. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgcgggcgaagccgccgacgccacac	Protospacer
. ** ************* ******

199. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgcccggc	Protospacer
* **** ****************

200. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ctgccggcgaagccgccgccgatgatg	Protospacer
* ******************* .. .*

201. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
acgccgtcgaagccgccgccgcgacga	Protospacer
  **** *************** ** .

202. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttcccggcgaggccgccgccgccgccc	Protospacer
.  *******.************.**

203. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttgcgggcgaagccgccgacgccacac	Protospacer
. ** ************* ******

204. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP046101 (Rhodococcus sp. AQ5-07 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tggcccgcgaagccgccgccgacagtc	Protospacer
.**** *************** ** .

205. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ggaccggcgaagccgccgccggcatgc	Protospacer
 *.****************** **.

206. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP024609 (Massilia violaceinigra strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gaaacggcgaagccgcctgcgccaccg	Protospacer
 .. *************  ********

207. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP040246 (Mycobacterium avium subsp. hominissuis strain 101034 plasmid pFLAC0181_CHOP1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggccaagccgccgccgtcgggc	Protospacer
******** ************.*.

208. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagccgccgccgggcttg	Protospacer
*** *****************   ..*

209. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gcgccggcgaagaagccgccgccacgc	Protospacer
  **********  ***********

210. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gcaccggcgatgccgccgccgtcacca	Protospacer
  .******* **********.****.

211. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggacggcgatgccgccgccgccctgc	Protospacer
*** ****** ************ .

212. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagctgccgccgccggat	Protospacer
*** *********.*********.

213. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013052 (Sinorhizobium americanum CCGM7 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ttcccggcgaggccgccgccgccgccc	Protospacer
.  *******.************.**

214. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggggaacccgccgccgccattc	Protospacer
 ****** *** ************..

215. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgcagccgccgccgggcgag	Protospacer
********* ***********     *

216. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP020385 (Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcttcgacgatgccgccgccgccaccg	Protospacer
.  .**.*** ****************

217. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagctgccgccgccggat	Protospacer
*** *********.*********.

218. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MT740738 (Ralstonia phage Gamede, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cagccggcgaagacgccgccgcctgac	Protospacer
*.********** **********

219. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MT740736 (Ralstonia phage Eline, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cagccggcgaagacgccgccgcctgac	Protospacer
*.********** **********

220. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KU160664 (Arthrobacter phage Salgado, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccctgc	Protospacer
* **** **************** .

221. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MH727549 (Mycobacterium phage Gancho, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
atcgcggccaacccgccgccgccaccg	Protospacer
    **** ** ***************

222. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MF140418 (Arthrobacter phage LiSara, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccctgc	Protospacer
* **** **************** .

223. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to KU160654 (Arthrobacter phage Laroye, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
ccgccgccgaagccgccgccgccctgc	Protospacer
* **** **************** .

224. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagctgccgccgccggat	Protospacer
*** *********.*********.

225. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgacgcggccgccgcccata	Protospacer
********** ** *********  ..

226. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP023150 (Mycobacterium intracellulare strain FLAC0181 plasmid pFLAC0181, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggccaagccgccgccgtcgggc	Protospacer
******** ************.*.

227. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgacgcggccgccgcccata	Protospacer
********** ** *********  ..

228. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP040254 (Mycobacterium avium subsp. hominissuis strain 101115 plasmid pFLAC0181_CHOP101, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggccaagccgccgccgtcgggc	Protospacer
******** ************.*.

229. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgacgcggccgccgcccata	Protospacer
********** ** *********  ..

230. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagctgccgccgccggat	Protospacer
*** *********.*********.

231. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_019730 (Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.02, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aagccgccgaagccgccgccgcccaag	Protospacer
 .**** ****************   *

232. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
acccgggcgaggccgccgccgccaccc	Protospacer
   * *****.***************

233. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP040248 (Mycobacterium avium subsp. hominissuis strain 101174 plasmid pFLAC0181_CHOP101, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggccaagccgccgccgtcgggc	Protospacer
******** ************.*.

234. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP033037 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13b, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gagccgacgaagccgccgccgcctgca	Protospacer
 .****.****************  *.

235. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccggcgcagccgcggccgccactc	Protospacer
. ******* ****** ********.

236. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcggagccggcgccgcccggc	Protospacer
*********.***** *******

237. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP053709 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgaagccgccgcgtcggcga	Protospacer
*******************  * .* .

238. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP031358 (Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggccggcgaaggcgccgccgcagatg	Protospacer
 *********** ********* . .*

239. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccggcgcagccgcggccgccactc	Protospacer
. ******* ****** ********.

240. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggccggcgacgcggccgccgcccata	Protospacer
********** ** *********  ..

241. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagctgccgccgccggat	Protospacer
*** *********.*********.

242. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cggacggcgaagccgccgctgccgaat	Protospacer
*** ***************.***.

243. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aaatcgacgaggccgccgccgccaccg	Protospacer
 ...**.***.****************

244. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MN813684 (Microbacterium phage Terij, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gcctcggcgacgccgccgccgccgccg	Protospacer
   .****** ************.***

245. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MK977705 (Gordonia Phage Mollymur, complete genome) position: , mismatch: 6, identity: 0.778

cggccggcgaagccgccgccgccaccg	CRISPR spacer
tcgccgccgaagccgccgccgccgaag	Protospacer
. **** ****************.  *

246. spacer 8.1|2555184|31|CP027022|CRISPRCasFinder matches to MT310862 (Streptomyces phage Itza, complete genome) position: , mismatch: 6, identity: 0.806

cgggcttcacggccggagcctccagcctgtg	CRISPR spacer
cgggcttcatcgccggagcctccagcttcga	Protospacer
*********. ***************.*  .

247. spacer 8.1|2555184|31|CP027022|CRISPRCasFinder matches to MN062705 (Streptomyces phage Celia, complete genome) position: , mismatch: 6, identity: 0.806

cgggcttcacggccggagcctccagcctgtg	CRISPR spacer
cgggcttcatcgccggagcctccagcttcga	Protospacer
*********. ***************.*  .

248. spacer 8.1|2555184|31|CP027022|CRISPRCasFinder matches to MN234189 (Streptomyces phage Urza, complete genome) position: , mismatch: 6, identity: 0.806

cgggcttcacggccggagcctccagcctgtg	CRISPR spacer
cgggcttcatcgccggagcctccagcttcga	Protospacer
*********. ***************.*  .

249. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP021372 (Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence) position: , mismatch: 6, identity: 0.812

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgagcatggcgcccgcgccgccgaaggcgaa	Protospacer
.* * *. *** ********************

250. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 6, identity: 0.812

--accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
cggccatc--ggcccccgagccgccgcaggcgaa	Protospacer
  .***.*  ******** ******* *******

251. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_AF331043 (Arthrobacter keyseri strain 12B plasmid pRE1, complete sequence) position: , mismatch: 6, identity: 0.812

--accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
ccgtcacc--ggcccccgcgccctcgaaggcgaa	Protospacer
  ..****  ************ .**********

252. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_015147 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE302, complete sequence) position: , mismatch: 6, identity: 0.812

--accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
ccgtcacc--ggcccccgcgccctcgaaggcgaa	Protospacer
  ..****  ************ .**********

253. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.812

--accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
ccgtcacc--ggcccccgcgccctcgaaggcgaa	Protospacer
  ..****  ************ .**********

254. spacer 23.1|7089514|33|CP027022|CRISPRCasFinder matches to NC_016435 (Gordonia phage GRU1, complete genome) position: , mismatch: 6, identity: 0.818

tcgtccggttcgtccttgggctcgtcgtccggc	CRISPR spacer
ggctccggatcgtcctcgggctcgtcgtccggg	Protospacer
   ***** *******.***************

255. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagccgccgccgaagaaa	Protospacer
*** *****************  .  .

256. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cacgcggcgaagccgccgccgccctac	Protospacer
*.  ******************* .

257. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP006588 (Hymenobacter sp. APR13 plasmid pHA, complete sequence) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cgggcggcgaagccgccgccgaagaaa	Protospacer
*** *****************  .  .

258. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
gtgccgtcgaagccgccgccgccgaac	Protospacer
  **** ****************.

259. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_021279 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
cacgcggcgaagccgccgccgccctac	Protospacer
*.  ******************* .

260. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to MH834619 (Arthrobacter phage Maureen, complete genome) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggcccgcgaagccgccgccgctgaga	Protospacer
 **** ****************..  .

261. spacer 7.4|2013348|27|CP027022|CRISPRCasFinder matches to NC_048115 (Arthrobacter phage Liebe, complete genome) position: , mismatch: 7, identity: 0.741

cggccggcgaagccgccgccgccaccg	CRISPR spacer
aggcccgcgaagccgccgccgctgaga	Protospacer
 **** ****************..  .

262. spacer 8.1|2555184|31|CP027022|CRISPRCasFinder matches to MN585980 (Microbacterium phage Gina, complete genome) position: , mismatch: 7, identity: 0.774

cgggcttcacggccggagcctccagcctgtg-	CRISPR spacer
cgggcatcaccgccggagcctcca-ccgacat	Protospacer
***** **** ************* ** ...

263. spacer 8.1|2555184|31|CP027022|CRISPRCasFinder matches to MN586059 (Microbacterium phage Teamocil, complete genome) position: , mismatch: 7, identity: 0.774

cgggcttcacggccggagcctccagcctgtg-	CRISPR spacer
cgggcatcaccgccggagcctcca-ccgacat	Protospacer
***** **** ************* ** ...

264. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP025432 (Paracoccus zhejiangensis strain J6 plasmid pPZ02, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
cctgcagcgcctcgatcgggtcctgggcgat	Protospacer
 **    ************ **********

265. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcccgaccgcctcgatcgcctccggggcgac	Protospacer
.*.** .*********** **** ******

266. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
tcaccgtcgcctcgatcagcccctgggcgac	Protospacer
 * *  ***********.**.*********

267. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcaggcccgcctcgatcagcacctgggcgag	Protospacer
.*  *..**********.** **********

268. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcaggcccgcctcgatcagcacctgggcgag	Protospacer
.*  *..**********.** **********

269. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcaggcccgcctcgatcagcacctgggcgag	Protospacer
.*  *..**********.** **********

270. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.774

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
actgcgtcgcctcggtcggcacctgggcgga	Protospacer
***   ********.***** ********..

271. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 7, identity: 0.781

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gggaccgaggcccccgcgccgccggtggcaga	Protospacer
.  *********************. ***..*

272. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcaagcattgcacccgcgccgccgaaggcgaa	Protospacer
.* * *.  ** ********************

273. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.781

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgagcattgcacccgcgccgccgaaggcgaa	Protospacer
.* * *.  ** ********************

274. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gccagcatcgcgcccgcgccgccgaatgcgaa	Protospacer
.*** *.  ** ************** *****

275. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gccagcatcgcgcccgcgccgccgaatgcgaa	Protospacer
.*** *.  ** ************** *****

276. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

--accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
cagacacc--cgcccccgcgacgcccaaggcgaa	Protospacer
  . ****   ********* **** ********

277. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
cctcgtgcgcctcgaacggctcctcgacctc	Protospacer
 ***** ******** ******** *.*

278. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
accgcaccgcctcgatcggctcgcgggcgaa	Protospacer
**.   .*************** .******.

279. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP011667 (Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
agaccctcgccaccatcggctcctgggcgcc	Protospacer
*  * .***** * ***************

280. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NC_042350 (Salinibacter virus M8CR30-2, complete genome) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcctgttcgcctcgatctcctcctggggaat	Protospacer
.*..*************  ******** .*

281. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MF580958 (Salinibacter virus M8CR30-4, partial genome) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcctgttcgcctcgatctcctcctggggaat	Protospacer
.*..*************  ******** .*

282. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NC_042348 (Salinibacter virus M1EM-1, partial genome) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gtttgttcgcctcgatctcctcctggggaac	Protospacer
..*.*************  ******** .*

283. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
ggcaggtcgcctcggtcggcgcctgggcgcg	Protospacer
. . * ********.***** ******** *

284. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
agaccctcgccaccatcggctcctgggcgcc	Protospacer
*  * .***** * ***************

285. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gtctggtcgcctcggtcggcgcctgggcgcg	Protospacer
....* ********.***** ******** *

286. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MK814757 (Gordonia phage Fairfaxidum, complete genome) position: , mismatch: 8, identity: 0.742

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcttcctcacctcgatcggctcctcggcggt	Protospacer
.**. .**.*************** ****.

287. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 8, identity: 0.75

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
agaactttggcgcccgcgccggcgaaggcgag	Protospacer
*  **.  *** ********* *********.

288. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 8, identity: 0.75

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accgccgaggcacccgcgccgcccaggctggt	Protospacer
***.******* *********** *.* .*.

289. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgagcatcgcgccggcgccgccgaaggcgaa	Protospacer
.* * *.  ** ** *****************

290. spacer 23.1|7089514|33|CP027022|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 8, identity: 0.758

tcgtccggttcgtccttgggctcgtcgtccggc	CRISPR spacer
actgatggttcgtccttgcgctcgtcggccgtc	Protospacer
 *   .************ ******** *** *

291. spacer 23.1|7089514|33|CP027022|CRISPRCasFinder matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.758

tcgtccggttcgtccttgggctcgtcgtccggc	CRISPR spacer
atatgcagttcgtccatgggctcgtcatccggt	Protospacer
 ..* *.******** **********.*****.

292. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to NZ_CP023455 (Rhodobacteraceae bacterium QY30 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
cggccttcgcctcgatcggcttctgcgccga	Protospacer
   * ****************.*** ** ..

293. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MF324912 (Mycobacterium phage Phrank, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
ccataagcgcctcgatcggctcacgggcgac	Protospacer
 * ..  *************** .******

294. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MF324908 (Mycobacterium phage Unicorn, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcataagcgcctcgatcggctcacgggcgac	Protospacer
.* ..  *************** .******

295. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MN369762 (Mycobacterium phage Bryler, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
ccataagcgcctcgatcggctcacgggcgac	Protospacer
 * ..  *************** .******

296. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MF324909 (Mycobacterium phage PhelpsODU, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcataagcgcctcgatcggctcacgggcgac	Protospacer
.* ..  *************** .******

297. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MF324913 (Mycobacterium phage Cain, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
ccataagcgcctcgatcggctcacgggcgac	Protospacer
 * ..  *************** .******

298. spacer 11.2|3257475|31|CP027022|CRISPRCasFinder matches to MN234176 (Mycobacterium phage Yuna, complete genome) position: , mismatch: 9, identity: 0.71

actcgttcgcctcgatcggctcctgggcgag	CRISPR spacer
gcataagcgcctcgatcggctcacgggcgac	Protospacer
.* ..  *************** .******

299. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
tggaccgacgcccccgcgccgacgaagacctc	Protospacer
   ***** ************ *****.*

300. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgataccggccatcgcgccgccgaaggcgat	Protospacer
.* *.   **** .*****************

301. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP050100 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaaaccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

302. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP025017 (Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaaaccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

303. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcttccgaggccaccgcgtcgccgaagtacag	Protospacer
.*. ******** *****.********   *.

304. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_012854 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

305. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

306. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

307. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP016291 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

308. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

309. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP048284 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248b, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

310. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP032053 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
cgcctgcaggccgccgcgccgccgcaggcgga	Protospacer
  * .  ***** *********** *****.*

311. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP054036 (Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

312. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP022568 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
gcgaagccggccatcgcgccgccgaaggcgat	Protospacer
.* *    **** .*****************

313. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

314. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

315. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

316. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to KF986246 (Mycobacterium phage MichelleMyBell, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

317. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

318. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

319. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

320. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

321. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

322. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

323. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

324. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH399787 (Mycobacterium phage Rubeelu, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

325. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

326. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

327. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_021061 (Mycobacterium phage Butters, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

328. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

329. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MK524500 (Mycobacterium phage Kevin1, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

330. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

331. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NC_031243 (Mycobacterium phage Xeno, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

332. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 9, identity: 0.719

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccgcggccaccgcgccgccctcgggcgg	Protospacer
******* **** **********   **  ..

333. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MT498048 (Mycobacterium phage Raymond7, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

334. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MK524522 (Mycobacterium phage Purgamenstris, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

335. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MT498042 (Mycobacterium phage Rebel, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

336. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MK392367 (Mycobacterium phage BabeRuth, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

337. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MK524520 (Mycobacterium phage Nenae, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

338. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to JN624851 (Mycobacterium phage Redi, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

339. spacer 16.1|5578121|34|CP027022|CRISPRCasFinder matches to MK524528 (Mycobacterium phage ShrimpFriedEgg, complete genome) position: , mismatch: 9, identity: 0.735

gacccatgaggcgggccacttcgacggcgaacga	CRISPR spacer
tccacgtgcggcgggcctcttcgacggcgatctg	Protospacer
  * *.** ******** ************ * .

340. spacer 9.2|2972525|37|CP027022|PILER-CR matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.73

acctgtccggccgcctgcgccgacgc----ctgcgatccgt	CRISPR spacer
acctgtgcggctgcctgcgccgacgcgatattgcacg----	Protospacer
****** ****.**************    .***.

341. spacer 11.1|3257421|31|CP027022|CRISPRCasFinder matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 10, identity: 0.677

tctccatcggctcggtgggctccttcctctc	CRISPR spacer
gtcgcatcggcgcggtgggcaccttccaggt	Protospacer
 .. ******* ******** ******   .

342. spacer 11.1|3257421|31|CP027022|CRISPRCasFinder matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 10, identity: 0.677

tctccatcggctcggtgggctccttcctctc	CRISPR spacer
gtcgcatcggcgcggtgggcaccttccaggt	Protospacer
 .. ******* ******** ******   .

343. spacer 12.2|3302283|32|CP027022|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 10, identity: 0.688

accaccgaggcccccgcgccgccgaaggcgaa	CRISPR spacer
accaccccggcccccgcgccgcccgccacccc	Protospacer
******  *************** .  .*

344. spacer 23.1|7089514|33|CP027022|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 10, identity: 0.697

tcgtccggttcgtccttgggctcgtcgtccggc	CRISPR spacer
cgctccgtttcgtccttgggctcgccgcgcacg	Protospacer
.  **** ****************.**. *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1515038 : 1526956

Bacillus_phage(50.0%)

plate,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVH94811.1\|1515038_1516649_+\|tail	phage tail protein	J9PVC2	Bacillus_phage	5.9e-61	32.8
AVH94812.1\|1516769_1517213_+\|tail	phage tail protein	NA	NA	NA	NA
AVH94813.1\|1517212_1517635_+	hypothetical protein	NA	NA	NA	NA
AVH94814.1\|1518407_1519985_-	hypothetical protein	NA	NA	NA	NA
AVH94815.1\|1520046_1520889_+	hypothetical protein	NA	NA	NA	NA
AVH94816.1\|1520940_1521378_+\|tail	phage tail protein	NA	NA	NA	NA
AVH94817.1\|1521379_1522108_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
AVH94818.1\|1522104_1523919_+	type IV secretion protein Rhs	NA	NA	NA	NA
AVH94819.1\|1523959_1524358_+\|plate	baseplate protein	A0A0E3FHN9	Synechococcus_phage	4.0e-11	35.4
AVH94820.1\|1524368_1526354_+\|plate	putative baseplate assembly protein	NA	NA	NA	NA
AVH94821.1\|1526350_1526956_+\|tail	phage tail protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP027025

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027025_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_1

8857-9496

TypeI-E

NA:I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGNGCGCNGGGAGCAG	CRT
TGGGTCCATCCCCGCGCACGCGGGGAGCAG	CRISPRCasFinder
TCCTGGGTCCATCCCCGCGCACGCGGGGAGCAG	PILER-CR

10 spacers

cas3

The CRISPR arrays of CP027025_1

>merge|CP027025|1|8857-9496|CRT,CRISPRCasFinder,PILER-CR
TCACACATCCCCGCAAGCGCAGGGAGCAGAAGCCCAGGTCCGGGCCCTGGACGAACCAGGAGGGTTCATCCCCGCAAGCGCAGGGAGCAGGTCGAGGAGCGGTCCACCGAGTGGGAGGCGAAGGGTCCATCCCCGCGAACGCGGAGAGCAGAACGTGTCGAGGCCGATCTGCGCGTACTTGTTGGGTCCATCCCCGCGAGCGCGGGGAGCAGGTGTCGCCAAGCGAGAGGCGCGTCGTGATGGCGGGTCCATCCCCGCGAGCGCAGGGAGCAGGTAGTCCTCGAAGGACAGCAGGGTCGTGGCGAGGGTCCATCCCCGCGGGCGCGGGGAGCAGGTCCGTCTTCGGGTCGTCCTCGAACACCTCCCAGGGTCGATCCCTGCGGGCGCGGGGAGCAGTCGGCACGAGCGCCTGACGTGGTCGACTTCGTGGGTCCATCCCCGCGGGCGCAGGGAGCAGCGTGCCGTCCGTGAGGCCGTGTTCGACGAGCTGGGTCCATCCCCGCGGGTGCGGGGAGCAGAGCGCCACCGCGCCGCGGACGGCCTCGATCGTGGGTCCATCCCCGCGCACGCGGGGAGCAGCCCCAGCTCGTCGCCTACAGCGCCGGAGTCCTGGGTCCATCCCCGCGCACGCGGGGAGCAG

>CP027025|1|1|8857-9496|CRT
TCACACATCCCCGCAAGCGCAGGGAGCAG	AAGCCCAGGTCCGGGCCCTGGACGAACCAGGA
GGGTTCATCCCCGCAAGCGCAGGGAGCAG	GTCGAGGAGCGGTCCACCGAGTGGGAGGCGAA
GGGTCCATCCCCGCGAACGCGGAGAGCAG	AACGTGTCGAGGCCGATCTGCGCGTACTTGTT
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GTGTCGCCAAGCGAGAGGCGCGTCGTGATGGC
GGGTCCATCCCCGCGAGCGCAGGGAGCAG	GTAGTCCTCGAAGGACAGCAGGGTCGTGGCGA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GTCCGTCTTCGGGTCGTCCTCGAACACCTCCCA
GGGTCGATCCCTGCGGGCGCGGGGAGCAG	TCGGCACGAGCGCCTGACGTGGTCGACTTCGT
GGGTCCATCCCCGCGGGCGCAGGGAGCAG	CGTGCCGTCCGTGAGGCCGTGTTCGACGAGCT
GGGTCCATCCCCGCGGGTGCGGGGAGCAG	AGCGCCACCGCGCCGCGGACGGCCTCGATCGT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CCCCAGCTCGTCGCCTACAGCGCCGGAGTCCT
GGGTCCATCCCCGCGCACGCGGGGAGCAG

>CP027025|1|1|8917-9496|CRISPRCasFinder
AGGGTTCATCCCCGCAAGCGCAGGGAGCAG	GTCGAGGAGCGGTCCACCGAGTGGGAGGCGA
AGGGTCCATCCCCGCGAACGCGGAGAGCAG	AACGTGTCGAGGCCGATCTGCGCGTACTTGT
TGGGTCCATCCCCGCGAGCGCGGGGAGCAG	GTGTCGCCAAGCGAGAGGCGCGTCGTGATGG
CGGGTCCATCCCCGCGAGCGCAGGGAGCAG	GTAGTCCTCGAAGGACAGCAGGGTCGTGGCG
AGGGTCCATCCCCGCGGGCGCGGGGAGCAG	GTCCGTCTTCGGGTCGTCCTCGAACACCTCCC
AGGGTCGATCCCTGCGGGCGCGGGGAGCAG	TCGGCACGAGCGCCTGACGTGGTCGACTTCG
TGGGTCCATCCCCGCGGGCGCAGGGAGCAG	CGTGCCGTCCGTGAGGCCGTGTTCGACGAGC
TGGGTCCATCCCCGCGGGTGCGGGGAGCAG	AGCGCCACCGCGCCGCGGACGGCCTCGATCG
TGGGTCCATCCCCGCGCACGCGGGGAGCAG	CCCCAGCTCGTCGCCTACAGCGCCGGAGTCC
TGGGTCCATCCCCGCGCACGCGGGGAGCAG

>CP027025|1|1|9344-9496|PILER-CR
CTGGGTCCATCCCCGCGGGTGCGGGGAGCAGAG	CGCCACCGCGCCGCGGACGGCCTCGATC
GTGGGTCCATCCCCGCGCACGCGGGGAGCAGCC	CCAGCTCGTCGCCTACAGCGCCGGAGTC
CTGGGTCCATCCCCGCGCACGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00273.1\|2931_3732_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379165
CP027025.1\|AVI00274.1\|3728_5192_-\|transposase	unknown	unknown	gnl\|CDD\|366234
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00277.1\|9862_10459_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	unknown	unknown	gnl\|CDD\|187578
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240032
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00271.1\|632_2096_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00275.1\|6095_8183_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00278.1\|10831_11113_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00272.1\|2092_2938_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379165

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240032	cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.8357e-28
CP027025.1\|AVI00273.1\|2931_3732_-\|ATP-binding-protein	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	2.17443e-13
CP027025.1\|AVI00274.1\|3728_5192_-\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.78133e-07
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.2265e-27
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00272.1\|2092_2938_-\|ATP-binding-protein	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	5.0665e-12
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.13042e-32
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.91956e-60

>CP027025.1|AVI00275.1|6095_8183_-|hypothetical-protein
MDPDGTNINIAPFPLPATAEWQRRFVDGVLATEGVNVPRAALEQIAPFVDQPKSLLYSPRAQDKPERLRDDVLVPIRTDAGTALAVSVRLMGVAGTTWWHNERISTAFRSPADPARGDKPLLPAVRAWTAMTADGTERTFSALRSEFRTLSDLIETIERSGNELLGRDGHRPYDLLEDLVLNGQMEPCMYIAQQLVLDEASVDDDGAQRPAAYWAWPAVRGNNRTRARQTLLGLTSAEVVTGVPMAKLGKDGADVATNPSFWVHRYAQHLNTAYREAFQANNTDATAVRAAKVAVVQAHLVIGSPTPERLYRIVQSSNRRDHVHPPLEFRPNDRSRSLGRSILGSYSAAGILPEMVADVLAGTQPIDRLPEGPGDASVSVQRDWRSMRLLAEFFPAEDDARRPLIRAALSEPAPSTLLRAHVNRRLRAWSALTSESYPEPWNPRVADALPVALAKDGVTEVEVPLTRRTLADLLACADTDPEAFEELLAYRAPHWLAAFDLIDADRGSVGAQRGDSATDQTVDGEESLRIRRGVNNAIAAMRNDPVRAVALLRELALAMDEGDRDPLQVDESGTRLDQVATRAWFNRAFPKTAATAPRVSTGQPTPGAAAAPPESDTQAVKRLRRELNEILTSLEEGVKLLPGVVAQMRAHARAAHIDQPLPEARAQQAALQVTGLLPLLRELPELLLALGNREA
>CP027025.1|AVI00274.1|3728_5192_-|transposase
MRLVAESVGVSVRQVWRWLAQAEETGSTEKPERRRFRITEEIIEVLADHQGNVKRAHEHLVRAAKAAGQKPIGLTTLHDAIARDLDPGFMAGLREGIPAARGFDPAFQRPAVARNQVWEGDHKQAPLVVMMPDKKLSKVWVTWFEDRGTGYVMGWAVTAGSAHRGSVLAAVRAAVLREDPYGPAGGLPQLVRVDGGADFLSRTVRRAFGLLGVPVHRVRSARHKGGIERLNRTSMTRFFADLPRYTKAPQLDHRSRLGETDPPLTFEAFVGLLREWVTEHNTQHVVKRTGVTPLEAWLADPTEIRPEPTPDELRAFMLESDHRPRKITSHGVEFAGRCYMPANGVGRIGVQVRVRWMPHHSHEIDLYTFRRDRYLGRAFLSDQATEELRAKVLADRAEHSADLRRALKRSGERRRDRYLPATEPQLPASATRMTKQEALAELAGSGGRAPAAPRRRAEPYSPLTPIPAGWARPGQATDTAHPSPEDT
>CP027025.1|AVI00273.1|2931_3732_-|ATP-binding-protein
MTTTTTAAPPQPPEPAAPRRPDLRPQFFLGLEDSSLVATDTLLQIKDTVVDTVESRAMSVIYGDAGLGKSFGTRATIQEMNPDLILPLDFARSRPGPKDLREELFHQMNLSCKMPGTPTAFDKLLRETLPRRPYVIVCDEAQQYRRENFEFLRKLWDNCDPKPAILFVGGREAYETLQSDPALASRIYIRLEILAMTEEEVLKTVPDSHPVWRGAEEALLKRVDTQYALGSFREWVKVTKHVIKGMEHFKADKVDDAIVDWALKRC
>CP027025.1|AVI00272.1|2092_2938_-|ATP-binding-protein
MLTTPPPPPAVWGTAGAAEPFAVLEDAAPPGLHFLDTPGVRTLLTPGMLAVGDALADAYAQGRFVCVLGDAGVGKTFAVHTAARRLGELLLLPLLLPLYLGAQPTPADLRACLHKALKLRGEPPADPGAADAWIRRALALGPRIVVVEDAHRLSASCFEYLRFLHDDLPQGLCVVLIAQTRGERSLRAQRMLATRTAGWPYIWPLTRDQVPKAVRALHPLWQSVAPDDLKTLDARIADGCLRRWAVLTFHTQRALAVTGATKPDWGLLEAVADRVDGGRRP
>CP027025.1|AVI00271.1|632_2096_-|hypothetical-protein
MTAPTLPPVPIPPPAAPSSSVARAAGPVRLLLDGDDDQAVHRAAYQRADPARGWITVDPTPHTTSPAYLALDVLRAMGRDGYLRPEAERLSTDPAWRAVTCWTVATDVHEVIVLRAHRLTTERLRRLAAWRADTGIRLTLLAHTPERDDFQRLLELLTAAHLVDVATVTGTAAVLGAIGPAATGRRYGPPPRDHVHPLPTVPRSGMAAFRADCWRRQNATDFAHTDGQYRAGYAAARTWLARLPAQPPAIGGIEPADGPAAPTPFSLQETEAVRLFLARLTVSSPSPQHTVARVRGAQAGFLSRSLLLNVPDDLTSRAGPGITTVPLTPRAVHTITVRLPNPLRAAAVAALLFTGTDTSLLSMTQIGSVDEAGTTVAIDRDSRIHIGEPPGPRHMYAVPPRARPLLQAAREFRRRTPRTADAHGLFANCFGTTPRFEALIADAGLPIPALAHPHVGDDWHTAARCWHLHTPQPPAPDVLPNLGELRP
>CP027025.1|AVI00277.1|9862_10459_+|hypothetical-protein
MGFSGHLVFACSKRPLLEAPMFNSTGPELRDDVHECQPRPGGWQTLQLKQGIWEDEHLSTLVEWTKAPACFADVSDSSVALVTGLDADGHRWQAWLNLDNAAALLVEKPEDVDDVSLWLATPEFEEAIGHKRAELDAEVPADAEGALVWASAAGVQAATQRSRIEELLRTRETFVEELFDALLDELGFPEAVHPAPQP
>CP027025.1|AVI00278.1|10831_11113_-|hypothetical-protein
MISPRFGNPRQLLVIACAVAALTIAILSWYAVQNVRPDCVVGISKVTDVHGNTLLSQDGRVLSDKELLDLAYEQAVDSGHCDPPRVRWKQWLS
>CP027025.1|AVI00279.1|11378_12212_-|capsule-biosynthesis-protein-CapD
MILVTGATGNIGSALLKELHVRGVGPLRGLTRDAARAALPQGVEAVEGDFADPASLKPALKGVRSLFLVSRLGPDADILEAARQAGVEHVVLVSSITVQTHPHLGPADENLAVERLLKETGMAWTILRPTQFASNALMWAASIRSRETVRAPYAETALPTIHPADIASVARVALTEPGHHRRTHALTGPEPITVRQQVEAIAAVLGREVPFVEISRRQAHAQMVAVFGTEAADAVLDVTGGDVNPELLMVRDTVSQVTGTPARSFRQWASENADAFR
>CP027025.1|AVI00280.1|12958_13708_-|IS5/IS1182-family-transposase
MVPHPAALDLPHALVEWVTMLIVTREGDRRCKLPPHRRALVALVYLRRHDTLARIAAGFGISVGTAHAYITAVTGLLAERAPGLLRTLREHDPEFVLLDGTLAECDRVGDSRADYSAKHRRHGVNVQVVTDPVGKVLWISPALPGRTHDLTAARTHRIIRICERQGVPILADRAYQGAGPWVTTGLKRPPGGELTLTQRTVNRALAQARAPIERGMARLKSWQIFRRSRISPNRMTVIAKAVLTLERQR
>CP027025.1|AVI00281.1|13918_14725_+|IS5/IS1182-family-transposase
MVISLITPATEGALLVPYPATLDVPYELVEHVAWLLHERRLACNTRWRKLGCFKQALLALVHLRKNETFSQLGAGFGISQATAWRYVDETLDVLAGWAPGLHEALTGLGEGDHVIVDGTLIAIDRIRADEPYYSMKHRRHGMNVQVITRPDGVPLWFSRATPGRTHDLTAARAHGIIQACLTRQILVLADRAYQGAGATVRTPYYRHHEQPEHYQQFNRDHARLRAPGERAFAQLKSWRILRRARCSTRRIGTIIQAVHTLLTCNYSG
>CP027025.1|AVI00282.1|14714_15086_+|NUDIX-domain-containing-protein
MQDERGSVTGIIDPGEQPADAAAREVLEETGIVAVPQRLAMVHVTDPVVYDNGDQTQYLDLVFHLSWQSGVPRPADGENTAAGWFPLNGLPAMPDDMRKRITAALSNEQTAQYVFSPPSPDGA
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_2

18015-18410

TypeI-E

I-E:I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRT
GCATGGGTCCATCCCCGCGCACGCGGGGAGCAG	PILER-CR

6 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e

The CRISPR arrays of CP027025_2

>merge|CP027025|2|18015-18410|CRISPRCasFinder,CRT,PILER-CR
GGGTCCATCCCCGCGCACGCGGGGAGCAGGGTGACGGTCACGGGCGGTGCTCCTGGGCGGTGGGTCCATCCCCGCGCACGCGGGGAGCAGACGCAGCTCCTCCAGGCCGGGCCTGACGGCCTGGGTCCATCCCCGCGCACGCGGGGAGCAGCTCTGGTTGAGTACGACGACGAGCAGGGTCTCGGGTCCATCCCCGCAGGCGCGGGGAGCAGGGATCGCGCCGTCACATGCGGGTGGGCGGCTTGGGTCCATCCCCGCGCACGCGGGGAGCAGTACCGGACGGCGCTGGAGGCCGGTCCGATCCAGGGTCCATCCCCGCGCACGCGGGGAGCAGAGTACCAGCGCCCCGGACGCGGCGACCTGCATGGGTCCATCCCCGCGCACGCGGGGAGCAGC

>CP027025|2|2|18015-18410|CRISPRCasFinder
GGGTCCATCCCCGCGCACGCGGGGAGCAG	GGTGACGGTCACGGGCGGTGCTCCTGGGCGGT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	ACGCAGCTCCTCCAGGCCGGGCCTGACGGCCT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CTCTGGTTGAGTACGACGACGAGCAGGGTCTC
GGGTCCATCCCCGCAGGCGCGGGGAGCAG	GGATCGCGCCGTCACATGCGGGTGGGCGGCTT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	TACCGGACGGCGCTGGAGGCCGGTCCGATCCA
GGGTCCATCCCCGCGCACGCGGGGAGCAG	AGTACCAGCGCCCCGGACGCGGCGACCTGCAT
GGGTCCATCCCCGCGCACGCGGGGAGCAGC

>CP027025|2|2|18015-18409|CRT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	GGTGACGGTCACGGGCGGTGCTCCTGGGCGGT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	ACGCAGCTCCTCCAGGCCGGGCCTGACGGCCT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CTCTGGTTGAGTACGACGACGAGCAGGGTCTC
GGGTCCATCCCCGCAGGCGCGGGGAGCAG	GGATCGCGCCGTCACATGCGGGTGGGCGGCTT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	TACCGGACGGCGCTGGAGGCCGGTCCGATCCA
GGGTCCATCCCCGCGCACGCGGGGAGCAG	AGTACCAGCGCCCCGGACGCGGCGACCTGCAT
GGGTCCATCCCCGCGCACGCGGGGAGCAG

>CP027025|2|2|18255-18409|PILER-CR
GCTTGGGTCCATCCCCGCGCACGCGGGGAGCAG	TACCGGACGGCGCTGGAGGCCGGTCCGATCCA
GGGTCCATCCCCGCGCACGCGGGGAGCAGAGTA	CCAGCGCCCCGGACGCGGCGACCTGCAT
GGGTCCATCCCCGCGCACGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00276.1\|8809_9217_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00277.1\|9862_10459_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	unknown	unknown	gnl\|CDD\|187578
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240032
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00278.1\|10831_11113_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.13042e-32
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.2265e-27
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.91956e-60
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240032	cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.8357e-28

>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00282.1|14714_15086_+|NUDIX-domain-containing-protein
MQDERGSVTGIIDPGEQPADAAAREVLEETGIVAVPQRLAMVHVTDPVVYDNGDQTQYLDLVFHLSWQSGVPRPADGENTAAGWFPLNGLPAMPDDMRKRITAALSNEQTAQYVFSPPSPDGA
>CP027025.1|AVI00281.1|13918_14725_+|IS5/IS1182-family-transposase
MVISLITPATEGALLVPYPATLDVPYELVEHVAWLLHERRLACNTRWRKLGCFKQALLALVHLRKNETFSQLGAGFGISQATAWRYVDETLDVLAGWAPGLHEALTGLGEGDHVIVDGTLIAIDRIRADEPYYSMKHRRHGMNVQVITRPDGVPLWFSRATPGRTHDLTAARAHGIIQACLTRQILVLADRAYQGAGATVRTPYYRHHEQPEHYQQFNRDHARLRAPGERAFAQLKSWRILRRARCSTRRIGTIIQAVHTLLTCNYSG
>CP027025.1|AVI00280.1|12958_13708_-|IS5/IS1182-family-transposase
MVPHPAALDLPHALVEWVTMLIVTREGDRRCKLPPHRRALVALVYLRRHDTLARIAAGFGISVGTAHAYITAVTGLLAERAPGLLRTLREHDPEFVLLDGTLAECDRVGDSRADYSAKHRRHGVNVQVVTDPVGKVLWISPALPGRTHDLTAARTHRIIRICERQGVPILADRAYQGAGPWVTTGLKRPPGGELTLTQRTVNRALAQARAPIERGMARLKSWQIFRRSRISPNRMTVIAKAVLTLERQR
>CP027025.1|AVI00279.1|11378_12212_-|capsule-biosynthesis-protein-CapD
MILVTGATGNIGSALLKELHVRGVGPLRGLTRDAARAALPQGVEAVEGDFADPASLKPALKGVRSLFLVSRLGPDADILEAARQAGVEHVVLVSSITVQTHPHLGPADENLAVERLLKETGMAWTILRPTQFASNALMWAASIRSRETVRAPYAETALPTIHPADIASVARVALTEPGHHRRTHALTGPEPITVRQQVEAIAAVLGREVPFVEISRRQAHAQMVAVFGTEAADAVLDVTGGDVNPELLMVRDTVSQVTGTPARSFRQWASENADAFR
>CP027025.1|AVI00278.1|10831_11113_-|hypothetical-protein
MISPRFGNPRQLLVIACAVAALTIAILSWYAVQNVRPDCVVGISKVTDVHGNTLLSQDGRVLSDKELLDLAYEQAVDSGHCDPPRVRWKQWLS
>CP027025.1|AVI00277.1|9862_10459_+|hypothetical-protein
MGFSGHLVFACSKRPLLEAPMFNSTGPELRDDVHECQPRPGGWQTLQLKQGIWEDEHLSTLVEWTKAPACFADVSDSSVALVTGLDADGHRWQAWLNLDNAAALLVEKPEDVDDVSLWLATPEFEEAIGHKRAELDAEVPADAEGALVWASAAGVQAATQRSRIEELLRTRETFVEELFDALLDELGFPEAVHPAPQP
>CP027025.1|AVI00276.1|8809_9217_-|hypothetical-protein
MFEDDPKTDLLPAPAGMDPRHDPAVLRGLPAPCARGDGPAITTRLSLGDTCSPRSRGWTQQVRADRPRHVLLSAFAGMDPSPPTRWTAPRPAPCACGDEPSWFVQGPDLGFCSLRLRGCVRFGEPGTGMFGFWCH
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_3

18563-19890

TypeI-E

I-E

Consensus_repeat	Method
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCGNGCGCGGGGAGCAG	CRT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	PILER-CR

21 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e

The CRISPR arrays of CP027025_3

>merge|CP027025|3|18563-19890|CRISPRCasFinder,CRT,PILER-CR
AGGTCCATCCCCGCGAGCGCGGGGAGCAGCGTCGGGCGGGGTCACTGGCGGACTCCCAACGGGGCCCATCCCCACGAGTGCAGGGAGCAGGGATGACCTCTTTGCCAGCCTCGCCCACCAGGCCCACCACGGGCCGGCCCACGATCCCGCCGGGTCTATCCCCGCGAGCACGGAGAACAGCCATACGTCAGCGTCGCGCCACCGCCAGCCGGGGGCCCATCCCCGCAAGCGCAGGGAGCAGATAGTCCTCGAAGGACAGCAAGGTCGTGGCGAGGATCCATCCCCGCGAGCGCGGGGAGCAGCTCAGGTCCACCGACAACTTCGCGGCCGACACGGGTCCATCCCTGCGAGTGCAGGGAGCAGGCCGCAGCCGCCCGCGCGGCAGGCCACGGAGAAGGTTCATCCCTGCGAGCGCGGGAAGCAGCTTTTCAGGAGGCTGGAGGCGCGCAACGCGTCGGGTCCATCCCCGCAGGCACGGGGAGCAGCGCGTTTGCCCCTTGCAGCCCCGATTCATCCGGGGTCCATCCCCGTAGGCGCGGGGAGCAGGCGACGAGGGCGGCCGCGCTGGGTCCATCCCCGCGGGCGCGGGGAGCAGGAGGGCGTGTAGCTCTCCTCGAAGGGGGTGCCGGGTCCATCCCCGCGGGCGCGGGGAGCAGTCTGCGGCGGCCGGCGCCGGGCCGCGCTTGGGGGGTCCATCCCCGCGGGCGCGGGGAGCAGGGACGACGAGCAGGGCGAGCGTGGACACGGTGGGGTCCATCCCCGCGGGCGCGGGGAGCAGACGGCGTGCGTGCAGTGTGCACAGAGCGGAAAGGGTCCATCCCCGCGGGCGCGGGGAGCAGCCGGTCTTCGACAGTCTGGGGAACACGACGTGGGGTCCATCCCCGCGGGCGCGGGGAGCAGCACGCCCGGTTCCGAGGAGCGCCGGACGCGGCGGGTCCATCCCCGCGGGCGCGGGGAGCAGGGCGGGATGTCGAGGCGTTCGATGCCGGTGGTGGGTCCATCCCCGCGGGCGCGGGGAGCAGGACTCGGAGAGGATCTCCAGGTTGTCTTCCTTGGGTCCATCCCCGCGGGCGCGGGGAGCAGTTAACTGTTCCCGTTCGTAGCCGTAACGGTCCGAGGTCCATCCCCGCGGGCGCGGGGAGCAGGCCTCCCAGCCGGAGGGCAGACTCGTCGTGAAGGGTCCATCCCCGCGGGCGCGGGGAGCAGAAGTGCTCGGCGATCCGCAGGCGGCGGAGGCTGGGTCCATCCCCGCGGGCGCGGGGAGCAGCGGATTACCCGACGGGGCTTCTTTGTGAAGGGGGGTCCATCCCCGCGGGCGCGGGGAGCAG

>CP027025|3|3|18563-19890|CRISPRCasFinder
AGGTCCATCCCCGCGAGCGCGGGGAGCAG	CGTCGGGCGGGGTCACTGGCGGACTCCCAACG
GGGCCCATCCCCACGAGTGCAGGGAGCAG	GGATGACCTCTTTGCCAGCCTCGCCCACCAGGCCCACCACGGGCCGGCCCACGATCCCGCC
GGGTCTATCCCCGCGAGCACGGAGAACAG	CCATACGTCAGCGTCGCGCCACCGCCAGCCGG
GGGCCCATCCCCGCAAGCGCAGGGAGCAG	ATAGTCCTCGAAGGACAGCAAGGTCGTGGCGA
GGATCCATCCCCGCGAGCGCGGGGAGCAG	CTCAGGTCCACCGACAACTTCGCGGCCGACAC
GGGTCCATCCCTGCGAGTGCAGGGAGCAG	GCCGCAGCCGCCCGCGCGGCAGGCCACGGAGA
AGGTTCATCCCTGCGAGCGCGGGAAGCAG	CTTTTCAGGAGGCTGGAGGCGCGCAACGCGTC
GGGTCCATCCCCGCAGGCACGGGGAGCAG	CGCGTTTGCCCCTTGCAGCCCCGATTCATCCG
GGGTCCATCCCCGTAGGCGCGGGGAGCAG	GCGACGAGGGCGGCCGCGCT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GAGGGCGTGTAGCTCTCCTCGAAGGGGGTGCC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TCTGCGGCGGCCGGCGCCGGGCCGCGCTTGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGACGACGAGCAGGGCGAGCGTGGACACGGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	ACGGCGTGCGTGCAGTGTGCACAGAGCGGAAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CCGGTCTTCGACAGTCTGGGGAACACGACGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CACGCCCGGTTCCGAGGAGCGCCGGACGCGGC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGCGGGATGTCGAGGCGTTCGATGCCGGTGGT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GACTCGGAGAGGATCTCCAGGTTGTCTTCCTT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TTAACTGTTCCCGTTCGTAGCCGTAACGGTCCG
AGGTCCATCCCCGCGGGCGCGGGGAGCAG	GCCTCCCAGCCGGAGGGCAGACTCGTCGTGAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	AAGTGCTCGGCGATCCGCAGGCGGCGGAGGCT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CGGATTACCCGACGGGGCTTCTTTGTGAAGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG

>CP027025|3|3|18563-19890|CRT
AGGTCCATCCCCGCGAGCGCGGGGAGCAG	CGTCGGGCGGGGTCACTGGCGGACTCCCAACG
GGGCCCATCCCCACGAGTGCAGGGAGCAG	GGATGACCTCTTTGCCAGCCTCGCCCACCAGGCCCACCACGGGCCGGCCCACGATCCCGCC
GGGTCTATCCCCGCGAGCACGGAGAACAG	CCATACGTCAGCGTCGCGCCACCGCCAGCCGG
GGGCCCATCCCCGCAAGCGCAGGGAGCAG	ATAGTCCTCGAAGGACAGCAAGGTCGTGGCGA
GGATCCATCCCCGCGAGCGCGGGGAGCAG	CTCAGGTCCACCGACAACTTCGCGGCCGACAC
GGGTCCATCCCTGCGAGTGCAGGGAGCAG	GCCGCAGCCGCCCGCGCGGCAGGCCACGGAGA
AGGTTCATCCCTGCGAGCGCGGGAAGCAG	CTTTTCAGGAGGCTGGAGGCGCGCAACGCGTC
GGGTCCATCCCCGCAGGCACGGGGAGCAG	CGCGTTTGCCCCTTGCAGCCCCGATTCATCCG
GGGTCCATCCCCGTAGGCGCGGGGAGCAG	GCGACGAGGGCGGCCGCGCT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GAGGGCGTGTAGCTCTCCTCGAAGGGGGTGCC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TCTGCGGCGGCCGGCGCCGGGCCGCGCTTGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGACGACGAGCAGGGCGAGCGTGGACACGGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	ACGGCGTGCGTGCAGTGTGCACAGAGCGGAAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CCGGTCTTCGACAGTCTGGGGAACACGACGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CACGCCCGGTTCCGAGGAGCGCCGGACGCGGC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGCGGGATGTCGAGGCGTTCGATGCCGGTGGT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GACTCGGAGAGGATCTCCAGGTTGTCTTCCTT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TTAACTGTTCCCGTTCGTAGCCGTAACGGTCCG
AGGTCCATCCCCGCGGGCGCGGGGAGCAG	GCCTCCCAGCCGGAGGGCAGACTCGTCGTGAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	AAGTGCTCGGCGATCCGCAGGCGGCGGAGGCT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CGGATTACCCGACGGGGCTTCTTTGTGAAGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG

>CP027025|3|3|19129-19890|PILER-CR
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GAGGGCGTGTAGCTCTCCTCGAAGGGGGTGCC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TCTGCGGCGGCCGGCGCCGGGCCGCGCTTGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGACGACGAGCAGGGCGAGCGTGGACACGGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	ACGGCGTGCGTGCAGTGTGCACAGAGCGGAAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CCGGTCTTCGACAGTCTGGGGAACACGACGTG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CACGCCCGGTTCCGAGGAGCGCCGGACGCGGC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GGCGGGATGTCGAGGCGTTCGATGCCGGTGGT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	GACTCGGAGAGGATCTCCAGGTTGTCTTCCTT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	TTAACTGTTCCCGTTCGTAGCCGTAACGGTCCG
AGGTCCATCCCCGCGGGCGCGGGGAGCAG	GCCTCCCAGCCGGAGGGCAGACTCGTCGTGAA
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	AAGTGCTCGGCGATCCGCAGGCGGCGGAGGCT
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CGGATTACCCGACGGGGCTTCTTTGTGAAGGG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00276.1\|8809_9217_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00277.1\|9862_10459_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	unknown	unknown	gnl\|CDD\|187578
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240032
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372577
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00278.1\|10831_11113_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00280.1\|12958_13708_-\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.13042e-32
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00281.1\|13918_14725_+\|IS5/IS1182-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.2265e-27
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00279.1\|11378_12212_-\|capsule-biosynthesis-protein-CapD	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.91956e-60
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240032	cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.8357e-28

>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00282.1|14714_15086_+|NUDIX-domain-containing-protein
MQDERGSVTGIIDPGEQPADAAAREVLEETGIVAVPQRLAMVHVTDPVVYDNGDQTQYLDLVFHLSWQSGVPRPADGENTAAGWFPLNGLPAMPDDMRKRITAALSNEQTAQYVFSPPSPDGA
>CP027025.1|AVI00281.1|13918_14725_+|IS5/IS1182-family-transposase
MVISLITPATEGALLVPYPATLDVPYELVEHVAWLLHERRLACNTRWRKLGCFKQALLALVHLRKNETFSQLGAGFGISQATAWRYVDETLDVLAGWAPGLHEALTGLGEGDHVIVDGTLIAIDRIRADEPYYSMKHRRHGMNVQVITRPDGVPLWFSRATPGRTHDLTAARAHGIIQACLTRQILVLADRAYQGAGATVRTPYYRHHEQPEHYQQFNRDHARLRAPGERAFAQLKSWRILRRARCSTRRIGTIIQAVHTLLTCNYSG
>CP027025.1|AVI00280.1|12958_13708_-|IS5/IS1182-family-transposase
MVPHPAALDLPHALVEWVTMLIVTREGDRRCKLPPHRRALVALVYLRRHDTLARIAAGFGISVGTAHAYITAVTGLLAERAPGLLRTLREHDPEFVLLDGTLAECDRVGDSRADYSAKHRRHGVNVQVVTDPVGKVLWISPALPGRTHDLTAARTHRIIRICERQGVPILADRAYQGAGPWVTTGLKRPPGGELTLTQRTVNRALAQARAPIERGMARLKSWQIFRRSRISPNRMTVIAKAVLTLERQR
>CP027025.1|AVI00279.1|11378_12212_-|capsule-biosynthesis-protein-CapD
MILVTGATGNIGSALLKELHVRGVGPLRGLTRDAARAALPQGVEAVEGDFADPASLKPALKGVRSLFLVSRLGPDADILEAARQAGVEHVVLVSSITVQTHPHLGPADENLAVERLLKETGMAWTILRPTQFASNALMWAASIRSRETVRAPYAETALPTIHPADIASVARVALTEPGHHRRTHALTGPEPITVRQQVEAIAAVLGREVPFVEISRRQAHAQMVAVFGTEAADAVLDVTGGDVNPELLMVRDTVSQVTGTPARSFRQWASENADAFR
>CP027025.1|AVI00278.1|10831_11113_-|hypothetical-protein
MISPRFGNPRQLLVIACAVAALTIAILSWYAVQNVRPDCVVGISKVTDVHGNTLLSQDGRVLSDKELLDLAYEQAVDSGHCDPPRVRWKQWLS
>CP027025.1|AVI00277.1|9862_10459_+|hypothetical-protein
MGFSGHLVFACSKRPLLEAPMFNSTGPELRDDVHECQPRPGGWQTLQLKQGIWEDEHLSTLVEWTKAPACFADVSDSSVALVTGLDADGHRWQAWLNLDNAAALLVEKPEDVDDVSLWLATPEFEEAIGHKRAELDAEVPADAEGALVWASAAGVQAATQRSRIEELLRTRETFVEELFDALLDELGFPEAVHPAPQP
>CP027025.1|AVI00276.1|8809_9217_-|hypothetical-protein
MFEDDPKTDLLPAPAGMDPRHDPAVLRGLPAPCARGDGPAITTRLSLGDTCSPRSRGWTQQVRADRPRHVLLSAFAGMDPSPPTRWTAPRPAPCACGDEPSWFVQGPDLGFCSLRLRGCVRFGEPGTGMFGFWCH
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_4

28301-28509

TypeI-E

I-E

Consensus_repeat	Method
GGGTCCATCCCCGCGGGCGCGGGGAGCAG	CRT

3 spacers

cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP027025_4

>merge|CP027025|4|28301-28509|CRT
GAGTCCATCCCCGCGGGCACGGGGAGCAGAGCGGTGGTCGCGTTCCATATGGCCACCGTGGGTCCATCCCCGCGGGTGCGGGGAGCAGGAGCGGGCATCGTCGGGGCCGGGGAGCGTGTCGGGTCCACCCCGCGGGCGCAAAGAGCAGGCTTCACGGACCCGCCGAGCACCATTGTTGGCGGGTCCATCCCCGCGGGCGCGGGGGGGGC

>CP027025|4|4|28301-28509|CRT
GAGTCCATCCCCGCGGGCACGGGGAGCAG	AGCGGTGGTCGCGTTCCATATGGCCACCGT
GGGTCCATCCCCGCGGGTGCGGGGAGCAG	GAGCGGGCATCGTCGGGGCCGGGGAGCGTGT
CGGGTCCACCCCGCGGGCGCAAAGAGCAG	GCTTCACGGACCCGCCGAGCACCATTGTTGGC
GGGTCCATCCCCGCGGGCGCGGGGGGGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00294.1\|34836_35451_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00315.1\|38361_38811_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240032
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027025.1\|AVI00314.1\|36182_36773_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00296.1\|41126_41426_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.99322e-29
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.51563e-30
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240032	cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.8357e-28

>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00282.1|14714_15086_+|NUDIX-domain-containing-protein
MQDERGSVTGIIDPGEQPADAAAREVLEETGIVAVPQRLAMVHVTDPVVYDNGDQTQYLDLVFHLSWQSGVPRPADGENTAAGWFPLNGLPAMPDDMRKRITAALSNEQTAQYVFSPPSPDGA
>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR
>CP027025.1|AVI00294.1|34836_35451_-|hypothetical-protein
MAFGGMTAQADETGCGRCFDEVEVELLRTPDVPLPTDLVGRVAQKEPFHWDDQPAIIRRVLPQLVVVLAEGAVESALMARGLAAAGWSRWPREQTGAVAGFLEAWWTQALRMKSPPTPVCEVFETCVTASSSVAPWLARWEAETGPVARHHLTESVGWWREELASDDSPFWWWWGTAAEERAAWHEVKTWLAAQTQATMVPDGL
>CP027025.1|AVI00314.1|36182_36773_+|hypothetical-protein
MEPKDQHARHLAHVVRKPLLERASLPEEWFAPLMAAAVYDPDPSFCRWFVEPAVYAFGRRRVMAALVDYLRTGTDAERAGAVRAWYSAHVPLRADRTPAYGPGGVRDPALDESRDIKAAWLETSLRVFAEATDLQMRHRVLLGLPTSRAAYPPHLHELLESTLASARVHPDPHIRRWAAAADQPDSYPSRQLRDSP
>CP027025.1|AVI00315.1|38361_38811_+|hypothetical-protein
MSRDAEVIVLARWSNEVMEPLTQNDPERTWRGRFVPIAGQWGYEFGWALEFEKLRGRQGLLRHLESLPWPHPHTVQVLLRDQDDDCFGLWMFQEGRLVEVTIPRTERFHQPAPPNENFEPYPGMLLRTDQNTALPEQTPEARRDTRSPW
>CP027025.1|AVI00295.1|38932_39802_-|IS5-family-transposase
MGRGDLSDEEWARLEPHLPVNRGRGGRWQSHRRVINGILFRQRTGLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVDSTTCRAHQHAAGASTRAPKIPGRRRSLARHRPDEALGRSRGGLTSKIHLAGEGGCRPLGFVITPGQWGDAPQMIAVLKEIRVPRQTGGRPRTRPVHVGGDKAYSSRRNRRHLRRRQIKHTIPELRDQRANRRRRGSQGGRPTGFDKTIYRRRNEVERTINRLKNFRAVATRFDKRAYVFHRMVTVAAIRL
>CP027025.1|AVI00316.1|39904_40735_+|IS5-family-transposase
MRRHELSDAEWDLIRPLLPRPALGRPRLDDRMVLNGIVWKFRTGVPWRDVPERYGPWTSLHTRFRRWAADGTFDRILRAAQAKADAAGDIDWTVSVDSTIVRAHQHAAGARKGGAKARPSAGPEAGLTSKIHLVCDAIGRPLAFVLTGGNTNDCTQFTAVMDAIRVPRTGPGRPRTRPDHVIGDKGYSSKAIRTWLRRRGIRHTIPERADQVRNRARKGSLGGRPPVFDKDVYKHRNVVERCFSRLKQWRGIATRYDKTAQSYKAAVTLALILMWA
>CP027025.1|AVI00296.1|41126_41426_+|hypothetical-protein
MAIWDTVEDGDRRICAACGTAVRSYQFRLYPPESSMFERCVGLAWCSGCRIYFSAMVHISRTRVLADALGSLPEDESVRLRRSEAKLVDYLDRQDRRKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_5

28605-29579

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRISPRCasFinder

15 spacers

cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP027025_5

>merge|CP027025|5|28605-29579|CRISPRCasFinder
GGGCCCATCCCCACAGGCGCGGGGAACAGAGGGAGACGGCCAGGTCCCGGGAATAGGAGACGGGTCCATCCCCGCAGGCGCGGGGAGCAGAGGGTACCCGCAGCGTGGCCCTGCTCGATGCGGGGTCCATCCCCGCGGGCGCGAGGGGCAGCGGCCGACGTGCAGGTGGCGCAGTCGAGCCGGGGGGCCATCCTCGCAAGCGCGAGGAGCAGTTGACCAGCACCTTCCGGTCGTTGGTCCGGTAAGACCCATCCCTGCGGGCGCGGGGAACAGGTCACCACCGTCGACGACGGGGCCTTCACCGCGGGTCCATCCCCGCGAGCGCGGGGAGCAGACGGGGCCCCGGTACGAGGTCGGCCAGGTGCGAGGTCCATCCCCGCGGGCACGGGGAGCAGATCCAGATGCCCGGCTCGGACCGCATGAACATGGGTCCATCCCCGCAGGCGCGGGGAGCAGGCCGACATGGAGAAGATGGACTTCCCCTCGATGGGTCCATCCCCGCGAGCGCGGGGAGCGGGACACCGTCACCACCTTCATCGCGAACGTGCAGGGTCCATCCCCGCGAGCGCGGAGAGCAGGGATAACCTCTTTGCCGGCCTCGCCCACCAGGCCCACCACGGGCCGGTCCACGATCCCGCCGGGTCTATCCCTGCAAGCGCAGGGAGCAGGTAGTCCTCGAATGACAGCAGGGTCGTGGCGAGGGTCCATCGCCTCGAGCGCGGGGAGCAGTTCGCGGGATCGACGACGAAATGGTTCTCGATGGGTTCATCCCCGTGAGCGCAGGGAGCAGGCCGCAGCCGCCCGCGCGGCAGGCCACGGAGGAGGTCCATCCCCGCGAGCGCGGGGAGCAGCCGCCCCGTGTCCACCTGGCCCACCACCGCGTGGGTACATCCCCGCGGGCGCGGGGAGCAGCTCGGCCGACTTGGTGAACACGTTGGCGTTGTGGGGTCCATTCCCGCAGGCGCGGGGAGCAGT

>CP027025|5|4|28605-29579|CRISPRCasFinder
GGGCCCATCCCCACAGGCGCGGGGAACAG	AGGGAGACGGCCAGGTCCCGGGAATAGGAGAC
GGGTCCATCCCCGCAGGCGCGGGGAGCAG	AGGGTACCCGCAGCGTGGCCCTGCTCGATGCG
GGGTCCATCCCCGCGGGCGCGAGGGGCAG	CGGCCGACGTGCAGGTGGCGCAGTCGAGCCGG
GGGGCCATCCTCGCAAGCGCGAGGAGCAG	TTGACCAGCACCTTCCGGTCGTTGGTCCGGTA
AGACCCATCCCTGCGGGCGCGGGGAACAG	GTCACCACCGTCGACGACGGGGCCTTCACCGC
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	ACGGGGCCCCGGTACGAGGTCGGCCAGGTGCG
AGGTCCATCCCCGCGGGCACGGGGAGCAG	ATCCAGATGCCCGGCTCGGACCGCATGAACAT
GGGTCCATCCCCGCAGGCGCGGGGAGCAG	GCCGACATGGAGAAGATGGACTTCCCCTCGAT
GGGTCCATCCCCGCGAGCGCGGGGAGCGG	GACACCGTCACCACCTTCATCGCGAACGTGCA
GGGTCCATCCCCGCGAGCGCGGAGAGCAG	GGATAACCTCTTTGCCGGCCTCGCCCACCAGGCCCACCACGGGCCGGTCCACGATCCCGCC
GGGTCTATCCCTGCAAGCGCAGGGAGCAG	GTAGTCCTCGAATGACAGCAGGGTCGTGGCGA
GGGTCCATCGCCTCGAGCGCGGGGAGCAG	TTCGCGGGATCGACGACGAAATGGTTCTCGAT
GGGTTCATCCCCGTGAGCGCAGGGAGCAG	GCCGCAGCCGCCCGCGCGGCAGGCCACGGAGG
AGGTCCATCCCCGCGAGCGCGGGGAGCAG	CCGCCCCGTGTCCACCTGGCCCACCACCGCGT
GGGTACATCCCCGCGGGCGCGGGGAGCAG	CTCGGCCGACTTGGTGAACACGTTGGCGTTGTG
GGGTCCATTCCCGCAGGCGCGGGGAGCAGT

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00294.1\|34836_35451_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00315.1\|38361_38811_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240032
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027025.1\|AVI00314.1\|36182_36773_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00296.1\|41126_41426_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.99322e-29
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.51563e-30
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00282.1\|14714_15086_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240032	cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.8357e-28

>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00282.1|14714_15086_+|NUDIX-domain-containing-protein
MQDERGSVTGIIDPGEQPADAAAREVLEETGIVAVPQRLAMVHVTDPVVYDNGDQTQYLDLVFHLSWQSGVPRPADGENTAAGWFPLNGLPAMPDDMRKRITAALSNEQTAQYVFSPPSPDGA
>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR
>CP027025.1|AVI00294.1|34836_35451_-|hypothetical-protein
MAFGGMTAQADETGCGRCFDEVEVELLRTPDVPLPTDLVGRVAQKEPFHWDDQPAIIRRVLPQLVVVLAEGAVESALMARGLAAAGWSRWPREQTGAVAGFLEAWWTQALRMKSPPTPVCEVFETCVTASSSVAPWLARWEAETGPVARHHLTESVGWWREELASDDSPFWWWWGTAAEERAAWHEVKTWLAAQTQATMVPDGL
>CP027025.1|AVI00314.1|36182_36773_+|hypothetical-protein
MEPKDQHARHLAHVVRKPLLERASLPEEWFAPLMAAAVYDPDPSFCRWFVEPAVYAFGRRRVMAALVDYLRTGTDAERAGAVRAWYSAHVPLRADRTPAYGPGGVRDPALDESRDIKAAWLETSLRVFAEATDLQMRHRVLLGLPTSRAAYPPHLHELLESTLASARVHPDPHIRRWAAAADQPDSYPSRQLRDSP
>CP027025.1|AVI00315.1|38361_38811_+|hypothetical-protein
MSRDAEVIVLARWSNEVMEPLTQNDPERTWRGRFVPIAGQWGYEFGWALEFEKLRGRQGLLRHLESLPWPHPHTVQVLLRDQDDDCFGLWMFQEGRLVEVTIPRTERFHQPAPPNENFEPYPGMLLRTDQNTALPEQTPEARRDTRSPW
>CP027025.1|AVI00295.1|38932_39802_-|IS5-family-transposase
MGRGDLSDEEWARLEPHLPVNRGRGGRWQSHRRVINGILFRQRTGLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVDSTTCRAHQHAAGASTRAPKIPGRRRSLARHRPDEALGRSRGGLTSKIHLAGEGGCRPLGFVITPGQWGDAPQMIAVLKEIRVPRQTGGRPRTRPVHVGGDKAYSSRRNRRHLRRRQIKHTIPELRDQRANRRRRGSQGGRPTGFDKTIYRRRNEVERTINRLKNFRAVATRFDKRAYVFHRMVTVAAIRL
>CP027025.1|AVI00316.1|39904_40735_+|IS5-family-transposase
MRRHELSDAEWDLIRPLLPRPALGRPRLDDRMVLNGIVWKFRTGVPWRDVPERYGPWTSLHTRFRRWAADGTFDRILRAAQAKADAAGDIDWTVSVDSTIVRAHQHAAGARKGGAKARPSAGPEAGLTSKIHLVCDAIGRPLAFVLTGGNTNDCTQFTAVMDAIRVPRTGPGRPRTRPDHVIGDKGYSSKAIRTWLRRRGIRHTIPERADQVRNRARKGSLGGRPPVFDKDVYKHRNVVERCFSRLKQWRGIATRYDKTAQSYKAAVTLALILMWA
>CP027025.1|AVI00296.1|41126_41426_+|hypothetical-protein
MAIWDTVEDGDRRICAACGTAVRSYQFRLYPPESSMFERCVGLAWCSGCRIYFSAMVHISRTRVLADALGSLPEDESVRLRRSEAKLVDYLDRQDRRKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_6

30543-30755

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGCACGCGGGGAGCAGG	PILER-CR
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRT

3 spacers

cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP027025_6

>merge|CP027025|6|30543-30755|PILER-CR,CRISPRCasFinder,CRT
GGGTCCATCCCCGCGCACGCGGGGAGCAGGACATCACCGTCCGGATCTCCCGCGAGGCGACGGGTCCATCCCCGCGCACGCGGGGAGCAGTTGCCTTCGAAGACGACCGTCGCCAGGTCGTACGGTCCATCCCCGCGCACGCGGGGAGCAGGCCTTGAACACGCTGACGAAGATGCTGCCGACGGGTCCATCCCCGCGCACGCGGGGAGCAGC

>CP027025|6|4|30543-30694|PILER-CR
GGGTCCATCCCCGCGCACGCGGGGAGCAGG	ACATCACCGTCCGGATCTCCCGCGAGGCGAC
GGGTCCATCCCCGCGCACGCGGGGAGCAGT	TGCCTTCGAAGACGACCGTCGCCAGGTCGTA
CGGTCCATCCCCGCGCACGCGGGGAGCAGG

>CP027025|6|5|30543-30755|CRISPRCasFinder
GGGTCCATCCCCGCGCACGCGGGGAGCAG	GACATCACCGTCCGGATCTCCCGCGAGGCGAC
GGGTCCATCCCCGCGCACGCGGGGAGCAG	TTGCCTTCGAAGACGACCGTCGCCAGGTCGTA
CGGTCCATCCCCGCGCACGCGGGGAGCAG	GCCTTGAACACGCTGACGAAGATGCTGCCGAC
GGGTCCATCCCCGCGCACGCGGGGAGCAGC

>CP027025|6|5|30543-30754|CRT
GGGTCCATCCCCGCGCACGCGGGGAGCAG	GACATCACCGTCCGGATCTCCCGCGAGGCGAC
GGGTCCATCCCCGCGCACGCGGGGAGCAG	TTGCCTTCGAAGACGACCGTCGCCAGGTCGTA
CGGTCCATCCCCGCGCACGCGGGGAGCAG	GCCTTGAACACGCTGACGAAGATGCTGCCGAC
GGGTCCATCCCCGCGCACGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00294.1\|34836_35451_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225949
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00315.1\|38361_38811_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027025.1\|AVI00314.1\|36182_36773_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00296.1\|41126_41426_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.99322e-29
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.51563e-30
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.33604e-16

>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR
>CP027025.1|AVI00294.1|34836_35451_-|hypothetical-protein
MAFGGMTAQADETGCGRCFDEVEVELLRTPDVPLPTDLVGRVAQKEPFHWDDQPAIIRRVLPQLVVVLAEGAVESALMARGLAAAGWSRWPREQTGAVAGFLEAWWTQALRMKSPPTPVCEVFETCVTASSSVAPWLARWEAETGPVARHHLTESVGWWREELASDDSPFWWWWGTAAEERAAWHEVKTWLAAQTQATMVPDGL
>CP027025.1|AVI00314.1|36182_36773_+|hypothetical-protein
MEPKDQHARHLAHVVRKPLLERASLPEEWFAPLMAAAVYDPDPSFCRWFVEPAVYAFGRRRVMAALVDYLRTGTDAERAGAVRAWYSAHVPLRADRTPAYGPGGVRDPALDESRDIKAAWLETSLRVFAEATDLQMRHRVLLGLPTSRAAYPPHLHELLESTLASARVHPDPHIRRWAAAADQPDSYPSRQLRDSP
>CP027025.1|AVI00315.1|38361_38811_+|hypothetical-protein
MSRDAEVIVLARWSNEVMEPLTQNDPERTWRGRFVPIAGQWGYEFGWALEFEKLRGRQGLLRHLESLPWPHPHTVQVLLRDQDDDCFGLWMFQEGRLVEVTIPRTERFHQPAPPNENFEPYPGMLLRTDQNTALPEQTPEARRDTRSPW
>CP027025.1|AVI00295.1|38932_39802_-|IS5-family-transposase
MGRGDLSDEEWARLEPHLPVNRGRGGRWQSHRRVINGILFRQRTGLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVDSTTCRAHQHAAGASTRAPKIPGRRRSLARHRPDEALGRSRGGLTSKIHLAGEGGCRPLGFVITPGQWGDAPQMIAVLKEIRVPRQTGGRPRTRPVHVGGDKAYSSRRNRRHLRRRQIKHTIPELRDQRANRRRRGSQGGRPTGFDKTIYRRRNEVERTINRLKNFRAVATRFDKRAYVFHRMVTVAAIRL
>CP027025.1|AVI00316.1|39904_40735_+|IS5-family-transposase
MRRHELSDAEWDLIRPLLPRPALGRPRLDDRMVLNGIVWKFRTGVPWRDVPERYGPWTSLHTRFRRWAADGTFDRILRAAQAKADAAGDIDWTVSVDSTIVRAHQHAAGARKGGAKARPSAGPEAGLTSKIHLVCDAIGRPLAFVLTGGNTNDCTQFTAVMDAIRVPRTGPGRPRTRPDHVIGDKGYSSKAIRTWLRRRGIRHTIPERADQVRNRARKGSLGGRPPVFDKDVYKHRNVVERCFSRLKQWRGIATRYDKTAQSYKAAVTLALILMWA
>CP027025.1|AVI00296.1|41126_41426_+|hypothetical-protein
MAIWDTVEDGDRRICAACGTAVRSYQFRLYPPESSMFERCVGLAWCSGCRIYFSAMVHISRTRVLADALGSLPEDESVRLRRSEAKLVDYLDRQDRRKS
>CP027025.1|AVI00297.1|41647_42151_+|hypothetical-protein
MVSFKPSLVVPPLTRPQLAEARRVRAAELFDQERSGAEIARMLGVSQESVRRWRRVWEKDGADALRRRPATGRPPKLDDAQVERVRTALEQGAQAHGFEADLWTLERVGLVVGRVTGVTLSRASVWRLLTGRLGWSLQRPERRAVERDESEIARWIAHEWPRIKRGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_7

30850-31367

TypeI-E

I-E:I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCNNGCGCGGGGAGCAG	CRT
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	PILER-CR

8 spacers

cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP027025_7

>merge|CP027025|7|30850-31367|CRISPRCasFinder,CRT,PILER-CR
CGGGACGACTCCGCGAGCACGGGGAGCAGCCACGCCGCCGCCTGGTCGCCAGGGAAGTCGCAGGTCCATCCCCGCGGGCGCGGGGAGCAGGACAGACCGCCGAGGGCGATCCGGACGGAGTTGGATCCATCCCCGCAGGGGCGGGGAGCAGGCAGCCCCGATGACGGCCGCCCACTCGCCTACGGGTCCATCCCCGCAAGCGCGGGGAGCAGCGGCTCATGCACCGCGAGCAGACGTGGACGTTGGGTCCATCCCCGCAAGCGCAGGGAGCAGTCGACCGGCCCGCGCCCGTACTCGGCCGGCAGGGGTCCATCCCCGCGAGCGCGGGGAGCAGGCCGAGCTCCTCGGGAACCTCTTCCGCGCCCTGGGTCCATCCCCGCGAGCGCGGGGAGCAGGGCTTCGTCGTGTCCTGTCCCGGCCGGCCACCGGGTCCATCCCCGCGAGCGCGGGGAGCAGCCCGGCCGGGCTCTCACACACCGACCGGGGCCGGGTCCATCCCCGCGGGCGCGGGGAGCAGT

>CP027025|7|6|30850-31367|CRISPRCasFinder
CGGGACGACTCCGCGAGCACGGGGAGCAG	CCACGCCGCCGCCTGGTCGCCAGGGAAGTCGC
AGGTCCATCCCCGCGGGCGCGGGGAGCAG	GACAGACCGCCGAGGGCGATCCGGACGGAGTT
GGATCCATCCCCGCAGGGGCGGGGAGCAG	GCAGCCCCGATGACGGCCGCCCACTCGCCTAC
GGGTCCATCCCCGCAAGCGCGGGGAGCAG	CGGCTCATGCACCGCGAGCAGACGTGGACGTT
GGGTCCATCCCCGCAAGCGCAGGGAGCAG	TCGACCGGCCCGCGCCCGTACTCGGCCGGCAG
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GCCGAGCTCCTCGGGAACCTCTTCCGCGCCCT
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GGCTTCGTCGTGTCCTGTCCCGGCCGGCCACC
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	CCCGGCCGGGCTCTCACACACCGACCGGGGCC
GGGTCCATCCCCGCGGGCGCGGGGAGCAGT

>CP027025|7|6|30850-31366|CRT
CGGGACGACTCCGCGAGCACGGGGAGCAG	CCACGCCGCCGCCTGGTCGCCAGGGAAGTCGC
AGGTCCATCCCCGCGGGCGCGGGGAGCAG	GACAGACCGCCGAGGGCGATCCGGACGGAGTT
GGATCCATCCCCGCAGGGGCGGGGAGCAG	GCAGCCCCGATGACGGCCGCCCACTCGCCTAC
GGGTCCATCCCCGCAAGCGCGGGGAGCAG	CGGCTCATGCACCGCGAGCAGACGTGGACGTT
GGGTCCATCCCCGCAAGCGCAGGGAGCAG	TCGACCGGCCCGCGCCCGTACTCGGCCGGCAG
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GCCGAGCTCCTCGGGAACCTCTTCCGCGCCCT
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GGCTTCGTCGTGTCCTGTCCCGGCCGGCCACC
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	CCCGGCCGGGCTCTCACACACCGACCGGGGCC
GGGTCCATCCCCGCGGGCGCGGGGAGCAG

>CP027025|7|5|31033-31305|PILER-CR
GGGTCCATCCCCGCAAGCGCGGGGAGCAG	CGGCTCATGCACCGCGAGCAGACGTGGACGTT
GGGTCCATCCCCGCAAGCGCAGGGAGCAG	TCGACCGGCCCGCGCCCGTACTCGGCCGGCAG
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GCCGAGCTCCTCGGGAACCTCTTCCGCGCCCT
GGGTCCATCCCCGCGAGCGCGGGGAGCAG	GGCTTCGTCGTGTCCTGTCCCGGCCGGCCACC
GGGTCCATCCCCGCGAGCGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00294.1\|34836_35451_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225949
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00315.1\|38361_38811_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027025.1\|AVI00314.1\|36182_36773_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00296.1\|41126_41426_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.99322e-29
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.51563e-30
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.33604e-16

>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR
>CP027025.1|AVI00294.1|34836_35451_-|hypothetical-protein
MAFGGMTAQADETGCGRCFDEVEVELLRTPDVPLPTDLVGRVAQKEPFHWDDQPAIIRRVLPQLVVVLAEGAVESALMARGLAAAGWSRWPREQTGAVAGFLEAWWTQALRMKSPPTPVCEVFETCVTASSSVAPWLARWEAETGPVARHHLTESVGWWREELASDDSPFWWWWGTAAEERAAWHEVKTWLAAQTQATMVPDGL
>CP027025.1|AVI00314.1|36182_36773_+|hypothetical-protein
MEPKDQHARHLAHVVRKPLLERASLPEEWFAPLMAAAVYDPDPSFCRWFVEPAVYAFGRRRVMAALVDYLRTGTDAERAGAVRAWYSAHVPLRADRTPAYGPGGVRDPALDESRDIKAAWLETSLRVFAEATDLQMRHRVLLGLPTSRAAYPPHLHELLESTLASARVHPDPHIRRWAAAADQPDSYPSRQLRDSP
>CP027025.1|AVI00315.1|38361_38811_+|hypothetical-protein
MSRDAEVIVLARWSNEVMEPLTQNDPERTWRGRFVPIAGQWGYEFGWALEFEKLRGRQGLLRHLESLPWPHPHTVQVLLRDQDDDCFGLWMFQEGRLVEVTIPRTERFHQPAPPNENFEPYPGMLLRTDQNTALPEQTPEARRDTRSPW
>CP027025.1|AVI00295.1|38932_39802_-|IS5-family-transposase
MGRGDLSDEEWARLEPHLPVNRGRGGRWQSHRRVINGILFRQRTGLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVDSTTCRAHQHAAGASTRAPKIPGRRRSLARHRPDEALGRSRGGLTSKIHLAGEGGCRPLGFVITPGQWGDAPQMIAVLKEIRVPRQTGGRPRTRPVHVGGDKAYSSRRNRRHLRRRQIKHTIPELRDQRANRRRRGSQGGRPTGFDKTIYRRRNEVERTINRLKNFRAVATRFDKRAYVFHRMVTVAAIRL
>CP027025.1|AVI00316.1|39904_40735_+|IS5-family-transposase
MRRHELSDAEWDLIRPLLPRPALGRPRLDDRMVLNGIVWKFRTGVPWRDVPERYGPWTSLHTRFRRWAADGTFDRILRAAQAKADAAGDIDWTVSVDSTIVRAHQHAAGARKGGAKARPSAGPEAGLTSKIHLVCDAIGRPLAFVLTGGNTNDCTQFTAVMDAIRVPRTGPGRPRTRPDHVIGDKGYSSKAIRTWLRRRGIRHTIPERADQVRNRARKGSLGGRPPVFDKDVYKHRNVVERCFSRLKQWRGIATRYDKTAQSYKAAVTLALILMWA
>CP027025.1|AVI00296.1|41126_41426_+|hypothetical-protein
MAIWDTVEDGDRRICAACGTAVRSYQFRLYPPESSMFERCVGLAWCSGCRIYFSAMVHISRTRVLADALGSLPEDESVRLRRSEAKLVDYLDRQDRRKS
>CP027025.1|AVI00297.1|41647_42151_+|hypothetical-protein
MVSFKPSLVVPPLTRPQLAEARRVRAAELFDQERSGAEIARMLGVSQESVRRWRRVWEKDGADALRRRPATGRPPKLDDAQVERVRTALEQGAQAHGFEADLWTLERVGLVVGRVTGVTLSRASVWRLLTGRLGWSLQRPERRAVERDESEIARWIAHEWPRIKRGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027025_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027025_8

31692-31842

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
GGGTCCATCCCCGCGCACGCGGGGAGCAG	CRISPRCasFinder

2 spacers

cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP027025_8

>merge|CP027025|8|31692-31842|CRISPRCasFinder
GAGGCGATACCCGCGAGCGCGGAAAGCAGGTCTTGCCCTGCCAGTCCTTGCGGCCCTTGGTGGAGCCATCCCCGCGGGCGCGGGGAGCAGAGCGGTTCCGCGCCCATCTCGAAGTTGGACAGGGGTCCATCCCCGCGGGCGCGGGGAGCAG

>CP027025|8|7|31692-31842|CRISPRCasFinder
GAGGCGATACCCGCGAGCGCGGAAAGCAG	GTCTTGCCCTGCCAGTCCTTGCGGCCCTTGGT
GGAGCCATCCCCGCGGGCGCGGGGAGCAG	AGCGGTTCCGCGCCCATCTCGAAGTTGGACAG
GGGTCCATCCCCGCGGGCGCGGGGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237794
CP027025.1\|AVI00284.1\|16669_16852_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00285.1\|17703_17994_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
CP027025.1\|AVI00294.1\|34836_35451_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027025.1\|AVI00283.1\|16167_16575_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225949
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027025.1\|AVI00293.1\|34142_34655_-\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00315.1\|38361_38811_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP027025.1\|AVI00291.1\|32313_32934_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027025.1\|AVI00314.1\|36182_36773_+\|hypothetical-protein	unknown	unknown	unknown
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP027025.1\|AVI00296.1\|41126_41426_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027025.1\|AVI00292.1\|33062_33341_-\|hypothetical-protein	gnl\|CDD\|237794	PRK14705, PRK14705, glycogen branching enzyme; Provisional.	0.00873572
CP027025.1\|AVI00286.1\|23151_24753_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.04767e-43
CP027025.1\|AVI00295.1\|38932_39802_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.99322e-29
CP027025.1\|AVI00316.1\|39904_40735_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.51563e-30
CP027025.1\|AVI00290.1\|29692_30376_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.09411e-06
CP027025.1\|AVI00313.1\|26676_27495_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.16747e-28
CP027025.1\|AVI00287.1\|24749_25277_+\|hypothetical-protein	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.48658e-10
CP027025.1\|AVI00289.1\|27476_28217_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	7.28579e-40
CP027025.1\|AVI00312.1\|20146_22168_-\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.72836e-48
CP027025.1\|AVI00288.1\|25192_26662_+\|CRISPR-associated-protein	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.63411e-56
CP027025.1\|AVI00297.1\|41647_42151_+\|hypothetical-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.33604e-16

>CP027025.1|AVI00290.1|29692_30376_-|SMI1/KNR4-family-protein
MGNTPGRDVGCRYAWRDLLQRWSDEWLDPVLHEQERAEPFPDAVRRARWLGTTGVTSGELGALEKRLGVSLPPSYRQFLLTSNGWRSTTPDIHRVLPAHEVGWTRDLDPELVTGWTEGYQGAERVGDEEYFLYGKAQSPTTLRPEYLPHTLKISHTPNATDVYLLNPCVLTPDGEWEAWYLAHWLPGAVRYPSFWDLMNDEYEDFHGERRAQQVHPGTDRTGGRSTA
>CP027025.1|AVI00289.1|27476_28217_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MGHHPVTANRLITCHSILQLDLNHPHAATALTDAHQMHRIVMTGFKNWVPDGERDARAQLGVLSTWSADLKTNTLLIVVQSRVRPDWSSIPRTALRQPADVRNIDLPIATGDRYTFRTVINPVRAVRPTAAPGTTPTRGPSKRLPHVRPDHVRRWFEARLPPTDPTQHQNNTTGHIGADVDRGTLAIRMLPPVESDHHKGLKISRAEIRGTLTVTHPANFTQTLTNGLGKARAYSCGLILTRPASS
>CP027025.1|AVI00313.1|26676_27495_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MRLASPLQSWGALARFDRRDTQPRPTKSAVVGLIAAALGHDRTDDLGPLTSLRFATRADRPGTALRDFHIVGGGTYPLRPRDLITDHRRAAKAAAALDQATGPAFGHLPGQSVTHWYGAPKEIAPDPALGTLIAGNTTRDAMMTTRWYLADAAFVAAVQHPDEELLNRISHALEHPARLLWLGRKSCPPTGTISGGVHTGTLETILNTTALLPNATTERPWAWFETTNGTHGAVQTGDQPVTFHPEHRTHAPRWETRTRLTPEPTIEWDIIP
>CP027025.1|AVI00288.1|25192_26662_+|CRISPR-associated-protein
MAGTRPPHRRRLGQVLLHPHLPEQEPEVTSLSHTAATDLLSGDQFLSLHLLETFTAALPVRDENGMPKAFRYGGDLRTMITSQSRRRAERTYSRERANNGQGALAGYTMGIRTREWAKQTADALTRLHGWDKNRALETSKALLEGIGLKFGTKPNTQNLTQVLLFAPEDAGRSIAAYAHANEETTTAWVSEYLQAKAAQAAAEAAKKEKNAAARKAKKEGTSAPEEPVDASADDTDEKLPKLPKEIREAVLTALAPRDAIDIALYGRFLAEIADSPNVDGAIQTAHAFTVHAAEHIDDFYAAADDAKLHRKEHALDFLDVADDAGAGMTGYQSLITGTFYRHATLDRYKIRLNLLAAGMKPDEAQAAAEAAEREFVEAFTNAVPHAKKNTTASTGILPKLVLAFTGKRPFNYAGAFEKPIDETTDGPASLAAADRLLQQHALVLRKRTDISPARVLTYDLDVQRLLDQHTNAGTLPGTEADSAQELTGQ
>CP027025.1|AVI00287.1|24749_25277_+|hypothetical-protein
MTQPAEHPPGVQFAGWLAGLVRSRNVGDLAALRRLQPIPRLEAHYRAAAFAPMPEQEQYYQLTAFLFARYHAGATSPHYGYGDVGAALRRIGNGLTRGPKDPGAKRLLTRITASREVPARHLQHVIDRARSCGTAPPAWELLPDDLARWQERGRPIADAWGKSFYTPTYPNRNPK
>CP027025.1|AVI00286.1|23151_24753_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MLLRLSDLHEREVDTMRWEPRDQACIPALTSGSDQQELKLNLPDTFRRADEISAVYGDSPGETAAVIEWLLGLIYAADAYPETTDEWKQWVETRAPLNEVATWIEKHPGCWDLFDSEQPLGQNPTLHQHLDTYGVGPAQLFVERVGDYNQFFDHHHLHHPEPVPADAAWRAMLVQHAFAIGMRGRIKASAMGLPGTFTNLGTNRLASRLRVIARPAWDGATLGDLLRLNITPWPREPGPLNLTWNQELPQRRDFTQPGPRQARIPQGPADLHTVLGRSIALRPALLADGTAGVDRVLIGAGETLSPLPAEYLQDAVTHTGPGGTKRLLGPSANRDLWRESEALYAAVADRDKGTDLYGRIATLHGRRIHLWTIGLLSTQGKPITWVTDEFPYVPGREAPLRHAAETGSAICEYAARALYLAASTARDIAYPNPKPDDKKAQIARFNGEPEMWAGAADHFHVLLDQVTAGEDTTSALDDFGSAIRALSIQGLNDRLISLSGSATGLEARVMAQSRLEKLLDHSKAPVHLKEAAA
>CP027025.1|AVI00312.1|20146_22168_-|CRISPR-associated-helicase-Cas3'
MAALPATGPALIIIESDTGSGKTRLALACAHHLAVTCGYQGLYLAMPTRAATNQAARETARFMQHALNGQNSAMLAVVHSTAQATDFVHDLLDAGRAPGQATFDNLEDFITNLDTGPDTSPATSRAVLSPWYLRRCLGLIAQFAVGTVDQVVLSTLPSRHWMLRFLGLATKTVIIDEAHAYELYQQGLLAAVLRWLADAGSSVVILSATLPAAARTALTDAWCAGHRTTPSDSGQIGPITIVNEHGFITRTGSGIKTPKLRTHIDFLPDPGAQELADHVMQEATGAGITLVLRNRVDSAVELYTTALQRAAANGWRFDRIVLLHGRTLPRFRLPVEERLKNLLGPGEDPHHPNPDRPHRLLVIATQVVEQSLDIDFDRIYTDLAPIDLLIQRRGRQHRHTVNDPYRPFWTHKARMTILLREDPDGLPLVEPPNPKEGRPTGNPDGYIYAPYTLLASWHALKLRTRADGTVRIVTPTHTTDLIETVYGPRQTADGALGETLDRTWASWQSQLADEQAQCRSHALEPFTRRGKPTLISGLVSGDAHGDGDDGGVEGIKAVSRLGDPSIEAIALYRQTDGTLTYDQEGTLRADLARHTSDSPVHRQQQKDLLLNTLAIPAHWFTRQKTPLPTPETWPAHPAPALKYMNVALFDPANGSCISGPLGLTLHPSTGLSR
>CP027025.1|AVI00285.1|17703_17994_-|hypothetical-protein
MAPAFGRKFAQEAEQKRAQAESERRCVAELEAEMERERQERAAAEVAEEVDRLATEQARAAEVDEETVRLRAQMLAEHPWMAEYAVKSQQEAAALF
>CP027025.1|AVI00284.1|16669_16852_-|hypothetical-protein
MFRKQAGTAMWSLDVLDRLSAHDGTPVPDLLRGADHAVGRPLAARRAAHLGGAQTVITVG
>CP027025.1|AVI00283.1|16167_16575_+|hypothetical-protein
MGDPGGQAVQLLFCEPTRPYGDDPTLDFIVRARGRWVSVETSVRTWDGDGLDSFLSGLAEDFRGWEGARTWHSLEYDLTLSAEHRSGGHVHLTWGIHDRAPAEVWHFETTTVHAAGEDMKHLASEIRALLTCETQ
>CP027025.1|AVI00291.1|32313_32934_+|hypothetical-protein
MVYGVREGWRREGFESHEGGVGVLLADGSEPGPVFFDLGSGSTFHESTSWWHYDGTFRRPTAVTMRGRCACGWCGASRYPIGWEKVREDDDPDAYDASGPYTEWEAHLDDVAERAVTLPEDLAALPGQVRERLDRMWLEDDTARGYTTMLRACGELEAIVAQVGPEAAQVLGREHDEATDAIAEALGTTEKAARARLRHYEHLTWN
>CP027025.1|AVI00292.1|33062_33341_-|hypothetical-protein
MVLPFSYEEILARYRAGQSATAIGRAAGVDCRTILRRIPEDERRTHLQAQRLNRPAPDVDADTIRTLRARGLTWEEIGAEVGLSAKTVRARA
>CP027025.1|AVI00293.1|34142_34655_-|hypothetical-protein
MSGSPRYIQYRGAPPPCDRTHRTPPGLPFGQTTPLSTHARGRDRPAAVPPHGRSSRRGHGPPRPGHGCRTSRPRPRAHREGRPRRTWYALVGPAGTRAPRPLERRAGRIRRAGRPGGAPTKREQAQVPGPGAPERPYSRHPRTGHVGLNSLQRRTLSCPQRPLSSNPRRR
>CP027025.1|AVI00294.1|34836_35451_-|hypothetical-protein
MAFGGMTAQADETGCGRCFDEVEVELLRTPDVPLPTDLVGRVAQKEPFHWDDQPAIIRRVLPQLVVVLAEGAVESALMARGLAAAGWSRWPREQTGAVAGFLEAWWTQALRMKSPPTPVCEVFETCVTASSSVAPWLARWEAETGPVARHHLTESVGWWREELASDDSPFWWWWGTAAEERAAWHEVKTWLAAQTQATMVPDGL
>CP027025.1|AVI00314.1|36182_36773_+|hypothetical-protein
MEPKDQHARHLAHVVRKPLLERASLPEEWFAPLMAAAVYDPDPSFCRWFVEPAVYAFGRRRVMAALVDYLRTGTDAERAGAVRAWYSAHVPLRADRTPAYGPGGVRDPALDESRDIKAAWLETSLRVFAEATDLQMRHRVLLGLPTSRAAYPPHLHELLESTLASARVHPDPHIRRWAAAADQPDSYPSRQLRDSP
>CP027025.1|AVI00315.1|38361_38811_+|hypothetical-protein
MSRDAEVIVLARWSNEVMEPLTQNDPERTWRGRFVPIAGQWGYEFGWALEFEKLRGRQGLLRHLESLPWPHPHTVQVLLRDQDDDCFGLWMFQEGRLVEVTIPRTERFHQPAPPNENFEPYPGMLLRTDQNTALPEQTPEARRDTRSPW
>CP027025.1|AVI00295.1|38932_39802_-|IS5-family-transposase
MGRGDLSDEEWARLEPHLPVNRGRGGRWQSHRRVINGILFRQRTGLPWRDLPPCFGSWKTVHDRHRRWSADGTWERILRAVQADADAEGRIDWSMVSVDSTTCRAHQHAAGASTRAPKIPGRRRSLARHRPDEALGRSRGGLTSKIHLAGEGGCRPLGFVITPGQWGDAPQMIAVLKEIRVPRQTGGRPRTRPVHVGGDKAYSSRRNRRHLRRRQIKHTIPELRDQRANRRRRGSQGGRPTGFDKTIYRRRNEVERTINRLKNFRAVATRFDKRAYVFHRMVTVAAIRL
>CP027025.1|AVI00316.1|39904_40735_+|IS5-family-transposase
MRRHELSDAEWDLIRPLLPRPALGRPRLDDRMVLNGIVWKFRTGVPWRDVPERYGPWTSLHTRFRRWAADGTFDRILRAAQAKADAAGDIDWTVSVDSTIVRAHQHAAGARKGGAKARPSAGPEAGLTSKIHLVCDAIGRPLAFVLTGGNTNDCTQFTAVMDAIRVPRTGPGRPRTRPDHVIGDKGYSSKAIRTWLRRRGIRHTIPERADQVRNRARKGSLGGRPPVFDKDVYKHRNVVERCFSRLKQWRGIATRYDKTAQSYKAAVTLALILMWA
>CP027025.1|AVI00296.1|41126_41426_+|hypothetical-protein
MAIWDTVEDGDRRICAACGTAVRSYQFRLYPPESSMFERCVGLAWCSGCRIYFSAMVHISRTRVLADALGSLPEDESVRLRRSEAKLVDYLDRQDRRKS
>CP027025.1|AVI00297.1|41647_42151_+|hypothetical-protein
MVSFKPSLVVPPLTRPQLAEARRVRAAELFDQERSGAEIARMLGVSQESVRRWRRVWEKDGADALRRRPATGRPPKLDDAQVERVRTALEQGAQAHGFEADLWTLERVGLVVGRVTGVTLSRASVWRLLTGRLGWSLQRPERRAVERDESEIARWIAHEWPRIKRGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP027025_3	3.9\|19109\|20\|CP027025\|CRISPRCasFinder,CRT	19109-19128	20	CP027022.1	1438151-1438170	2	0.9
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	CP027025.1	18531-18562	2	0.938

1. spacer 3.9|19109|20|CP027025|CRISPRCasFinder,CRT matches to position: 1438151-1438170, mismatch: 2, identity: 0.9

gcgacgagggcggccgcgct	CRISPR spacer
gcgacgagcgcgcccgcgct	Protospacer
******** *** *******

2. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to position: 18531-18562, mismatch: 2, identity: 0.938

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
ccacaccgccgcctggtcgccggggaagtcgc	Protospacer
****.****************.**********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	8886-8917	0	1.0
CP027025_1	1.2\|8947\|32\|CP027025\|CRT	8947-8978	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	8947-8978	0	1.0
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9008-9039	0	1.0
CP027025_1	1.4\|9069\|32\|CP027025\|CRT	9069-9100	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9069-9100	0	1.0
CP027025_1	1.5\|9130\|32\|CP027025\|CRT	9130-9161	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9130-9161	0	1.0
CP027025_1	1.6\|9191\|33\|CP027025\|CRT	9191-9223	33	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9191-9223	0	1.0
CP027025_1	1.7\|9253\|32\|CP027025\|CRT	9253-9284	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9253-9284	0	1.0
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9314-9345	0	1.0
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9375-9406	0	1.0
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9436-9467	0	1.0
CP027025_1	1.11\|8947\|31\|CP027025\|CRISPRCasFinder	8947-8977	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	8947-8977	0	1.0
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9008-9038	0	1.0
CP027025_1	1.13\|9069\|31\|CP027025\|CRISPRCasFinder	9069-9099	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9069-9099	0	1.0
CP027025_1	1.14\|9130\|31\|CP027025\|CRISPRCasFinder	9130-9160	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9130-9160	0	1.0
CP027025_1	1.15\|9191\|32\|CP027025\|CRISPRCasFinder	9191-9222	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9191-9222	0	1.0
CP027025_1	1.16\|9253\|31\|CP027025\|CRISPRCasFinder	9253-9283	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9253-9283	0	1.0
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9314-9344	0	1.0
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9375-9405	0	1.0
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9436-9466	0	1.0
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9375-9402	0	1.0
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9436-9463	0	1.0
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18044-18075	0	1.0
CP027025_2	2.2\|18105\|32\|CP027025\|CRISPRCasFinder,CRT	18105-18136	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18105-18136	0	1.0
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18166-18197	0	1.0
CP027025_2	2.4\|18227\|32\|CP027025\|CRISPRCasFinder,CRT	18227-18258	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18227-18258	0	1.0
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18288-18319	0	1.0
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18349-18380	0	1.0
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18349-18376	0	1.0
CP027025_3	3.1\|18592\|32\|CP027025\|CRISPRCasFinder,CRT	18592-18623	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18592-18623	0	1.0
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18743-18774	0	1.0
CP027025_3	3.4\|18804\|32\|CP027025\|CRISPRCasFinder,CRT	18804-18835	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18804-18835	0	1.0
CP027025_3	3.5\|18865\|32\|CP027025\|CRISPRCasFinder,CRT	18865-18896	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18865-18896	0	1.0
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18926-18957	0	1.0
CP027025_3	3.7\|18987\|32\|CP027025\|CRISPRCasFinder,CRT	18987-19018	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18987-19018	0	1.0
CP027025_3	3.8\|19048\|32\|CP027025\|CRISPRCasFinder,CRT	19048-19079	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19048-19079	0	1.0
CP027025_3	3.9\|19109\|20\|CP027025\|CRISPRCasFinder,CRT	19109-19128	20	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19109-19128	0	1.0
CP027025_3	3.10\|19158\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19158-19189	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19158-19189	0	1.0
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19219-19250	0	1.0
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19280-19311	0	1.0
CP027025_3	3.13\|19341\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19341-19372	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19341-19372	0	1.0
CP027025_3	3.14\|19402\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19402-19433	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19402-19433	0	1.0
CP027025_3	3.15\|19463\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19463-19494	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19463-19494	0	1.0
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19524-19555	0	1.0
CP027025_3	3.17\|19585\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19585-19616	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19585-19616	0	1.0
CP027025_3	3.18\|19646\|33\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19646-19678	33	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19646-19678	0	1.0
CP027025_3	3.19\|19708\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19708-19739	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19708-19739	0	1.0
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19769-19800	0	1.0
CP027025_3	3.21\|19830\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19830-19861	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	19830-19861	0	1.0
CP027025_4	4.1\|28330\|30\|CP027025\|CRT	28330-28359	30	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28330-28359	0	1.0
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28389-28419	0	1.0
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28449-28480	0	1.0
CP027025_5	5.1\|28634\|32\|CP027025\|CRISPRCasFinder	28634-28665	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28634-28665	0	1.0
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28695-28726	0	1.0
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28756-28787	0	1.0
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28817-28848	0	1.0
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28878-28909	0	1.0
CP027025_5	5.6\|28939\|32\|CP027025\|CRISPRCasFinder	28939-28970	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	28939-28970	0	1.0
CP027025_5	5.7\|29000\|32\|CP027025\|CRISPRCasFinder	29000-29031	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29000-29031	0	1.0
CP027025_5	5.8\|29061\|32\|CP027025\|CRISPRCasFinder	29061-29092	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29061-29092	0	1.0
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29122-29153	0	1.0
CP027025_5	5.11\|29273\|32\|CP027025\|CRISPRCasFinder	29273-29304	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29273-29304	0	1.0
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29334-29365	0	1.0
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29395-29426	0	1.0
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29456-29487	0	1.0
CP027025_5	5.15\|29517\|33\|CP027025\|CRISPRCasFinder	29517-29549	33	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29517-29549	0	1.0
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30573-30603	0	1.0
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30634-30664	0	1.0
CP027025_6	6.3\|30572\|32\|CP027025\|CRISPRCasFinder,CRT	30572-30603	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30572-30603	0	1.0
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30633-30664	0	1.0
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30694-30725	0	1.0
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30879-30910	0	1.0
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	30940-30971	0	1.0
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31001-31032	0	1.0
CP027025_7	7.4\|31062\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31062-31093	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31062-31093	0	1.0
CP027025_7	7.5\|31123\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31123-31154	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31123-31154	0	1.0
CP027025_7	7.6\|31184\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31184-31215	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31184-31215	0	1.0
CP027025_7	7.7\|31245\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31245-31276	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31245-31276	0	1.0
CP027025_7	7.8\|31306\|32\|CP027025\|CRISPRCasFinder,CRT	31306-31337	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31306-31337	0	1.0
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31721-31752	0	1.0
CP027025_8	8.2\|31782\|32\|CP027025\|CRISPRCasFinder	31782-31813	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	31782-31813	0	1.0
CP027025_1	1.5\|9130\|32\|CP027025\|CRT	9130-9161	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29273-29304	1	0.969
CP027025_1	1.14\|9130\|31\|CP027025\|CRISPRCasFinder	9130-9160	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29273-29303	1	0.968
CP027025_3	3.2\|18653\|61\|CP027025\|CRISPRCasFinder,CRT	18653-18713	61	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18653-18713	1	0.984
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29395-29426	1	0.969
CP027025_3	3.9\|19109\|20\|CP027025\|CRISPRCasFinder,CRT	19109-19128	20	NC_012807	Methylorubrum extorquens AM1 plasmid p1META1, complete sequence	1816-1835	1	0.95
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	12636-12667	1	0.969
CP027025_5	5.10\|29183\|61\|CP027025\|CRISPRCasFinder	29183-29243	61	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29183-29243	1	0.984
CP027025_5	5.11\|29273\|32\|CP027025\|CRISPRCasFinder	29273-29304	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9130-9161	1	0.969
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18926-18957	1	0.969
CP027025_1	1.5\|9130\|32\|CP027025\|CRT	9130-9161	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18804-18835	2	0.938
CP027025_1	1.14\|9130\|31\|CP027025\|CRISPRCasFinder	9130-9160	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18804-18834	2	0.935
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	MT711975	Streptomyces phage Alderaan, complete genome	29255-29286	2	0.938
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	KY092481	Streptomyces phage PapayaSalad, complete genome	25648-25679	2	0.938
CP027025_3	3.4\|18804\|32\|CP027025\|CRISPRCasFinder,CRT	18804-18835	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	9130-9161	2	0.938
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	79082-79113	2	0.938
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	NC_020894	Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence	57198-57229	2	0.938
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	NC_017766	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence	57199-57230	2	0.938
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18531-18562	2	0.938
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	706336-706363	3	0.893
CP027025_3	3.4\|18804\|32\|CP027025\|CRISPRCasFinder,CRT	18804-18835	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	29273-29304	3	0.906
CP027025_5	5.11\|29273\|32\|CP027025\|CRISPRCasFinder	29273-29304	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	18804-18835	3	0.906
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	66816-66847	4	0.875
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	78156-78187	4	0.875
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	65421-65452	4	0.875
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	67006-67037	4	0.875
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	66816-66846	4	0.871
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	78156-78186	4	0.871
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	65421-65451	4	0.871
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	67006-67036	4	0.871
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_014159	Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence	92890-92920	4	0.871
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3223442-3223469	4	0.857
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	29891-29918	4	0.857
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_014159	Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence	92893-92920	4	0.857
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	298818-298845	4	0.857
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	2186263-2186290	4	0.857
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	2252567-2252594	4	0.857
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1646470-1646497	4	0.857
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1646468-1646495	4	0.857
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1552047-1552074	4	0.857
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1495244-1495271	4	0.857
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	KP966108	Burkholderia phage vB_BceM_AP3, complete genome	9762-9789	4	0.857
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	655322-655349	4	0.857
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	655331-655358	4	0.857
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	674910-674937	4	0.857
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	285040-285067	4	0.857
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP030354	Novosphingobium sp. P6W plasmid pP6W1, complete sequence	105122-105153	5	0.844
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_AP014659	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence	26089-26120	5	0.844
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	396402-396433	5	0.844
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP030354	Novosphingobium sp. P6W plasmid pP6W1, complete sequence	105123-105153	5	0.839
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_AP014659	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence	26089-26119	5	0.839
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	396402-396432	5	0.839
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	655364-655391	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	174261-174288	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	203372-203399	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	262638-262665	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	187144-187171	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	189669-189696	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	605390-605417	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	663806-663833	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	401817-401844	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	930437-930464	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2113006-2113033	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1610780-1610807	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1587242-1587269	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1935478-1935505	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	458279-458306	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	259835-259862	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	146791-146818	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	478114-478141	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	276016-276043	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP050991	Chromobacterium violaceum strain FDAARGOS_635 plasmid unnamed, complete sequence	36410-36437	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_MG651603	Chromobacterium violaceum strain ATCC 12472 plasmid pChV1, complete sequence	23434-23461	5	0.821
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	MT657335	Gordonia phage Mariokart, complete genome	46421-46448	5	0.821
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	592230-592257	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	639630-639657	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	655341-655368	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	525691-525718	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	297572-297599	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	639480-639507	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	639458-639485	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	519595-519622	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1877301-1877328	5	0.821
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP054606	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence	91264-91291	5	0.821
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	NZ_CP026654	Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence	57111-57142	5	0.844
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP029234	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436d, complete sequence	123747-123778	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	179512-179543	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	869174-869205	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	179512-179543	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	177953-177984	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	182200-182231	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	176318-176349	6	0.812
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	179512-179543	6	0.812
CP027025_1	1.4\|9069\|32\|CP027025\|CRT	9069-9100	32	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	154817-154848	6	0.812
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	401817-401848	6	0.812
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1587238-1587269	6	0.812
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1610776-1610807	6	0.812
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	298814-298845	6	0.812
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	458279-458310	6	0.812
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP029234	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436d, complete sequence	123748-123778	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	179512-179542	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	869174-869204	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	179512-179542	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	177953-177983	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	182200-182230	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	176318-176348	6	0.806
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	179512-179542	6	0.806
CP027025_1	1.13\|9069\|31\|CP027025\|CRISPRCasFinder	9069-9099	31	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	154818-154848	6	0.806
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	244366-244396	6	0.806
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1610777-1610807	6	0.806
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1587239-1587269	6	0.806
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	458279-458309	6	0.806
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1646470-1646500	6	0.806
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1646468-1646498	6	0.806
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1552047-1552077	6	0.806
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1495244-1495274	6	0.806
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	KP966108	Burkholderia phage vB_BceM_AP3, complete genome	9759-9789	6	0.806
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4432147-4432174	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1471277-1471304	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	174400-174427	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	MN813693	Mycobacterium phage Imvubu, complete genome	22705-22732	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	132000-132027	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_008537	Arthrobacter sp. FB24 plasmid 1, complete sequence	109301-109328	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	520476-520503	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	MT446395	UNVERIFIED: Escherichia virus TH21, complete genome	15182-15209	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	750324-750351	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	72970-72997	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	79852-79879	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	120954-120981	6	0.786
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	MK376956	Gordonia phage WilliamBoone, complete genome	14295-14322	6	0.786
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1265819-1265846	6	0.786
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	601643-601670	6	0.786
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	16798-16825	6	0.786
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	209283-209310	6	0.786
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	295434-295461	6	0.786
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	721820-721847	6	0.786
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP044333	Methylocystis parvus strain BRCS2 plasmid unnamed2, complete sequence	39097-39128	6	0.812
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP034813	Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence	185973-186004	6	0.812
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	151251-151282	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	75283-75314	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	332591-332622	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	335349-335380	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	332531-332562	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	351987-352018	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	568995-569026	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	338777-338808	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	346952-346983	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	351987-352018	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	332531-332562	6	0.812
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	332097-332128	6	0.812
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP026529	Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence	47880-47911	6	0.812
CP027025_7	7.5\|31123\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31123-31154	32	NZ_CP045549	Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence	119347-119378	6	0.812
CP027025_7	7.6\|31184\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31184-31215	32	NZ_CP014599	Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence	261955-261986	6	0.812
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	635496-635527	7	0.781
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	244366-244397	7	0.781
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	253993-254024	7	0.781
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2113002-2113033	7	0.781
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	478110-478141	7	0.781
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1646470-1646501	7	0.781
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1646468-1646499	7	0.781
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1552047-1552078	7	0.781
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1495244-1495275	7	0.781
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	KP966108	Burkholderia phage vB_BceM_AP3, complete genome	9758-9789	7	0.781
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	461070-461100	7	0.774
CP027025_1	1.14\|9130\|31\|CP027025\|CRISPRCasFinder	9130-9160	31	NZ_CP045377	Sulfitobacter sp. THAF37 plasmid pTHAF37_e, complete sequence	18026-18056	7	0.774
CP027025_1	1.15\|9191\|32\|CP027025\|CRISPRCasFinder	9191-9222	32	KY006853	Erythrobacter phage vB_EliS_R6L, complete genome	651-682	7	0.781
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	57794-57824	7	0.774
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	KC292024	Halovirus HHTV-2, complete genome	17967-17997	7	0.774
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	253993-254023	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3223442-3223472	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	914529-914559	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	655361-655391	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	174258-174288	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	203369-203399	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	262635-262665	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	187141-187171	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	189666-189696	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	605387-605417	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	516289-516319	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	663803-663833	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	173545-173575	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	2186263-2186293	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	2252567-2252597	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	29888-29918	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2113003-2113033	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	298815-298845	7	0.774
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	79852-79882	7	0.774
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	592227-592257	7	0.774
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	795901-795928	7	0.75
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4812318-4812345	7	0.75
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1315500-1315527	7	0.75
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	79271-79298	7	0.75
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	780418-780445	7	0.75
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	128216-128243	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	19711-19738	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	20704-20731	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	19717-19744	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	19730-19757	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	19658-19685	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	19555-19582	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	16776-16803	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	19635-19662	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	146999-147026	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	16776-16803	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	16776-16803	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	584733-584760	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	16776-16803	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	16776-16803	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1632364-1632391	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	502545-502572	7	0.75
CP027025_1	1.21\|9438\|28\|CP027025\|PILER-CR	9438-9465	28	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	19656-19683	7	0.75
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	154986-155017	7	0.781
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	181748-181779	7	0.781
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_LR134469	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 27, complete sequence	11903-11934	7	0.781
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	655322-655353	7	0.781
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	655331-655362	7	0.781
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	674910-674941	7	0.781
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	285036-285067	7	0.781
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	721820-721851	7	0.781
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1077920-1077947	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	297024-297051	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	338031-338058	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	572041-572068	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1390900-1390927	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1560349-1560376	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1313799-1313826	7	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	277825-277852	7	0.75
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	177911-177942	7	0.781
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	662834-662865	7	0.781
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	CP000622	Burkholderia phage phiE255, complete genome	30378-30409	7	0.781
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NC_009237	Burkholderia phage phiE255 chromosome, complete genome	30378-30409	7	0.781
CP027025_3	3.10\|19158\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19158-19189	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	130702-130733	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_018452	Burkholderia phage DC1, complete genome	44469-44500	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	AB981169	Ralstonia phage RSY1 DNA, complete genome	21981-22012	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	384206-384237	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	390212-390243	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	48223-48254	7	0.781
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	165822-165853	7	0.781
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	17838-17869	7	0.781
CP027025_3	3.13\|19341\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19341-19372	32	MK059749	Mycobacterium phage CRB2, complete genome	20613-20644	7	0.781
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP035512	Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence	32201-32232	7	0.781
CP027025_3	3.17\|19585\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19585-19616	32	NC_029046	Sinorhizobium phage phiLM21, complete genome	23137-23168	7	0.781
CP027025_3	3.18\|19646\|33\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19646-19678	33	NZ_CP013256	Kocuria flava strain HO-9041 plasmid 2, complete sequence	7939-7971	7	0.788
CP027025_3	3.18\|19646\|33\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19646-19678	33	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	129593-129625	7	0.788
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	195999-196030	7	0.781
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP015216	Rhodobacter sphaeroides strain MBTLJ-13 plasmid e, complete sequence	1212-1243	7	0.781
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP034650	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH29, complete sequence	9719-9750	7	0.781
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP034652	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH14, complete sequence	13865-13896	7	0.781
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NZ_CP020540	Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence	217096-217126	7	0.774
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NC_008741	Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence	104045-104075	7	0.774
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP032697	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525a, complete sequence	269348-269379	7	0.781
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	321383-321414	7	0.781
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1578743-1578774	7	0.781
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP016292	Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence	58815-58846	7	0.781
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	86046-86077	7	0.781
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	141775-141806	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MK112543	Mycobacterium Phage Kalb97, complete genome	23711-23742	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MK967399	Mycobacterium phage Groupthink, complete genome	23712-23743	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MK310140	Mycobacterium phage Gemma, complete genome	23708-23739	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	KY965063	Mycobacterium phage PurpleHaze, complete genome	23711-23742	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MT657331	Mycobacterium phage Manu, complete genome	23712-23743	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MK494128	Mycobacterium phage Heliosoles, complete genome	23712-23743	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MH450124	Mycobacterium phage Marius, complete genome	23712-23743	7	0.781
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MH450126	Mycobacterium phage PhishRPhriends, complete genome	22896-22927	7	0.781
CP027025_5	5.6\|28939\|32\|CP027025\|CRISPRCasFinder	28939-28970	32	NZ_CP049837	Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence	2658-2689	7	0.781
CP027025_5	5.6\|28939\|32\|CP027025\|CRISPRCasFinder	28939-28970	32	NZ_CP043961	Streptomyces tendae strain 139 plasmid unnamed2, complete sequence	18741-18772	7	0.781
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	301137-301168	7	0.781
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	177911-177942	7	0.781
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	451821-451852	7	0.781
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1161532-1161563	7	0.781
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	86491-86522	7	0.781
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP022420	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-5, complete sequence	33517-33548	7	0.781
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP031599	Roseovarius indicus strain DSM 26383 plasmid pRIdsm_01, complete sequence	441451-441482	7	0.781
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP031600	Roseovarius indicus strain DSM 26383 plasmid pRIdsm_02, complete sequence	116443-116474	7	0.781
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP031601	Roseovarius indicus strain DSM 26383 plasmid pRIdsm_03, complete sequence	136424-136455	7	0.781
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP023712	Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence	31790-31821	7	0.781
CP027025_7	7.6\|31184\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31184-31215	32	NZ_CP006993	Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence	108546-108577	7	0.781
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	245177-245208	8	0.75
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	MT723933	Streptomyces phage Keanu, complete genome	42252-42283	8	0.75
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	MK411746	Arthrobacter phage Sonali, complete genome	45307-45338	8	0.75
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	461070-461101	8	0.75
CP027025_1	1.5\|9130\|32\|CP027025\|CRT	9130-9161	32	NZ_CP045377	Sulfitobacter sp. THAF37 plasmid pTHAF37_e, complete sequence	18025-18056	8	0.75
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	MN871455	UNVERIFIED: Pseudomonas phage Pa-B, complete genome	4170-4201	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3223442-3223473	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	914529-914560	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	655360-655391	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	174257-174288	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	203368-203399	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	262634-262665	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	187140-187171	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	189665-189696	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	605386-605417	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	2252567-2252598	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	516289-516320	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	663802-663833	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	173545-173576	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	29887-29918	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	2186263-2186294	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	KY006853	Erythrobacter phage vB_EliS_R6L, complete genome	46274-46305	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	79852-79883	8	0.75
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_008537	Arthrobacter sp. FB24 plasmid 1, complete sequence	109297-109328	8	0.75
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1265815-1265846	8	0.75
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	601639-601670	8	0.75
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	592226-592257	8	0.75
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	16794-16825	8	0.75
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	135534-135564	8	0.742
CP027025_1	1.14\|9130\|31\|CP027025\|CRISPRCasFinder	9130-9160	31	NC_049478	Arthrobacter phage Mufasa8, complete genome	39671-39701	8	0.742
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	MN871455	UNVERIFIED: Pseudomonas phage Pa-B, complete genome	4170-4200	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	401817-401847	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	930437-930467	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1935478-1935508	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	44488-44518	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	174397-174427	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	259832-259862	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	120954-120984	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	146788-146818	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	478111-478141	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP024312	Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence	113447-113477	8	0.742
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	142764-142794	8	0.742
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1265816-1265846	8	0.742
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	601640-601670	8	0.742
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	16795-16825	8	0.742
CP027025_1	1.20\|9377\|28\|CP027025\|PILER-CR	9377-9404	28	NC_047905	Streptomyces phage Attoomi, complete genome	26395-26422	8	0.714
CP027025_2	2.2\|18105\|32\|CP027025\|CRISPRCasFinder,CRT	18105-18136	32	NC_024994	Gluconacetobacter europaeus plasmid pGE2 genomic DNA, complete sequence, strain: KGMA0119	4246-4277	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	285500-285531	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP034911	Ensifer alkalisoli strain YIC4027 plasmid unnamed, complete sequence	292585-292616	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	530161-530192	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	392197-392228	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	4601-4632	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	403968-403999	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	269081-269112	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	446379-446410	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	385152-385183	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	28591-28622	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	282983-283014	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	255916-255947	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	358319-358350	8	0.75
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	414758-414789	8	0.75
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	62456-62487	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	MN369748	Mycobacterium phage Miko, complete genome	43661-43692	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	639630-639661	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1877297-1877328	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	655341-655372	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	525691-525722	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	297572-297603	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	639480-639511	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	639458-639489	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	519595-519626	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP022081	Burkholderia cepacia strain FDAARGOS_345 plasmid unnamed1, complete sequence	105853-105884	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP022081	Burkholderia cepacia strain FDAARGOS_345 plasmid unnamed1, complete sequence	196988-197019	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP054606	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence	91260-91291	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP023519	Burkholderia cepacia strain FDAARGOS_388 plasmid unnamed1, complete sequence	15161-15192	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP023519	Burkholderia cepacia strain FDAARGOS_388 plasmid unnamed1, complete sequence	128192-128223	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	297024-297055	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP007745	Burkholderia cepacia ATCC 25416 plasmid unnamed, complete sequence	40118-40149	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP007745	Burkholderia cepacia ATCC 25416 plasmid unnamed, complete sequence	152106-152137	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012984	Burkholderia cepacia ATCC 25416 strain UCB 717 plasmid pBC25416	52689-52720	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012984	Burkholderia cepacia ATCC 25416 strain UCB 717 plasmid pBC25416	143824-143855	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	421668-421699	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	424133-424164	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP034556	Burkholderia cepacia ATCC 25416 plasmid unnamed1, complete sequence	42834-42865	8	0.75
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP034556	Burkholderia cepacia ATCC 25416 plasmid unnamed1, complete sequence	155869-155900	8	0.75
CP027025_2	2.7\|18353\|28\|CP027025\|PILER-CR	18353-18380	28	NC_048047	Caulobacter phage CcrBL9, complete genome	125704-125731	8	0.714
CP027025_3	3.1\|18592\|32\|CP027025\|CRISPRCasFinder,CRT	18592-18623	32	MG707188	Pseudomonas phage TC7, partial genome	19993-20024	8	0.75
CP027025_3	3.1\|18592\|32\|CP027025\|CRISPRCasFinder,CRT	18592-18623	32	NC_031091	Pseudomonas phage MD8, complete genome	32480-32511	8	0.75
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	446851-446882	8	0.75
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	844355-844386	8	0.75
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	686013-686044	8	0.75
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_LR134453	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 11, complete sequence	16564-16595	8	0.75
CP027025_3	3.10\|19158\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19158-19189	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	274790-274821	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1083139-1083170	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	988929-988960	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1052912-1052943	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	988026-988057	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	988921-988952	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	988277-988308	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	988912-988943	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1083238-1083269	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1083233-1083264	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1083217-1083248	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	393078-393109	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	931784-931815	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	JX100810	Caulobacter phage CcrColossus, complete genome	44676-44707	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	440569-440600	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1359560-1359591	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1364228-1364259	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	429863-429894	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	442447-442478	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	422118-422149	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	448549-448580	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	418201-418232	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	423913-423944	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	431219-431250	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	442160-442191	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	418201-418232	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	448549-448580	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	420798-420829	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	422126-422157	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP031954	Phaeobacter inhibens strain 2.10 plasmid unnamed2, complete sequence	36801-36832	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_018423	Phaeobacter inhibens 2.10 plasmid pPGA2_95, complete sequence	36687-36718	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	422128-422159	8	0.75
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	427288-427319	8	0.75
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	174657-174688	8	0.75
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	217575-217606	8	0.75
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	KC252997	Halovirus PH1, complete genome	16374-16405	8	0.75
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	178970-179001	8	0.75
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	368568-368599	8	0.75
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	133908-133939	8	0.75
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1679209-1679240	8	0.75
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	610918-610949	8	0.75
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	558880-558910	8	0.742
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP030197	Salmonella enterica strain SA20051401 plasmid pSA20051401.1, complete sequence	111526-111557	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP024864	Escherichia coli strain AR_0015 plasmid unitig_2_pilon, complete sequence	72294-72325	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP030177	Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.2, complete sequence	101359-101390	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NC_011413	Escherichia coli SE11 plasmid pSE11-2, complete sequence	46788-46819	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP030785	Escherichia albertii strain 2012EL-1823B plasmid unnamed2, complete sequence	34209-34240	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	CP054565	Escherichia coli strain SCU-478 isolate rectal swab from healthy college student plasmid pSCU-478-1, complete sequence	77508-77539	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP032813	Escherichia coli strain ERL03-1416 plasmid pERL03-1416-2, complete sequence	32293-32324	8	0.75
CP027025_4	4.3\|28449\|32\|CP027025\|CRT	28449-28480	32	NZ_CP010201	Escherichia coli strain M10 plasmid A, complete sequence	17666-17697	8	0.75
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	MN234228	Mycobacterium phage Tourach, complete genome	77843-77874	8	0.75
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	621297-621328	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP024425	Paracoccus yeei strain TT13 plasmid pTT13-3, complete sequence	127415-127446	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP022992	Paraburkholderia aromaticivorans strain BN5 plasmid pBN2, complete sequence	164295-164326	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	356089-356120	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP046255	Sphingobium sp. CAP-1 plasmid p2, complete sequence	3274-3305	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP046255	Sphingobium sp. CAP-1 plasmid p2, complete sequence	13692-13723	8	0.75
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NZ_CP009431	Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence	124151-124182	8	0.75
CP027025_5	5.4\|28817\|32\|CP027025\|CRISPRCasFinder	28817-28848	32	MK450421	Streptomyces phage Vash, complete genome	37865-37896	8	0.75
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	119230-119261	8	0.75
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2639374-2639405	8	0.75
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	191578-191609	8	0.75
CP027025_5	5.8\|29061\|32\|CP027025\|CRISPRCasFinder	29061-29092	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	389349-389380	8	0.75
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1089641-1089672	8	0.75
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	1373083-1373114	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	446851-446882	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP021409	Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence	3267-3298	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	175512-175543	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP015043	Rhodovulum sp. P5 plasmid pRGUI04, complete sequence	57531-57562	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	CP000622	Burkholderia phage phiE255, complete genome	30378-30409	8	0.75
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NC_009237	Burkholderia phage phiE255 chromosome, complete genome	30378-30409	8	0.75
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	MN693615	Marine virus AFVG_250M1187, complete genome	27727-27758	8	0.75
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	MN694069	Marine virus AFVG_250M891, complete genome	12586-12617	8	0.75
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	MN694089	Marine virus AFVG_250M217, complete genome	29037-29068	8	0.75
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	MN694653	Marine virus AFVG_250M216, complete genome	29507-29538	8	0.75
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NZ_CP033726	Clavibacter michiganensis subsp. michiganensis strain UF1 plasmid pCM2U-F1, complete sequence	70824-70854	8	0.742
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1779396-1779426	8	0.742
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NZ_CP029836	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed6, complete sequence	79412-79442	8	0.742
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	33866-33896	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	937725-937755	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	715959-715989	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	168907-168937	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	142589-142619	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	179289-179319	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	97452-97482	8	0.742
CP027025_6	6.2\|30634\|31\|CP027025\|PILER-CR	30634-30664	31	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	3448-3478	8	0.742
CP027025_6	6.3\|30572\|32\|CP027025\|CRISPRCasFinder,CRT	30572-30603	32	NZ_CP033726	Clavibacter michiganensis subsp. michiganensis strain UF1 plasmid pCM2U-F1, complete sequence	70823-70854	8	0.75
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_CP021374	Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence	207582-207613	8	0.75
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	595623-595654	8	0.75
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	595661-595692	8	0.75
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	MH047631	Microbacterium phage Triscuit, complete genome	27273-27304	8	0.75
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	LN997844	Streptomyces reticuli genome assembly TUE45, plasmid : III	16729-16760	8	0.75
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP048398	Streptomyces sp. S4.7 plasmid pSSPS4.7a, complete sequence	1230-1261	8	0.75
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	724231-724262	8	0.75
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	344206-344237	8	0.75
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	343316-343347	8	0.75
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	110594-110625	8	0.75
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	151110-151141	8	0.75
CP027025_7	7.5\|31123\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31123-31154	32	NZ_CP045412	Roseovarius sp. THAF8 plasmid pTHAF8_b, complete sequence	2910-2941	8	0.75
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	KY210139	Xanthomonas phage KPhi1, complete genome	719-750	8	0.75
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	MN908685	Microbacterium phage PauloDiaboli, complete genome	132984-133015	8	0.75
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	2109916-2109947	8	0.75
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	942867-942898	9	0.719
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	916496-916527	9	0.719
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	518256-518287	9	0.719
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	175512-175543	9	0.719
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	135533-135564	9	0.719
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	178314-178345	9	0.719
CP027025_1	1.5\|9130\|32\|CP027025\|CRT	9130-9161	32	NC_049478	Arthrobacter phage Mufasa8, complete genome	39670-39701	9	0.719
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	57793-57824	9	0.719
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	31565-31596	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	930437-930468	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	44487-44518	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	174396-174427	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1935478-1935509	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	MN813693	Mycobacterium phage Imvubu, complete genome	22701-22732	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	259831-259862	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	120954-120985	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	146787-146818	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP024312	Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence	113446-113477	9	0.719
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	142763-142794	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	19707-19738	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	20700-20731	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	19713-19744	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	19726-19757	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	19654-19685	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	19551-19582	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	16772-16803	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	19631-19662	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	16772-16803	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	16772-16803	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	584729-584760	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	16772-16803	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	16772-16803	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1632364-1632395	9	0.719
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	19652-19683	9	0.719
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	207943-207973	9	0.71
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	178315-178345	9	0.71
CP027025_1	1.13\|9069\|31\|CP027025\|CRISPRCasFinder	9069-9099	31	NZ_AP015030	Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence	101591-101621	9	0.71
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	729528-729558	9	0.71
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	608873-608903	9	0.71
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	31566-31596	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	795901-795931	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	479022-479052	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	644664-644694	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	MN813693	Mycobacterium phage Imvubu, complete genome	22702-22732	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	72970-73000	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	128216-128246	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NC_008537	Arthrobacter sp. FB24 plasmid 1, complete sequence	109298-109328	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	79268-79298	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	780415-780445	9	0.71
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	520473-520503	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	19708-19738	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	20701-20731	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	19714-19744	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	19727-19757	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	19655-19685	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	19552-19582	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	16773-16803	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	19632-19662	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	16773-16803	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	16773-16803	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	584730-584760	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	16773-16803	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	16773-16803	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1632364-1632394	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	502545-502575	9	0.71
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	19653-19683	9	0.71
CP027025_2	2.1\|18044\|32\|CP027025\|CRISPRCasFinder,CRT	18044-18075	32	NZ_CP015221	Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence	116860-116891	9	0.719
CP027025_2	2.2\|18105\|32\|CP027025\|CRISPRCasFinder,CRT	18105-18136	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	283653-283684	9	0.719
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	385357-385388	9	0.719
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	MN369741	Mycobacterium phage LoneWolf, complete genome	37365-37396	9	0.719
CP027025_2	2.4\|18227\|32\|CP027025\|CRISPRCasFinder,CRT	18227-18258	32	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	66167-66198	9	0.719
CP027025_2	2.4\|18227\|32\|CP027025\|CRISPRCasFinder,CRT	18227-18258	32	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	80017-80048	9	0.719
CP027025_2	2.4\|18227\|32\|CP027025\|CRISPRCasFinder,CRT	18227-18258	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	341331-341362	9	0.719
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	658650-658681	9	0.719
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	42052-42083	9	0.719
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	295434-295465	9	0.719
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1304903-1304934	9	0.719
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	508631-508662	9	0.719
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	888582-888613	9	0.719
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	218501-218532	9	0.719
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	242560-242591	9	0.719
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	79791-79822	9	0.719
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	138346-138377	9	0.719
CP027025_3	3.5\|18865\|32\|CP027025\|CRISPRCasFinder,CRT	18865-18896	32	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	278509-278540	9	0.719
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	175512-175543	9	0.719
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP015043	Rhodovulum sp. P5 plasmid pRGUI04, complete sequence	57531-57562	9	0.719
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP021409	Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence	3267-3298	9	0.719
CP027025_3	3.7\|18987\|32\|CP027025\|CRISPRCasFinder,CRT	18987-19018	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1955986-1956017	9	0.719
CP027025_3	3.8\|19048\|32\|CP027025\|CRISPRCasFinder,CRT	19048-19079	32	NZ_CP017043	Selenomonas sp. oral taxon 920 strain W5150 plasmid unnamed1, complete sequence	8380-8411	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	518089-518120	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	582081-582112	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	212944-212975	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1465414-1465445	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_015951	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence	223236-223267	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	330858-330889	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	537488-537519	9	0.719
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	315159-315190	9	0.719
CP027025_3	3.12\|19280\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19280-19311	32	NZ_CP010408	Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence	220652-220683	9	0.719
CP027025_3	3.14\|19402\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19402-19433	32	NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	446149-446180	9	0.719
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	22413-22444	9	0.719
CP027025_3	3.17\|19585\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19585-19616	32	NC_014840	Pantoea sp. At-9b plasmid pPAT9B03, complete sequence	282497-282528	9	0.719
CP027025_3	3.19\|19708\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19708-19739	32	NZ_CP013109	Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence	526487-526518	9	0.719
CP027025_3	3.19\|19708\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19708-19739	32	NZ_CP013053	Sinorhizobium americanum CCGM7 plasmid B, complete sequence	487066-487097	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	23808-23839	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	99269-99300	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	94128-94159	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	313746-313777	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	326510-326541	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	316504-316535	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	359059-359090	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	313687-313718	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	333142-333173	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	587836-587867	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	319932-319963	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	328107-328138	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	326510-326541	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	333142-333173	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	313687-313718	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	313250-313281	9	0.719
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	CP000663	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence	111328-111359	9	0.719
CP027025_4	4.1\|28330\|30\|CP027025\|CRT	28330-28359	30	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	15530-15559	9	0.7
CP027025_4	4.1\|28330\|30\|CP027025\|CRT	28330-28359	30	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	66532-66561	9	0.7
CP027025_4	4.1\|28330\|30\|CP027025\|CRT	28330-28359	30	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	229457-229486	9	0.7
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	459050-459080	9	0.71
CP027025_4	4.2\|28389\|31\|CP027025\|CRT	28389-28419	31	NZ_CP036407	Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence	79000-79030	9	0.71
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NC_011879	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence	51214-51245	9	0.719
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	NC_015951	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence	120943-120974	9	0.719
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	MH588547	Caulobacter phage CcrSC, complete genome	101313-101344	9	0.719
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	CP003958	Rhodococcus opacus PD630 plasmid 9, complete sequence	12106-12137	9	0.719
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	52925-52956	9	0.719
CP027025_5	5.6\|28939\|32\|CP027025\|CRISPRCasFinder	28939-28970	32	NZ_CP049837	Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence	1292-1323	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP015204	Rhodococcus sp. 008 plasmid pR8C1, complete sequence	45952-45983	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NC_007486	Rhodococcus erythropolis PR4 plasmid pREC1, complete sequence	82955-82986	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	46336-46367	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	131062-131093	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MT024862	Microbacterium phage Alakazam, complete genome	14899-14930	9	0.719
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MN586028	Gordonia phage MelBins, complete genome	6099-6130	9	0.719
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	AP014315	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C66, * SEQUENCING IN PROGRESS *	17111-17142	9	0.719
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	844355-844386	9	0.719
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	686013-686044	9	0.719
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	57436-57467	9	0.719
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	80940-80971	9	0.719
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	372993-373024	9	0.719
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	NZ_CP023713	Rhodococcus ruber strain YC-YT1 plasmid unnamed2, complete sequence	64485-64516	9	0.719
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	KY653127	Corynebacterium phage IME1320_01, complete genome	10909-10940	9	0.719
CP027025_6	6.1\|30573\|31\|CP027025\|PILER-CR	30573-30603	31	NZ_LT984809	Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence	50088-50118	9	0.71
CP027025_6	6.3\|30572\|32\|CP027025\|CRISPRCasFinder,CRT	30572-30603	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1779396-1779427	9	0.719
CP027025_6	6.3\|30572\|32\|CP027025\|CRISPRCasFinder,CRT	30572-30603	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	33865-33896	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	937724-937755	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	715959-715990	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	168907-168938	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	142588-142619	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	179289-179320	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	97452-97483	9	0.719
CP027025_6	6.4\|30633\|32\|CP027025\|CRISPRCasFinder,CRT	30633-30664	32	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	3448-3479	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	443735-443766	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	1037615-1037646	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	538846-538877	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	564720-564751	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	366795-366826	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	551520-551551	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	564720-564751	9	0.719
CP027025_7	7.1\|30879\|32\|CP027025\|CRISPRCasFinder,CRT	30879-30910	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	134356-134387	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP021919	Sagittula sp. P11 plasmid unnamed5, complete sequence	19210-19241	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1846201-1846232	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	226578-226609	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	246428-246459	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	405220-405251	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1711426-1711457	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	382649-382680	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	186696-186727	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	841241-841272	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	83140-83171	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	227664-227695	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	226797-226828	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	223536-223567	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	227920-227951	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	227693-227724	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	272752-272783	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	222579-222610	9	0.719
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	229182-229213	9	0.719
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	798643-798674	9	0.719
CP027025_7	7.5\|31123\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	31123-31154	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	263077-263108	9	0.719
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1250506-1250537	9	0.719
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	36061-36092	9	0.719
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NZ_CP054030	Rhizobium sp. JKLM19E plasmid pPR19E03	281549-281580	9	0.719
CP027025_8	8.2\|31782\|32\|CP027025\|CRISPRCasFinder	31782-31813	32	NZ_CP042264	Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence	214306-214337	9	0.719
CP027025_8	8.2\|31782\|32\|CP027025\|CRISPRCasFinder	31782-31813	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1489607-1489638	9	0.719
CP027025_8	8.2\|31782\|32\|CP027025\|CRISPRCasFinder	31782-31813	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	1305813-1305844	9	0.719
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	207942-207973	10	0.688
CP027025_1	1.4\|9069\|32\|CP027025\|CRT	9069-9100	32	NZ_AP015030	Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence	101590-101621	10	0.688
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	729527-729558	10	0.688
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	608872-608903	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	479021-479052	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	644664-644695	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	72970-73001	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	79267-79298	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	780414-780445	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	128216-128247	10	0.688
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	520472-520503	10	0.688
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	146999-147030	10	0.688
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	671306-671337	10	0.688
CP027025_1	1.10\|9436\|32\|CP027025\|CRT	9436-9467	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	502545-502576	10	0.688
CP027025_1	1.12\|9008\|31\|CP027025\|CRISPRCasFinder	9008-9038	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	317777-317807	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	545713-545743	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	1124417-1124447	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	1088552-1088582	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	977083-977113	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	1124124-1124154	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	1111963-1111993	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	913492-913522	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	1067073-1067103	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	1003319-1003349	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	1088552-1088582	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	1111963-1111993	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	1020425-1020455	10	0.677
CP027025_1	1.17\|9314\|31\|CP027025\|CRISPRCasFinder	9314-9344	31	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	527093-527123	10	0.677
CP027025_1	1.18\|9375\|31\|CP027025\|CRISPRCasFinder	9375-9405	31	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	267724-267754	10	0.677
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	146999-147029	10	0.677
CP027025_1	1.19\|9436\|31\|CP027025\|CRISPRCasFinder	9436-9466	31	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	671306-671336	10	0.677
CP027025_2	2.4\|18227\|32\|CP027025\|CRISPRCasFinder,CRT	18227-18258	32	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	126382-126413	10	0.688
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	1137791-1137822	10	0.688
CP027025_2	2.5\|18288\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	18288-18319	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	361894-361925	10	0.688
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	116248-116279	10	0.688
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	764484-764515	10	0.688
CP027025_3	3.3\|18743\|32\|CP027025\|CRISPRCasFinder,CRT	18743-18774	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	227515-227546	10	0.688
CP027025_3	3.4\|18804\|32\|CP027025\|CRISPRCasFinder,CRT	18804-18835	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	181199-181230	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1458885-1458916	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1171165-1171196	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	884102-884133	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1787745-1787776	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	647363-647394	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1257436-1257467	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1426994-1427025	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	996646-996677	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1562906-1562937	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1172028-1172059	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1479605-1479636	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1878326-1878357	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1682544-1682575	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1356294-1356325	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1177115-1177146	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1209937-1209968	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1173858-1173889	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1359742-1359773	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1853062-1853093	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1142771-1142802	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	815568-815599	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1359709-1359740	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1358514-1358545	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1152587-1152618	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1358551-1358582	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1152610-1152641	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1229973-1230004	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1358551-1358582	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1358540-1358571	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1152610-1152641	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1358540-1358571	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1152610-1152641	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1229968-1229999	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1240423-1240454	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1359707-1359738	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1152610-1152641	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1152610-1152641	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1358551-1358582	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	787426-787457	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1358562-1358593	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1358540-1358571	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	787426-787457	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1142600-1142631	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1192726-1192757	10	0.688
CP027025_3	3.6\|18926\|32\|CP027025\|CRISPRCasFinder,CRT	18926-18957	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1055494-1055525	10	0.688
CP027025_3	3.10\|19158\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19158-19189	32	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	191772-191803	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	119025-119056	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	486122-486153	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	610698-610729	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	226164-226195	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	670595-670626	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_024366	Mycobacterium phage OkiRoe, complete genome	54361-54392	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	588956-588987	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP041766	Tomitella sp. HY188 plasmid unnamed, complete sequence	47264-47295	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP015813	Microbacterium chocolatum strain SIT 101 plasmid 3, complete sequence	13305-13336	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	330490-330521	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	AB276040	Ralstonia phage RSA1 DNA, complete genome	2381-2412	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	U46938	Mycobacterium phage DS6A, Spe1/NheI G fragment sequence	9214-9245	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_009382	Ralstonia phage phiRSA1, complete genome	2381-2412	10	0.688
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	JN698994	Mycobacterium phage DS6A, complete genome	50270-50301	10	0.688
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	459498-459529	10	0.688
CP027025_3	3.17\|19585\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19585-19616	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1141878-1141909	10	0.688
CP027025_3	3.20\|19769\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19769-19800	32	NZ_CP049700	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence	293527-293558	10	0.688
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	470376-470407	10	0.688
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	NC_004683	Mycobacterium phage Che9c, complete genome	53610-53641	10	0.688
CP027025_5	5.2\|28695\|32\|CP027025\|CRISPRCasFinder	28695-28726	32	AY129333	Mycobacterium virus Che9c, complete genome	53610-53641	10	0.688
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1118215-1118246	10	0.688
CP027025_5	5.5\|28878\|32\|CP027025\|CRISPRCasFinder	28878-28909	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	286223-286254	10	0.688
CP027025_5	5.6\|28939\|32\|CP027025\|CRISPRCasFinder	28939-28970	32	NC_019387	Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence	161257-161288	10	0.688
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MN204492	Streptomyces phage GirlPower, complete genome	24994-25025	10	0.688
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MK433268	Streptomyces phage Popy, complete genome	24023-24054	10	0.688
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MF467948	Streptomyces phage DrGrey, complete genome	24023-24054	10	0.688
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MN586054	Streptomyces phage FrodoSwaggins, complete genome	24023-24054	10	0.688
CP027025_5	5.9\|29122\|32\|CP027025\|CRISPRCasFinder	29122-29153	32	MN204504	Streptomyces phage Soshi, complete genome	24029-24060	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	647363-647394	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1853062-1853093	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1229969-1230000	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1229973-1230004	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1229968-1229999	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1458885-1458916	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1142600-1142631	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1171165-1171196	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1192726-1192757	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1055494-1055525	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	884102-884133	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1787745-1787776	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1239573-1239604	10	0.688
CP027025_5	5.13\|29395\|32\|CP027025\|CRISPRCasFinder	29395-29426	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1697368-1697399	10	0.688
CP027025_5	5.14\|29456\|32\|CP027025\|CRISPRCasFinder	29456-29487	32	MN693478	Marine virus AFVG_25M14, complete genome	21304-21335	10	0.688
CP027025_6	6.3\|30572\|32\|CP027025\|CRISPRCasFinder,CRT	30572-30603	32	NZ_LT984809	Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence	50088-50119	10	0.688
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5802349-5802380	10	0.688
CP027025_6	6.5\|30694\|32\|CP027025\|CRISPRCasFinder,CRT	30694-30725	32	MH651167	Gordonia phage Angelique, complete genome	25987-26018	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	425850-425881	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	621370-621401	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	KY365739	Streptomyces phage BabyGotBac, complete genome	34041-34072	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	MH178382	Streptomyces phage Salete, complete genome	34038-34069	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	KU189325	Streptomyces phage Maih, complete genome	34040-34071	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	MH178381	Streptomyces phage BayC, complete genome	34038-34069	10	0.688
CP027025_7	7.2\|30940\|32\|CP027025\|CRISPRCasFinder,CRT	30940-30971	32	KP876466	Streptomyces phage TP1604, complete genome	34041-34072	10	0.688
CP027025_7	7.3\|31001\|32\|CP027025\|CRISPRCasFinder,CRT	31001-31032	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1385997-1386028	10	0.688
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	313087-313118	10	0.688
CP027025_8	8.2\|31782\|32\|CP027025\|CRISPRCasFinder	31782-31813	32	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1357702-1357733	10	0.688
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	254882-254913	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	NC_006552	Pseudomonas phage F116, complete genome	30102-30133	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	MK511040	Pseudomonas phage CF63, partial genome	34039-34070	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	MF490237	Pseudomonas phage vB_PaeP_E220, complete genome	43693-43724	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	KM389216	UNVERIFIED: Pseudomonas phage F_ET605sp/Pa1651 clone contig00001 genomic sequence	37125-37156	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	AY625898	Pseudomonas aeruginosa phage F116, complete genome	30102-30133	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	KM389247	UNVERIFIED: Pseudomonas phage JBD90 clone contig00001 genomic sequence	18709-18740	11	0.656
CP027025_1	1.1\|8886\|32\|CP027025\|CRT	8886-8917	32	LT603684	Pseudomonas phage phiC725A genome assembly	29425-29456	11	0.656
CP027025_1	1.3\|9008\|32\|CP027025\|CRT	9008-9039	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	317776-317807	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	545712-545743	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	527093-527124	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	1124416-1124447	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	1088551-1088582	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	977082-977113	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	1124123-1124154	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	1111962-1111993	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	913491-913522	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	1067072-1067103	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	1003318-1003349	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	1088551-1088582	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	1111962-1111993	11	0.656
CP027025_1	1.8\|9314\|32\|CP027025\|CRT	9314-9345	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	1020424-1020455	11	0.656
CP027025_1	1.9\|9375\|32\|CP027025\|CRT	9375-9406	32	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	267724-267755	11	0.656
CP027025_2	2.3\|18166\|32\|CP027025\|CRISPRCasFinder,CRT	18166-18197	32	KT997836	Uncultured Mediterranean phage uvDeep-CGR0-AD1-C123, complete genome	14636-14667	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1313795-1313826	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1077920-1077951	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	572041-572072	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	277821-277852	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1390900-1390931	11	0.656
CP027025_2	2.6\|18349\|32\|CP027025\|CRISPRCasFinder,CRT	18349-18380	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1560345-1560376	11	0.656
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NC_007960	Nitrobacter hamburgensis X14 plasmid 2, complete sequence	89799-89830	11	0.656
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	90346-90377	11	0.656
CP027025_3	3.16\|19524\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19524-19555	32	AP014720	Arthrobacter sp. Hiyo8 plasmid pHiyo8-1 DNA, complete genome, strain: Hiyo8	420-451	11	0.656
CP027025_5	5.3\|28756\|32\|CP027025\|CRISPRCasFinder	28756-28787	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	38972-39003	11	0.656
CP027025_5	5.12\|29334\|32\|CP027025\|CRISPRCasFinder	29334-29365	32	NC_009427	Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence	29516-29547	11	0.656
CP027025_8	8.1\|31721\|32\|CP027025\|CRISPRCasFinder	31721-31752	32	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	443873-443904	11	0.656
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_LR594660	Variovorax sp. PBL-H6 plasmid 2	596611-596642	12	0.625
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_LR594667	Variovorax sp. SRS16 plasmid 2	241547-241578	12	0.625
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1019234-1019265	12	0.625
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_LR594690	Variovorax sp. WDL1 plasmid 2	244523-244554	12	0.625
CP027025_3	3.11\|19219\|32\|CP027025\|CRISPRCasFinder,CRT,PILER-CR	19219-19250	32	NZ_LR594672	Variovorax sp. PBL-E5 plasmid 2	241547-241578	12	0.625

1. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
aagcccaggtccgggccctggacgaaccagga	Protospacer
********************************

2. spacer 1.2|8947|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgaggagcggtccaccgagtgggaggcgaa	CRISPR spacer
gtcgaggagcggtccaccgagtgggaggcgaa	Protospacer
********************************

3. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
aacgtgtcgaggccgatctgcgcgtacttgtt	Protospacer
********************************

4. spacer 1.4|9069|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgtcgccaagcgagaggcgcgtcgtgatggc	CRISPR spacer
gtgtcgccaagcgagaggcgcgtcgtgatggc	Protospacer
********************************

5. spacer 1.5|9130|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcctcgaaggacagcagggtcgtggcga	CRISPR spacer
gtagtcctcgaaggacagcagggtcgtggcga	Protospacer
********************************

6. spacer 1.6|9191|33|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtccgtcttcgggtcgtcctcgaacacctccca	CRISPR spacer
gtccgtcttcgggtcgtcctcgaacacctccca	Protospacer
*********************************

7. spacer 1.7|9253|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

tcggcacgagcgcctgacgtggtcgacttcgt	CRISPR spacer
tcggcacgagcgcctgacgtggtcgacttcgt	Protospacer
********************************

8. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
cgtgccgtccgtgaggccgtgttcgacgagct	Protospacer
********************************

9. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
agcgccaccgcgccgcggacggcctcgatcgt	Protospacer
********************************

10. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccagctcgtcgcctacagcgccggagtcct	Protospacer
********************************

11. spacer 1.11|8947|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgaggagcggtccaccgagtgggaggcga	CRISPR spacer
gtcgaggagcggtccaccgagtgggaggcga	Protospacer
*******************************

12. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
aacgtgtcgaggccgatctgcgcgtacttgt	Protospacer
*******************************

13. spacer 1.13|9069|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgtcgccaagcgagaggcgcgtcgtgatgg	CRISPR spacer
gtgtcgccaagcgagaggcgcgtcgtgatgg	Protospacer
*******************************

14. spacer 1.14|9130|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcctcgaaggacagcagggtcgtggcg	CRISPR spacer
gtagtcctcgaaggacagcagggtcgtggcg	Protospacer
*******************************

15. spacer 1.15|9191|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtccgtcttcgggtcgtcctcgaacacctccc	CRISPR spacer
gtccgtcttcgggtcgtcctcgaacacctccc	Protospacer
********************************

16. spacer 1.16|9253|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

tcggcacgagcgcctgacgtggtcgacttcg	CRISPR spacer
tcggcacgagcgcctgacgtggtcgacttcg	Protospacer
*******************************

17. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
cgtgccgtccgtgaggccgtgttcgacgagc	Protospacer
*******************************

18. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
agcgccaccgcgccgcggacggcctcgatcg	Protospacer
*******************************

19. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccagctcgtcgcctacagcgccggagtcc	Protospacer
*******************************

20. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccaccgcgccgcggacggcctcga	Protospacer
****************************

21. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccagctcgtcgcctacagcgccggag	Protospacer
****************************

22. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
ggtgacggtcacgggcggtgctcctgggcggt	Protospacer
********************************

23. spacer 2.2|18105|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

acgcagctcctccaggccgggcctgacggcct	CRISPR spacer
acgcagctcctccaggccgggcctgacggcct	Protospacer
********************************

24. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
ctctggttgagtacgacgacgagcagggtctc	Protospacer
********************************

25. spacer 2.4|18227|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ggatcgcgccgtcacatgcgggtgggcggctt	CRISPR spacer
ggatcgcgccgtcacatgcgggtgggcggctt	Protospacer
********************************

26. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
taccggacggcgctggaggccggtccgatcca	Protospacer
********************************

27. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
agtaccagcgccccggacgcggcgacctgcat	Protospacer
********************************

28. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agtaccagcgccccggacgcggcgacct	CRISPR spacer
agtaccagcgccccggacgcggcgacct	Protospacer
****************************

29. spacer 3.1|18592|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cgtcgggcggggtcactggcggactcccaacg	CRISPR spacer
cgtcgggcggggtcactggcggactcccaacg	Protospacer
********************************

30. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
ccatacgtcagcgtcgcgccaccgccagccgg	Protospacer
********************************

31. spacer 3.4|18804|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

atagtcctcgaaggacagcaaggtcgtggcga	CRISPR spacer
atagtcctcgaaggacagcaaggtcgtggcga	Protospacer
********************************

32. spacer 3.5|18865|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ctcaggtccaccgacaacttcgcggccgacac	CRISPR spacer
ctcaggtccaccgacaacttcgcggccgacac	Protospacer
********************************

33. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gccgcagccgcccgcgcggcaggccacggaga	Protospacer
********************************

34. spacer 3.7|18987|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cttttcaggaggctggaggcgcgcaacgcgtc	CRISPR spacer
cttttcaggaggctggaggcgcgcaacgcgtc	Protospacer
********************************

35. spacer 3.8|19048|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cgcgtttgccccttgcagccccgattcatccg	CRISPR spacer
cgcgtttgccccttgcagccccgattcatccg	Protospacer
********************************

36. spacer 3.9|19109|20|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgacgagggcggccgcgct	CRISPR spacer
gcgacgagggcggccgcgct	Protospacer
********************

37. spacer 3.10|19158|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gagggcgtgtagctctcctcgaagggggtgcc	CRISPR spacer
gagggcgtgtagctctcctcgaagggggtgcc	Protospacer
********************************

38. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
tctgcggcggccggcgccgggccgcgcttggg	Protospacer
********************************

39. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
ggacgacgagcagggcgagcgtggacacggtg	Protospacer
********************************

40. spacer 3.13|19341|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

acggcgtgcgtgcagtgtgcacagagcggaaa	CRISPR spacer
acggcgtgcgtgcagtgtgcacagagcggaaa	Protospacer
********************************

41. spacer 3.14|19402|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccggtcttcgacagtctggggaacacgacgtg	CRISPR spacer
ccggtcttcgacagtctggggaacacgacgtg	Protospacer
********************************

42. spacer 3.15|19463|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cacgcccggttccgaggagcgccggacgcggc	CRISPR spacer
cacgcccggttccgaggagcgccggacgcggc	Protospacer
********************************

43. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggcgggatgtcgaggcgttcgatgccggtggt	Protospacer
********************************

44. spacer 3.17|19585|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gactcggagaggatctccaggttgtcttcctt	CRISPR spacer
gactcggagaggatctccaggttgtcttcctt	Protospacer
********************************

45. spacer 3.18|19646|33|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ttaactgttcccgttcgtagccgtaacggtccg	CRISPR spacer
ttaactgttcccgttcgtagccgtaacggtccg	Protospacer
*********************************

46. spacer 3.19|19708|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gcctcccagccggagggcagactcgtcgtgaa	CRISPR spacer
gcctcccagccggagggcagactcgtcgtgaa	Protospacer
********************************

47. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
aagtgctcggcgatccgcaggcggcggaggct	Protospacer
********************************

48. spacer 3.21|19830|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggattacccgacggggcttctttgtgaaggg	CRISPR spacer
cggattacccgacggggcttctttgtgaaggg	Protospacer
********************************

49. spacer 4.1|28330|30|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agcggtggtcgcgttccatatggccaccgt	CRISPR spacer
agcggtggtcgcgttccatatggccaccgt	Protospacer
******************************

50. spacer 4.2|28389|31|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gagcgggcatcgtcggggccggggagcgtgt	CRISPR spacer
gagcgggcatcgtcggggccggggagcgtgt	Protospacer
*******************************

51. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
gcttcacggacccgccgagcaccattgttggc	Protospacer
********************************

52. spacer 5.1|28634|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agggagacggccaggtcccgggaataggagac	CRISPR spacer
agggagacggccaggtcccgggaataggagac	Protospacer
********************************

53. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
agggtacccgcagcgtggccctgctcgatgcg	Protospacer
********************************

54. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
cggccgacgtgcaggtggcgcagtcgagccgg	Protospacer
********************************

55. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ttgaccagcaccttccggtcgttggtccggta	CRISPR spacer
ttgaccagcaccttccggtcgttggtccggta	Protospacer
********************************

56. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
gtcaccaccgtcgacgacggggccttcaccgc	Protospacer
********************************

57. spacer 5.6|28939|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccccggtacgaggtcggccaggtgcg	CRISPR spacer
acggggccccggtacgaggtcggccaggtgcg	Protospacer
********************************

58. spacer 5.7|29000|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

atccagatgcccggctcggaccgcatgaacat	CRISPR spacer
atccagatgcccggctcggaccgcatgaacat	Protospacer
********************************

59. spacer 5.8|29061|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacatggagaagatggacttcccctcgat	CRISPR spacer
gccgacatggagaagatggacttcccctcgat	Protospacer
********************************

60. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
gacaccgtcaccaccttcatcgcgaacgtgca	Protospacer
********************************

61. spacer 5.11|29273|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcctcgaatgacagcagggtcgtggcga	CRISPR spacer
gtagtcctcgaatgacagcagggtcgtggcga	Protospacer
********************************

62. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
ttcgcgggatcgacgacgaaatggttctcgat	Protospacer
********************************

63. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gccgcagccgcccgcgcggcaggccacggagg	Protospacer
********************************

64. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ccgccccgtgtccacctggcccaccaccgcgt	Protospacer
********************************

65. spacer 5.15|29517|33|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ctcggccgacttggtgaacacgttggcgttgtg	CRISPR spacer
ctcggccgacttggtgaacacgttggcgttgtg	Protospacer
*********************************

66. spacer 6.1|30573|31|CP027025|PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
acatcaccgtccggatctcccgcgaggcgac	Protospacer
*******************************

67. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tgccttcgaagacgaccgtcgccaggtcgta	Protospacer
*******************************

68. spacer 6.3|30572|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gacatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
gacatcaccgtccggatctcccgcgaggcgac	Protospacer
********************************

69. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ttgccttcgaagacgaccgtcgccaggtcgta	Protospacer
********************************

70. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
gccttgaacacgctgacgaagatgctgccgac	Protospacer
********************************

71. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
ccacgccgccgcctggtcgccagggaagtcgc	Protospacer
********************************

72. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacagaccgccgagggcgatccggacggagtt	Protospacer
********************************

73. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
gcagccccgatgacggccgcccactcgcctac	Protospacer
********************************

74. spacer 7.4|31062|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cggctcatgcaccgcgagcagacgtggacgtt	CRISPR spacer
cggctcatgcaccgcgagcagacgtggacgtt	Protospacer
********************************

75. spacer 7.5|31123|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

tcgaccggcccgcgcccgtactcggccggcag	CRISPR spacer
tcgaccggcccgcgcccgtactcggccggcag	Protospacer
********************************

76. spacer 7.6|31184|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgagctcctcgggaacctcttccgcgccct	CRISPR spacer
gccgagctcctcgggaacctcttccgcgccct	Protospacer
********************************

77. spacer 7.7|31245|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

ggcttcgtcgtgtcctgtcccggccggccacc	CRISPR spacer
ggcttcgtcgtgtcctgtcccggccggccacc	Protospacer
********************************

78. spacer 7.8|31306|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

cccggccgggctctcacacaccgaccggggcc	CRISPR spacer
cccggccgggctctcacacaccgaccggggcc	Protospacer
********************************

79. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
gtcttgccctgccagtccttgcggcccttggt	Protospacer
********************************

80. spacer 8.2|31782|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

agcggttccgcgcccatctcgaagttggacag	CRISPR spacer
agcggttccgcgcccatctcgaagttggacag	Protospacer
********************************

81. spacer 1.5|9130|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcctcgaaggacagcagggtcgtggcga	CRISPR spacer
gtagtcctcgaatgacagcagggtcgtggcga	Protospacer
************ *******************

82. spacer 1.14|9130|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.968

gtagtcctcgaaggacagcagggtcgtggcg	CRISPR spacer
gtagtcctcgaatgacagcagggtcgtggcg	Protospacer
************ ******************

83. spacer 3.2|18653|61|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.984

ggatgacctctttgccagcctcgcccaccaggcccaccacgggccggcccacgatcccgc	CRISPR spacer
ggatgacctctttgccagcctcgcccaccaggcccaccacgggccggcccacgatcccgc	Protospacer
************************************************************

84. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.969

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gccgcagccgcccgcgcggcaggccacggagg	Protospacer
*******************************.

85. spacer 3.9|19109|20|CP027025|CRISPRCasFinder,CRT matches to NC_012807 (Methylorubrum extorquens AM1 plasmid p1META1, complete sequence) position: , mismatch: 1, identity: 0.95

gcgacgagggcggccgcgct	CRISPR spacer
gcgacgagggcggccgcgca	Protospacer
*******************

86. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.969

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
ggacgacgagcagggcgagcgtggacacggta	Protospacer
*******************************.

87. spacer 5.10|29183|61|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.984

ggataacctctttgccggcctcgcccaccaggcccaccacgggccggtccacgatcccgc	CRISPR spacer
ggataacctctttgccggcctcgcccaccaggcccaccacgggccggtccacgatcccgc	Protospacer
************************************************************

88. spacer 5.11|29273|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcctcgaatgacagcagggtcgtggcga	CRISPR spacer
gtagtcctcgaaggacagcagggtcgtggcga	Protospacer
************ *******************

89. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.969

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gccgcagccgcccgcgcggcaggccacggaga	Protospacer
*******************************.

90. spacer 1.5|9130|32|CP027025|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.938

gtagtcctcgaaggacagcagggtcgtggcga	CRISPR spacer
atagtcctcgaaggacagcaaggtcgtggcga	Protospacer
.*******************.***********

91. spacer 1.14|9130|31|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.935

gtagtcctcgaaggacagcagggtcgtggcg	CRISPR spacer
atagtcctcgaaggacagcaaggtcgtggcg	Protospacer
.*******************.**********

92. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to MT711975 (Streptomyces phage Alderaan, complete genome) position: , mismatch: 2, identity: 0.938

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
ggtgacggtcacgggcggttctcctgtgcggt	Protospacer
******************* ****** *****

93. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 2, identity: 0.938

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
ggtgacggtcacgggcggttctcctgtgcggt	Protospacer
******************* ****** *****

94. spacer 3.4|18804|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.938

atagtcctcgaaggacagcaaggtcgtggcga	CRISPR spacer
gtagtcctcgaaggacagcagggtcgtggcga	Protospacer
.*******************.***********

95. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 2, identity: 0.938

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
cggccgccgtgcaggtggcgcagccgagccgg	Protospacer
****** ****************.********

96. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to NC_020894 (Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence) position: , mismatch: 2, identity: 0.938

ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
ttcgcggggtcgacgacgaaatgattctcgat	Protospacer
********.**************.********

97. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to NC_017766 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence) position: , mismatch: 2, identity: 0.938

ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
ttcgcggggtcgacgacgaaatgattctcgat	Protospacer
********.**************.********

98. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.938

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
ccacaccgccgcctggtcgccggggaagtcgc	Protospacer
****.****************.**********

99. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 3, identity: 0.893

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgcgaccgcgccgcggaccgcctcgt	Protospacer
***** ************** ******

100. spacer 3.4|18804|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.906

atagtcctcgaaggacagcaaggtcgtggcga	CRISPR spacer
gtagtcctcgaatgacagcagggtcgtggcga	Protospacer
.*********** *******.***********

101. spacer 5.11|29273|32|CP027025|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.906

gtagtcctcgaatgacagcagggtcgtggcga	CRISPR spacer
atagtcctcgaaggacagcaaggtcgtggcga	Protospacer
.*********** *******.***********

102. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 4, identity: 0.875

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcgt-	Protospacer
***** *****.************* ***.**

103. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 4, identity: 0.875

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcgt-	Protospacer
***** *****.************* ***.**

104. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 4, identity: 0.875

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcgt-	Protospacer
***** *****.************* ***.**

105. spacer 1.3|9008|32|CP027025|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 4, identity: 0.875

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcgt-	Protospacer
***** *****.************* ***.**

106. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 4, identity: 0.871

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcg-	Protospacer
***** *****.************* ***.*

107. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 4, identity: 0.871

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcg-	Protospacer
***** *****.************* ***.*

108. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 4, identity: 0.871

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcg-	Protospacer
***** *****.************* ***.*

109. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 4, identity: 0.871

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
aacgtctcgagaccgatctgcgcgtcactcg-	Protospacer
***** *****.************* ***.*

110. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_014159 (Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence) position: , mismatch: 4, identity: 0.871

agcgc-caccgcgccgcggacggcctcgatcg-	CRISPR spacer
-acgcgcaccgcgccgcggacggcgtcg-tcgt	Protospacer
 .*** ****************** *** ***

111. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.857

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cgcgccactgcgcggcggacggcctcgg	Protospacer
 *******.**** *************.

112. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 4, identity: 0.857

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acctccaccgcgcagcggaccgcctcga	Protospacer
* * ********* ****** *******

113. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_014159 (Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence) position: , mismatch: 4, identity: 0.857

agcgc-caccgcgccgcggacggcctcga	CRISPR spacer
-acgcgcaccgcgccgcggacggcgtcgt	Protospacer
 .*** ****************** ***

114. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 4, identity: 0.857

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
accgcgaccgcgccgcggaccgcctcca	Protospacer
* *** ************** ***** *

115. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 4, identity: 0.857

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acctccaccgcgcagcggaccgcctcga	Protospacer
* * ********* ****** *******

116. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 4, identity: 0.857

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acctccaccgcgcagcggaccgcctcga	Protospacer
* * ********* ****** *******

117. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccacctcgtcgcccacagcgccgccg	Protospacer
***** *********.*********  *

118. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccacctcgtcgcccacagcgccgccg	Protospacer
***** *********.*********  *

119. spacer 1.21|9438|28|CP027025|PILER-CR matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccacctcgtcgcccacagcgccgccg	Protospacer
***** *********.*********  *

120. spacer 1.21|9438|28|CP027025|PILER-CR matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccacctcgtcgcccacagcgccgccg	Protospacer
***** *********.*********  *

121. spacer 1.21|9438|28|CP027025|PILER-CR matches to KP966108 (Burkholderia phage vB_BceM_AP3, complete genome) position: , mismatch: 4, identity: 0.857

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ccccagctcgtcgcctccagcgcgcaag	Protospacer
**************** ******  .**

122. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggcgaccg	Protospacer
* .***.********************

123. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggcgaccg	Protospacer
* .***.********************

124. spacer 2.7|18353|28|CP027025|PILER-CR matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggcgaccg	Protospacer
* .***.********************

125. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 4, identity: 0.857

agtaccagcgccccggacgcggcgacct	CRISPR spacer
cgcaccagcgcctcgaacgcggcgacct	Protospacer
 *.*********.**.************

126. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP030354 (Novosphingobium sp. P6W plasmid pP6W1, complete sequence) position: , mismatch: 5, identity: 0.844

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
atcgcgtcgagggcgatctgcgcgtactcggt	Protospacer
* **.******* ***************.* *

127. spacer 1.9|9375|32|CP027025|CRT matches to NZ_AP014659 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence) position: , mismatch: 5, identity: 0.844

agcgcca-ccgcgccgcggacggcctcgatcgt	CRISPR spacer
-tcgccagccgctccgcggatggcctcgatcat	Protospacer
  ***** **** *******.**********.*

128. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 5, identity: 0.844

agcgcca-ccgcgccgcggacggcctcgatcgt	CRISPR spacer
-tcgccagccgctccgcggatggcctcgatcat	Protospacer
  ***** **** *******.**********.*

129. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP030354 (Novosphingobium sp. P6W plasmid pP6W1, complete sequence) position: , mismatch: 5, identity: 0.839

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
atcgcgtcgagggcgatctgcgcgtactcgg	Protospacer
* **.******* ***************.*

130. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_AP014659 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence) position: , mismatch: 5, identity: 0.839

agcgcca-ccgcgccgcggacggcctcgatcg	CRISPR spacer
-tcgccagccgctccgcggatggcctcgatca	Protospacer
  ***** **** *******.**********.

131. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 5, identity: 0.839

agcgcca-ccgcgccgcggacggcctcgatcg	CRISPR spacer
-tcgccagccgctccgcggatggcctcgatca	Protospacer
  ***** **** *******.**********.

132. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

133. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

134. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cgtgccaccgcgccgcggacggtctcct	Protospacer
 *.*******************.***

135. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
ctcgccaccgcctcgcggacggcctcgc	Protospacer
  ********* .**************

136. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

137. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

138. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

139. spacer 1.20|9377|28|CP027025|PILER-CR matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gccgccaccgcctcgcggacggcctcgc	Protospacer
. ********* .**************

140. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cacgccaccgcgctgcggacggccgcgc	Protospacer
 .***********.********** **

141. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cctgccaccacggcgcggacggcctcga	Protospacer
  .******.** ***************

142. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
atccacaccgagccgcgcacggcctcga	Protospacer
* *  ***** ****** **********

143. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgt	Protospacer
******.***********.****  **

144. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgt	Protospacer
******.***********.****  **

145. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acttccaccgcgcagcggaccgcctcga	Protospacer
* . ********* ****** *******

146. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgt	Protospacer
******.***********.****  **

147. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
accgccagcgcgccgcggatggcctgaa	Protospacer
* ***** ***********.***** .*

148. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
accctcaccccgccggggacggcctcga	Protospacer
* * .**** ***** ************

149. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
aaagcgaccgcgccgcggaccgcctcca	Protospacer
*. ** ************** ***** *

150. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

agcgc-caccgcgccgcggacggcctcga	CRISPR spacer
-tcgcaaaccgcgccgctgacggcctcgc	Protospacer
  ***  ********** **********

151. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP050991 (Chromobacterium violaceum strain FDAARGOS_635 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccaccgcgccgccgacgtcggcgt	Protospacer
**************** **** *  **

152. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_MG651603 (Chromobacterium violaceum strain ATCC 12472 plasmid pChV1, complete sequence) position: , mismatch: 5, identity: 0.821

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccaccgcgccgccgacgtcggcgt	Protospacer
**************** **** *  **

153. spacer 1.20|9377|28|CP027025|PILER-CR matches to MT657335 (Gordonia phage Mariokart, complete genome) position: , mismatch: 5, identity: 0.821

agcgcc-accgcgccgcggacggcctcga	CRISPR spacer
-gcgttgaccgcgccgaggacggcctcgg	Protospacer
 ***.. ********* ***********.

154. spacer 1.21|9438|28|CP027025|PILER-CR matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.821

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
ctccagcttgtcgcctccagcgccgccg	Protospacer
*.******.******* ********  *

155. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

156. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgcaccggacgcggcgaccg	Protospacer
* .***.**** ***************

157. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

158. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

159. spacer 2.7|18353|28|CP027025|PILER-CR matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

160. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

161. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

162. spacer 2.7|18353|28|CP027025|PILER-CR matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
accaccggcgccccggacgcggccaccg	Protospacer
* .***.**************** ***

163. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP054606 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence) position: , mismatch: 5, identity: 0.821

agtaccagcgccccggacgcggcgacct	CRISPR spacer
cgcatcagcgcctcggacacggcgacct	Protospacer
 *.*.*******.*****.*********

164. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to NZ_CP026654 (Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
ttgcccgggtcgacgacgaagtggttctcgat	Protospacer
**  * **.***********.***********

165. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP029234 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436d, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
accggatcgaggccgatctgcgcgggcttgat	Protospacer
* ** .****************** .**** *

166. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

167. spacer 1.3|9008|32|CP027025|CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
aacgtctcgagaccgatctgcgcctgacgcgt-	Protospacer
***** *****.*********** * ** .**

168. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

169. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

170. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

171. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

172. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.812

aacgtgtcgaggccgatctgcgcgt-acttgtt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccgt-	Protospacer
*.*** * ***************** **..**

173. spacer 1.4|9069|32|CP027025|CRT matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gtgtcgccaagcgagaggcgcgtcgtgatggc	CRISPR spacer
gaggcgccaagcgaaaggcgggtcgtgaatgc	Protospacer
* * **********.***** *******  **

174. spacer 1.9|9375|32|CP027025|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 6, identity: 0.812

agcgccaccgcgccgcggacggcctcg-atcgt	CRISPR spacer
cacgccaccgcgctgcggacggccgcgcagcg-	Protospacer
 .***********.********** ** * **

175. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.812

agcgccaccgcgccgcggacggc--ctcgatcgt	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgatc--	Protospacer
******.***********.****  * .****

176. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.812

agcgccaccgcgccgcggacggc--ctcgatcgt	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgatc--	Protospacer
******.***********.****  * .****

177. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.812

agcgccaccgcgccgcggacggcct-cgatcgt	CRISPR spacer
accgcgaccgcgccgcggaccgcctccagtcg-	Protospacer
* *** ************** **** *..***

178. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.812

agcgccaccgcgccgcggacggc--ctcgatcgt	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgatc--	Protospacer
******.***********.****  * .****

179. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP029234 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436d, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
accggatcgaggccgatctgcgcgggcttga	Protospacer
* ** .****************** .****

180. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

181. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
aacgtctcgagaccgatctgcgcctgacgcg-	Protospacer
***** *****.*********** * ** .*

182. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

183. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

184. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

185. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

186. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.806

aacgtgtcgaggccgatctgcgcgt-acttgt	CRISPR spacer
agcgtctggaggccgatctgcgcgtcacccg-	Protospacer
*.*** * ***************** **..*

187. spacer 1.13|9069|31|CP027025|CRISPRCasFinder matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gtgtcgccaagcgagaggcgcgtcgtgatgg	CRISPR spacer
gaggcgccaagcgaaaggcgggtcgtgaatg	Protospacer
* * **********.***** *******  *

188. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 6, identity: 0.806

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ggtgccgtccgtgaggccgcgttcgcaggcc	Protospacer
 ******************.*****  *. *

189. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.806

agcgccaccgcgccgcggacggc--ctcgatcg	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgat--	Protospacer
******.***********.****  * .***

190. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.806

agcgccaccgcgccgcggacggc--ctcgatcg	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgat--	Protospacer
******.***********.****  * .***

191. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.806

agcgccaccgcgccgcggacggc--ctcgatcg	CRISPR spacer
agcgccgccgcgccgcgggcggcggcgtgat--	Protospacer
******.***********.****  * .***

192. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccg	Protospacer
***** *********.*********  *.*

193. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccg	Protospacer
***** *********.*********  *.*

194. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccg	Protospacer
***** *********.*********  *.*

195. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccg	Protospacer
***** *********.*********  *.*

196. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to KP966108 (Burkholderia phage vB_BceM_AP3, complete genome) position: , mismatch: 6, identity: 0.806

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ccccagctcgtcgcctccagcgcgcaagcgc	Protospacer
**************** ******  .**. *

197. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acgaccaccgcgccggggacggccttgg	Protospacer
*  .*********** *********.*.

198. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cgggtgaccgcgccgcggacggcctccc	Protospacer
 * *. ********************

199. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gctgccaccgcctcgcggacggcctcgc	Protospacer
. .******** .**************

200. spacer 1.20|9377|28|CP027025|PILER-CR matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
ctggccaccgcgctgctgacggcctcgg	Protospacer
   **********.** **********.

201. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cgcggcgccgcgccgcggacggcccggg	Protospacer
 *** *.*****************. *.

202. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_008537 (Arthrobacter sp. FB24 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
cgcgcgaccgcgccgcggtcggccgtta	Protospacer
 **** ************ ***** . *

203. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
ccctgcaccgcgccgcgcacggccccga	Protospacer
  *  ************ ******.***

204. spacer 1.20|9377|28|CP027025|PILER-CR matches to MT446395 (UNVERIFIED: Escherichia virus TH21, complete genome) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
tgcgccaccgcgcggcggacggaacgga	Protospacer
 ************ ********  . **

205. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
tgcgccaccgcgacgcggacggtgacgg	Protospacer
 *********** *********.  **.

206. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
tgcgccagcgcgccgaggacggccatgc	Protospacer
 ****** ******* ******** .*

207. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgtcaccgcggcgcggacggcgaagg	Protospacer
****.******* **********   *.

208. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
acggccactgcgccgcggccggcctcac	Protospacer
*  *****.********* *******.

209. spacer 1.20|9377|28|CP027025|PILER-CR matches to MK376956 (Gordonia phage WilliamBoone, complete genome) position: , mismatch: 6, identity: 0.786

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
aggagatccgcgccgcggccggcctcga	Protospacer
** .   *********** *********

210. spacer 1.21|9438|28|CP027025|PILER-CR matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.786

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgccgagc	Protospacer
 ********* ** ***********..

211. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 6, identity: 0.786

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgccgagc	Protospacer
.********* ** ***********..

212. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 6, identity: 0.786

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaaa	Protospacer
 ********* ** ********** .*.

213. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 6, identity: 0.786

agtaccagcgccccggacgcggcgacct	CRISPR spacer
ctttgcagcgccccggacgcggcgtcca	Protospacer
  *  ******************* **

214. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 6, identity: 0.786

agtaccagcgccccggacgcggcgacct	CRISPR spacer
ggcaccagcgccctggacgtggcgacgg	Protospacer
.*.**********.*****.******

215. spacer 2.7|18353|28|CP027025|PILER-CR matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.786

agtaccagcgccccggacgcggcgacct	CRISPR spacer
agtgccagcgcctcggacgcggccccga	Protospacer
***.********.**********  *

216. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044333 (Methylocystis parvus strain BRCS2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
tccgcggcggccggcgccgcgccgcgcgtttt	Protospacer
**.**************** ******* *

217. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034813 (Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
acgccggcggccagcgcctggccgcgcttgcg	Protospacer
 *  ********.***** *********** *

218. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.812

tctgcggcggccggcgccgggccg-cgcttggg	CRISPR spacer
cgtgcggctgccggagccgggccgccgcttcg-	Protospacer
. ****** ***** ********* ***** *

219. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

220. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

221. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

222. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

223. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

224. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

225. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

226. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

227. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

228. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

229. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggctggatgacgaggcgttcgatgccgcctat	Protospacer
*** ***** ***************** . .*

230. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP026529 (Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence) position: , mismatch: 6, identity: 0.812

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
gcagccctgatgacggccgaccactgggccgc	Protospacer
*******.*********** ***** * *..*

231. spacer 7.5|31123|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045549 (Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

tcgaccggcccgcgcccgtactcggccggcag-	CRISPR spacer
aagacccgcccgcgccggtactcgg-cggcggc	Protospacer
  **** ********* ******** ****.*

232. spacer 7.6|31184|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014599 (Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

gccgagctc---ctcgggaacctcttccgcgccct	CRISPR spacer
---gagatctcgctcggggacatcttccgcgccct	Protospacer
   *** **   ******.** *************

233. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 7, identity: 0.781

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
atgcccaggtccgcgccctggtcgatcaggaa	Protospacer
* *********** ******* *** * .*.*

234. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 7, identity: 0.781

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ggtgccgtccgtgaggccgcgttcgcaggcca	Protospacer
 ******************.*****  *. *

235. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.781

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ggtgccgtccgcgaggtcgtgttccccgcggt	Protospacer
 **********.****.*******  ** * *

236. spacer 1.9|9375|32|CP027025|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
atccacaccgagccgcgcacggcctcgacctt	Protospacer
* *  ***** ****** **********.* *

237. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 7, identity: 0.781

agcgccaccgcgccgcggacggcct-cgatcgt	CRISPR spacer
aaagcgaccgcgccgcggaccgcctccagtcg-	Protospacer
*. ** ************** **** *..***

238. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccgc	Protospacer
***** *********.*********  *.* .

239. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccgc	Protospacer
***** *********.*********  *.* .

240. spacer 1.10|9436|32|CP027025|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccgc	Protospacer
***** *********.*********  *.* .

241. spacer 1.10|9436|32|CP027025|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccacctcgtcgcccacagcgccgccgccgc	Protospacer
***** *********.*********  *.* .

242. spacer 1.10|9436|32|CP027025|CRT matches to KP966108 (Burkholderia phage vB_BceM_AP3, complete genome) position: , mismatch: 7, identity: 0.781

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ccccagctcgtcgcctccagcgcgcaagcgcc	Protospacer
**************** ******  .**. *.

243. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

-aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
tggcg-gtcgcggccgatctgcccgtactgct	Protospacer
 ..** **** *********** ******  *

244. spacer 1.14|9130|31|CP027025|CRISPRCasFinder matches to NZ_CP045377 (Sulfitobacter sp. THAF37 plasmid pTHAF37_e, complete sequence) position: , mismatch: 7, identity: 0.774

--gtagtcctcgaaggacagcagggtcgtggcg	CRISPR spacer
caccag--gtcgatggacagcagggttgtggcg	Protospacer
   .**   **** ************.******

245. spacer 1.15|9191|32|CP027025|CRISPRCasFinder matches to KY006853 (Erythrobacter phage vB_EliS_R6L, complete genome) position: , mismatch: 7, identity: 0.781

---gtccgtcttcgggtcgtcctcgaacacctccc	CRISPR spacer
cgggtcgg---tcgcgtcgtcctcgaacgcctccg	Protospacer
   *** *   *** *************.*****

246. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 7, identity: 0.774

cgtgccgtccgtgaggccgtgttc---gacgagc	CRISPR spacer
ggtgccgtccgggagggcgtgttcccacacg---	Protospacer
 ********** **** *******    ***

247. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to KC292024 (Halovirus HHTV-2, complete genome) position: , mismatch: 7, identity: 0.774

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
gtagccctccgtgaggccgtgttcgttgacc	Protospacer
   *** ****************** .** *

248. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.774

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ggtgccgtccgcgaggtcgtgttccccgcgg	Protospacer
 **********.****.*******  ** *

249. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
cgcgccactgcgcggcggacggcctcggcga	Protospacer
 *******.**** *************.. .

250. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcg	Protospacer
. *  * *** ***** **************

251. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

252. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

253. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
cgtgccaccgcgccgcggacggtctcctgcc	Protospacer
 *.*******************.***   *

254. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
ctcgccaccgcctcgcggacggcctcgccct	Protospacer
  ********* .************** .*

255. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

256. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

257. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

258. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcg	Protospacer
. *  * *** ***** **************

259. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccct	Protospacer
. ********* .************** .*

260. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcg	Protospacer
. *  * *** ***** **************

261. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacga	Protospacer
* * ********* ****** *******. .

262. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacga	Protospacer
* * ********* ****** *******. .

263. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacga	Protospacer
* * ********* ****** *******. .

264. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
atccacaccgagccgcgcacggcctcgacct	Protospacer
* *  ***** ****** **********.*

265. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
accgcgaccgcgccgcggaccgcctccagtc	Protospacer
* *** ************** ***** * .

266. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 7, identity: 0.774

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
agcgtcaccgcggcgcggacggcgaagggcg	Protospacer
****.******* **********   *. **

267. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.774

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
ctccagcttgtcgcctccagcgccgccgatc	Protospacer
*.******.******* ********  * .*

268. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gacgccaccgcgccgaggacggccaacg	Protospacer
..************* ********   .

269. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
gcggccaccgcgccggggacggcccgca	Protospacer
.  ************ ********.  *

270. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
ttgcccaccgcgcggcggacggcctggg	Protospacer
    ********* *********** *.

271. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
tcttccagcgcggcgcggacggcctcgg	Protospacer
  . *** **** **************.

272. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccagcgcgccgctgacggcaaaac	Protospacer
******* ******** ******   .

273. spacer 1.20|9377|28|CP027025|PILER-CR matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.75

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
agcgccagcgcgccgctgacggcaaaac	Protospacer
******* ******** ******   .

274. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgcccaga	Protospacer
.********* ** ********** ...

275. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

276. spacer 1.21|9438|28|CP027025|PILER-CR matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgcccaga	Protospacer
.********* ** ********** ...

277. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgcccaga	Protospacer
.********* ** ********** ...

278. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

279. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgcccaga	Protospacer
.********* ** ********** ...

280. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

281. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
tcccagctcgacggctacagcgcccaga	Protospacer
.********* ** ********** ...

282. spacer 1.21|9438|28|CP027025|PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
gaccagctcgtcgcctacggcgtcgtgc	Protospacer
  ****************.***.** .

283. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

284. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

285. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccagc	Protospacer
 ********* ** ********** ..

286. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

287. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

288. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccagc	Protospacer
 ********* ** ********** ..

289. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
gtccagcccgtcgcctgcagcgccgcgc	Protospacer
 .*****.********.******** .

290. spacer 1.21|9438|28|CP027025|PILER-CR matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.75

ccccagctcgtcgcctacagcgccggag	CRISPR spacer
acccagctcgacggctacagcgcccaga	Protospacer
 ********* ** ********** ...

291. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.781

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
gctcttgttcacgggtggtgctcctgggaggt	Protospacer
* *  .* *******.************ ***

292. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 7, identity: 0.781

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
gatgccggtcacgggcggggctcctcgcgggg	Protospacer
*.** ************* ****** *  **

293. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134469 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 27, complete sequence) position: , mismatch: 7, identity: 0.781

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
taccgggcggcgctggaggccggactcgacga	Protospacer
******.**************** *. . * *

294. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggcgaccgaccg	Protospacer
* .***.******************** .*

295. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggcgaccgaccg	Protospacer
* .***.******************** .*

296. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggcgaccgaccg	Protospacer
* .***.******************** .*

297. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 7, identity: 0.781

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
cgcaccagcgcctcgaacgcggcgacctcatt	Protospacer
 *.*********.**.************   *

298. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

agtaccagcgccccggacgcgg---cgacctgcat	CRISPR spacer
agtgccagcgcctcggacgcggccccgacgcg---	Protospacer
***.********.*********   **** .*

299. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tccaccagcgacccggacccggcgacga	Protospacer
  .******* ******* *******

300. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
caggccagcgcccgggacgcggtgaccg	Protospacer
 . .********* ********.****

301. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
cccgccagcgcgccggacgcgacgaccg	Protospacer
  ..******* *********.*****

302. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tcgaccagcgacccggacccggcgacga	Protospacer
   ******* ******* *******

303. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tcgaccagcgacccggacccggcgacga	Protospacer
   ******* ******* *******

304. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tcgaccagcgacccggacccggcgacga	Protospacer
   ******* ******* *******

305. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tcgaccagcgacccggacccggcgacga	Protospacer
   ******* ******* *******

306. spacer 2.7|18353|28|CP027025|PILER-CR matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.75

agtaccagcgccccggacgcggcgacct	CRISPR spacer
tcgaccagcgacccggacccggcgacga	Protospacer
   ******* ******* *******

307. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 7, identity: 0.781

gccgcagccgcccgcgcggcagg-----ccacggaga	CRISPR spacer
gccgcagtcgcccgcgaggcaggcgtatccac-----	Protospacer
*******.******** ******     ****

308. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
ggcgagcgcgcccgtgcggcaggcctcggaga	Protospacer
* ** .  ******.********** ******

309. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to CP000622 (Burkholderia phage phiE255, complete genome) position: , mismatch: 7, identity: 0.781

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gcgcaagcagcgcgcgcggcaggccacggcaa	Protospacer
**   *** ** ***************** .*

310. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NC_009237 (Burkholderia phage phiE255 chromosome, complete genome) position: , mismatch: 7, identity: 0.781

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gcgcaagcagcgcgcgcggcaggccacggcaa	Protospacer
**   *** ** ***************** .*

311. spacer 3.10|19158|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gagggcgtgtagctctcctcgaagggggtgcc----	CRISPR spacer
gagggcatgtagctctgctcgaa----atgccacag	Protospacer
******.********* ******    .****

312. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_018452 (Burkholderia phage DC1, complete genome) position: , mismatch: 7, identity: 0.781

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ggtgcggcggccggcgccgcgccgggctgctg	Protospacer
  ***************** **** ***   *

313. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gttgcggcggccggcgcctgggcgcgcgcggc	Protospacer
 .**************** ** ***** .**

314. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 7, identity: 0.781

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
tcagcggcggccggcgcctggccaggcattgc	Protospacer
** *************** ****. ** * *

315. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.781

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
tcagcggcggccggcgcctggccaggcattgc	Protospacer
** *************** ****. ** * *

316. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tctgcggcggccggcgccgggccg-cgcttggg	CRISPR spacer
gctgcgtcggccggcgccggtccgacgatccg-	Protospacer
 ***** ************* *** ** *. *

317. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 7, identity: 0.781

tctgcggcg-gccggcgccgggccgcgcttggg	CRISPR spacer
-cggttgtgtgccggtgccgggccgcgcatggg	Protospacer
 * *. *.* *****.************ ****

318. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 7, identity: 0.781

ggacgacgagcagggcgagcgtggaca-cggtg	CRISPR spacer
ggacggcgagcacggcgagcgtgaagagcagc-	Protospacer
*****.****** **********.* * *.*.

319. spacer 3.13|19341|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to MK059749 (Mycobacterium phage CRB2, complete genome) position: , mismatch: 7, identity: 0.781

acggcgtgcgtgcagtgtgcacagagcggaaa	CRISPR spacer
acggcgggcgtgcagtgggcacagatacgatc	Protospacer
****** ********** *******   **

320. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035512 (Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgggat-gtcgaggcgttcgatgccggtggt	CRISPR spacer
-ccgagttcgtcgaggcgatcgaagccggtggc	Protospacer
  **.* * ********* **** ********.

321. spacer 3.17|19585|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_029046 (Sinorhizobium phage phiLM21, complete genome) position: , mismatch: 7, identity: 0.781

gactcggag---aggatctccaggttgtcttcctt	CRISPR spacer
---ttgaagagcaggatcgccaggctgtcttcctt	Protospacer
   *.*.**   ****** *****.**********

322. spacer 3.18|19646|33|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013256 (Kocuria flava strain HO-9041 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.788

ttaactgttcccgttcgtagccgtaacggtccg	CRISPR spacer
tgaggtagtcccggtcgtagccgtaccggtccg	Protospacer
* *. *. ***** *********** *******

323. spacer 3.18|19646|33|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

ttaactgttcccgttcgtagccgtaacggtccg	CRISPR spacer
tgatgtagtcccggtcgtagccgtaagggtccg	Protospacer
* *  *. ***** ************ ******

324. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.781

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
gcgtcctcggcgacccgcaggcggcggagcgc	Protospacer
. ** ********.***************  .

325. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015216 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid e, complete sequence) position: , mismatch: 7, identity: 0.781

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
cgcagctcggcgatgcgcaggcggcggcggcg	Protospacer
 .  ********** ************ ***

326. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034650 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH29, complete sequence) position: , mismatch: 7, identity: 0.781

aagtgctc-ggcgatccgcaggcggcggaggct	CRISPR spacer
-agcgtgcgggcaatccgcaggcggcggtggcg	Protospacer
 **.*. * ***.*************** ***

327. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034652 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH14, complete sequence) position: , mismatch: 7, identity: 0.781

aagtgctc-ggcgatccgcaggcggcggaggct	CRISPR spacer
-agcgtgcgggcaatccgcaggcggcggtggcg	Protospacer
 **.*. * ***.*************** ***

328. spacer 4.2|28389|31|CP027025|CRT matches to NZ_CP020540 (Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence) position: , mismatch: 7, identity: 0.774

gagcggg---catcgtcggggccggggagcgtgt	CRISPR spacer
---cgcgcaccatcgtcggggccggtgagcgtcg	Protospacer
   ** *   *************** ******

329. spacer 4.2|28389|31|CP027025|CRT matches to NC_008741 (Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence) position: , mismatch: 7, identity: 0.774

gagcgggcatcgtcggggccggggagcgtgt	CRISPR spacer
gacggctcatcgtcggggctggcgagcgtga	Protospacer
**  *  ************.** *******

330. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP032697 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525a, complete sequence) position: , mismatch: 7, identity: 0.781

gcttcacgg---acccgccgagcaccattgttggc	CRISPR spacer
---tgaaggccaacccgccgaacaccgttgttggc	Protospacer
   * * **   *********.****.********

331. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 7, identity: 0.781

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
ggacgacccgcagcgtggccctgaccgatgcc	Protospacer
.*.  ****************** .******

332. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 7, identity: 0.781

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
ggacgacccgcagcgtggccctgaccgatgcc	Protospacer
.*.  ****************** .******

333. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP016292 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
ggacgacccgcagcgtggccctgaccgatgcc	Protospacer
.*.  ****************** .******

334. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
tcagcgcccgccgcgtggcccttctcgatgcg	Protospacer
  .*..***** ********** *********

335. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 7, identity: 0.781

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
cccgtacccgcagccgggccctgctcgacccg	Protospacer
   ***********  ************. **

336. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MK112543 (Mycobacterium Phage Kalb97, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

337. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MK967399 (Mycobacterium phage Groupthink, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

338. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MK310140 (Mycobacterium phage Gemma, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

339. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to KY965063 (Mycobacterium phage PurpleHaze, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

340. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MT657331 (Mycobacterium phage Manu, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

341. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MK494128 (Mycobacterium phage Heliosoles, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

342. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MH450124 (Mycobacterium phage Marius, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

343. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MH450126 (Mycobacterium phage PhishRPhriends, complete genome) position: , mismatch: 7, identity: 0.781

ttgaccagcaccttccggtcgttggt--ccggta	CRISPR spacer
ctgacgagcaccttcgggtcgttggcgaccga--	Protospacer
.**** ********* *********.  ***.

344. spacer 5.6|28939|32|CP027025|CRISPRCasFinder matches to NZ_CP049837 (Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence) position: , mismatch: 7, identity: 0.781

acggggccccggtacgaggtcggccaggtgcg	CRISPR spacer
ggcgggccccggtatgaggtcggcccggtgta	Protospacer
.  ***********.********** ****..

345. spacer 5.6|28939|32|CP027025|CRISPRCasFinder matches to NZ_CP043961 (Streptomyces tendae strain 139 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

acggggccccggtacgaggtcggccaggtgcg	CRISPR spacer
acggggccccggtacgacgtgggccacaccct	Protospacer
***************** ** ***** .. *

346. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 7, identity: 0.781

gacaccgtcaccaccttcatcgcgaacgtgca-	CRISPR spacer
cgcaccgtcaccaccgtcaccgcgatca-gcac	Protospacer
 .************* ***.***** *. ***

347. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 7, identity: 0.781

gccgcagccgcccgcgcggcagg-----ccacggagg	CRISPR spacer
gccgcagtcgcccgcgaggcaggcgtatccac-----	Protospacer
*******.******** ******     ****

348. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.781

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
gccatgaacacgctgatgaagatggtccttat	Protospacer
*** ************.******* * *. *.

349. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 7, identity: 0.781

ccacgccg--ccgcctggtcgccagggaagtcgc	CRISPR spacer
--ataccggcccacctggtcgccatggaagtcga	Protospacer
  *..***  **.*********** ********

350. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 7, identity: 0.781

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gtccgtccgccgacggcgatccggccggagcc	Protospacer
* * * ******* ********** *****..

351. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022420 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-5, complete sequence) position: , mismatch: 7, identity: 0.781

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gaagacccgccgagggcgatccggatcgagct	Protospacer
** .. *******************. ***.*

352. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP031599 (Roseovarius indicus strain DSM 26383 plasmid pRIdsm_01, complete sequence) position: , mismatch: 7, identity: 0.781

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gaagacccgccgagggcgatccggatcgagct	Protospacer
** .. *******************. ***.*

353. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP031600 (Roseovarius indicus strain DSM 26383 plasmid pRIdsm_02, complete sequence) position: , mismatch: 7, identity: 0.781

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gaagacccgccgagggcgatccggatcgagct	Protospacer
** .. *******************. ***.*

354. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP031601 (Roseovarius indicus strain DSM 26383 plasmid pRIdsm_03, complete sequence) position: , mismatch: 7, identity: 0.781

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gaagacccgccgagggcgatccggatcgagct	Protospacer
** .. *******************. ***.*

355. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP023712 (Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gcagccccgatgacggccgcccact-cgcctac	CRISPR spacer
gcagccccgatgaccaccgcccaccgcgtcgg-	Protospacer
************** .********. **.* .

356. spacer 7.6|31184|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006993 (Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence) position: , mismatch: 7, identity: 0.781

gccgagctcctcgggaacctcttccgcgccct	CRISPR spacer
gaccggcagctccggaacctcttcctcgccct	Protospacer
* * .**  *** ************ ******

357. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
gcgcacaggtgcgggccctggacgaacaccgc	Protospacer
. ** ***** ****************   *

358. spacer 1.1|8886|32|CP027025|CRT matches to MT723933 (Streptomyces phage Keanu, complete genome) position: , mismatch: 8, identity: 0.75

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
ttgcccaggaccgggccctggtcgaacggcca	Protospacer
  ******* *********** ***** .  *

359. spacer 1.1|8886|32|CP027025|CRT matches to MK411746 (Arthrobacter phage Sonali, complete genome) position: , mismatch: 8, identity: 0.75

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
tcgccgaggtccgggccctggccgaggaggga	Protospacer
  *** *************** ***.  .***

360. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

-aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
tggcg-gtcgcggccgatctgcccgtactgctg	Protospacer
 ..** **** *********** ******  *

361. spacer 1.5|9130|32|CP027025|CRT matches to NZ_CP045377 (Sulfitobacter sp. THAF37 plasmid pTHAF37_e, complete sequence) position: , mismatch: 8, identity: 0.75

--gtagtcctcgaaggacagcagggtcgtggcga	CRISPR spacer
caccag--gtcgatggacagcagggttgtggcgt	Protospacer
   .**   **** ************.******

362. spacer 1.8|9314|32|CP027025|CRT matches to MN871455 (UNVERIFIED: Pseudomonas phage Pa-B, complete genome) position: , mismatch: 8, identity: 0.75

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
cgtgccatcagtgaggccgtgttccggggtat	Protospacer
******.** ************** . *.  *

363. spacer 1.9|9375|32|CP027025|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
cgcgccactgcgcggcggacggcctcggcgag	Protospacer
 *******.**** *************.. .

364. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcgc	Protospacer
. *  * *** ***** **************.

365. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

366. spacer 1.9|9375|32|CP027025|CRT matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

367. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
cgtgccaccgcgccgcggacggtctcctgccc	Protospacer
 *.*******************.***   * .

368. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
ctcgccaccgcctcgcggacggcctcgccctc	Protospacer
  ********* .************** .* .

369. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

370. spacer 1.9|9375|32|CP027025|CRT matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

371. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

372. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacgac	Protospacer
* * ********* ****** *******. ..

373. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcgc	Protospacer
. *  * *** ***** **************.

374. spacer 1.9|9375|32|CP027025|CRT matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccgccaccgcctcgcggacggcctcgccctc	Protospacer
. ********* .************** .* .

375. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gcctgccccgggccgccgacggcctcgatcgc	Protospacer
. *  * *** ***** **************.

376. spacer 1.9|9375|32|CP027025|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacgac	Protospacer
* * ********* ****** *******. ..

377. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
acctccaccgcgcagcggaccgcctcgacgac	Protospacer
* * ********* ****** *******. ..

378. spacer 1.9|9375|32|CP027025|CRT matches to KY006853 (Erythrobacter phage vB_EliS_R6L, complete genome) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gcgaccgtcgcggcgcagacggcctcgatcgt	Protospacer
.  .**..**** ***.***************

379. spacer 1.9|9375|32|CP027025|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
agcgtcaccgcggcgcggacggcgaagggcgg	Protospacer
****.******* **********   *. **

380. spacer 1.9|9375|32|CP027025|CRT matches to NC_008537 (Arthrobacter sp. FB24 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

agcgccaccgcgccgcggacggcc-tcgatcgt	CRISPR spacer
cgcgcgaccgcgccgcggtcggccgttagacg-	Protospacer
 **** ************ ***** *... **

381. spacer 1.10|9436|32|CP027025|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.75

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgccgagcgcat	Protospacer
 ********* ** ***********..  * *

382. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.75

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgccgagcgcat	Protospacer
.********* ** ***********..  * *

383. spacer 1.10|9436|32|CP027025|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 8, identity: 0.75

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
ctccagcttgtcgcctccagcgccgccgatcg	Protospacer
*.******.******* ********  * .*

384. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 8, identity: 0.75

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccaaaacat	Protospacer
 ********* ** ********** .*. * *

385. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
gcgctgccgaggccgatctgcgagtactgga	Protospacer
.   **.*************** ***** *

386. spacer 1.14|9130|31|CP027025|CRISPRCasFinder matches to NC_049478 (Arthrobacter phage Mufasa8, complete genome) position: , mismatch: 8, identity: 0.742

gtagtcctcgaaggacagcagggtcgtggcg	CRISPR spacer
cgtgtcctcggtggacagcagggtcgcgcgg	Protospacer
   *******. **************.*  *

387. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to MN871455 (UNVERIFIED: Pseudomonas phage Pa-B, complete genome) position: , mismatch: 8, identity: 0.742

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
cgtgccatcagtgaggccgtgttccggggta	Protospacer
******.** ************** . *.

388. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
cacgccaccgcgctgcggacggccgcgcagc	Protospacer
 .***********.********** **

389. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
cctgccaccacggcgcggacggcctcgacgc	Protospacer
  .******.** ***************.

390. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
acttccaccgcgcagcggaccgcctcgacga	Protospacer
* . ********* ****** *******. .

391. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
tgaacgcccgcgccgcggacggcgccgatca	Protospacer
 * .*  **************** .*****.

392. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gctgccaccgcctcgcggacggcctcgccct	Protospacer
. .******** .************** .*

393. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
accgccagcgcgccgcggatggcctgaacaa	Protospacer
* ***** ***********.***** .*. .

394. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
acggccactgcgccgcggccggcctcaccct	Protospacer
*  *****.********* *******. .*

395. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
accctcaccccgccggggacggcctcgaggt	Protospacer
* * .**** ***** ************

396. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
aaagcgaccgcgccgcggaccgcctccagtc	Protospacer
*. ** ************** ***** * .

397. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP024312 (Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
ggcaagctcgcgccgcggacggtctagatcg	Protospacer
.**.   .**************.** *****

398. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gccccggccgcgtcgcggaaggcctcgatct	Protospacer
. * * .*****.****** **********

399. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.742

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgccgagcgca	Protospacer
 ********* ** ***********..  *

400. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.742

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgccgagcgca	Protospacer
.********* ** ***********..  *

401. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 8, identity: 0.742

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccaaaaca	Protospacer
 ********* ** ********** .*. *

402. spacer 1.20|9377|28|CP027025|PILER-CR matches to NC_047905 (Streptomyces phage Attoomi, complete genome) position: , mismatch: 8, identity: 0.714

agcgccaccgcgccgcggacggcctcga	CRISPR spacer
caggccaccgcgccccggacggcccacg	Protospacer
 . *********** *********.  .

403. spacer 2.2|18105|32|CP027025|CRISPRCasFinder,CRT matches to NC_024994 (Gluconacetobacter europaeus plasmid pGE2 genomic DNA, complete sequence, strain: KGMA0119) position: , mismatch: 8, identity: 0.75

acgcagctc------ctccaggccgggcctgacggcct	CRISPR spacer
------ctcgtatcgctccagtccggtcctgacggcct	Protospacer
      ***      ****** **** ***********

404. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

405. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP034911 (Ensifer alkalisoli strain YIC4027 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
gccacgctgagttcgaccacgagcagggtcgc	Protospacer
 .*  *.***** **** ************ *

406. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
ctctgctggagtacgacgacgaggatgaaaac	Protospacer
***** * *************** * *.   *

407. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

408. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

409. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

410. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

411. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

412. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

413. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

414. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

415. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

416. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

417. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 8, identity: 0.75

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
cgacggttgagtacgatgaagagcaggatatg	Protospacer
*  .************.** *******.* *

418. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.75

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
tatgcgcgggcgctggaggccgatccgaccct	Protospacer
**.  *  **************.*****.**

419. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to MN369748 (Mycobacterium phage Miko, complete genome) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tggttgagcgcctcggacacggcgacctgcaa	Protospacer
 *  . ******.*****.************

420. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

421. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

422. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgcaccggacgcggcgaccgaccg	Protospacer
* .***.**** *************** .*

423. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

424. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

425. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

426. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

427. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
accaccggcgccccggacgcggccaccgaccg	Protospacer
* .***.**************** *** .*

428. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022081 (Burkholderia cepacia strain FDAARGOS_345 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ttgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

429. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022081 (Burkholderia cepacia strain FDAARGOS_345 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

430. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP054606 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
cgcatcagcgcctcggacacggcgaccttggt	Protospacer
 *.*.*******.*****.*********  .*

431. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP023519 (Burkholderia cepacia strain FDAARGOS_388 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ttgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

432. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP023519 (Burkholderia cepacia strain FDAARGOS_388 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

433. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacc-tgcat	CRISPR spacer
caggccagcgcccgggacgcggtgaccgtgga-	Protospacer
 . .********* ********.**** ** *

434. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007745 (Burkholderia cepacia ATCC 25416 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ttgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

435. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007745 (Burkholderia cepacia ATCC 25416 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

436. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012984 (Burkholderia cepacia ATCC 25416 strain UCB 717 plasmid pBC25416) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ttgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

437. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012984 (Burkholderia cepacia ATCC 25416 strain UCB 717 plasmid pBC25416) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

438. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagc-gccccggacgcggcgacctgcat	CRISPR spacer
-ctgatggcggccccggacgaggcgaccttcat	Protospacer
  *. ..** ********** ******** ***

439. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
agatcgagcgccccggcctcggcgacctgtcg	Protospacer
**  * ********** * **********.

440. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP034556 (Burkholderia cepacia ATCC 25416 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

441. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP034556 (Burkholderia cepacia ATCC 25416 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ttgtg-cggcgccccggccgcgtcgacctgcgg	Protospacer
  **. *.********* **** ********.

442. spacer 2.7|18353|28|CP027025|PILER-CR matches to NC_048047 (Caulobacter phage CcrBL9, complete genome) position: , mismatch: 8, identity: 0.714

agtaccagcgccccggacgcggcgacct	CRISPR spacer
gccaccagcgcctcggacgcggcgtagg	Protospacer
. .*********.***********

443. spacer 3.1|18592|32|CP027025|CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 8, identity: 0.75

cgtcgggcggggtcactggcggactcccaacg	CRISPR spacer
cgccgggctgggtcactggcggactagatagc	Protospacer
**.***** ****************    *

444. spacer 3.1|18592|32|CP027025|CRISPRCasFinder,CRT matches to NC_031091 (Pseudomonas phage MD8, complete genome) position: , mismatch: 8, identity: 0.75

cgtcgggcggggtcactggcggactcccaacg	CRISPR spacer
cgccgggctgggtcactggcggactagatagc	Protospacer
**.***** ****************    *

445. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
ggggcaggcgcccgcgcggcaggccgcgatcc	Protospacer
*  **** *****************.**.

446. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gccgcagccgcccgcccggctggcggtcagga	Protospacer
*************** **** *** .. ..**

447. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
ctaccagccggccgcccggcaggccacgtgga	Protospacer
 .  ****** **** ************ .**

448. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_LR134453 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 11, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gacgggcaggcccgcgccgcaggcctcggaga	Protospacer
* ** .   ******** ******* ******

449. spacer 3.10|19158|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcgtgtagctctcctcgaagggggtgcc	CRISPR spacer
cagggcgtgtcgatctcctcgaaggcgaaggt	Protospacer
 ********* * ************ *. * .

450. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

451. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

452. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

453. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

454. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

455. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

456. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

457. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

458. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

459. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgacgggacgcgccatct	Protospacer
 *************** **** *****.

460. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ttgccggcggccagcgccgggccgagcttcca	Protospacer
*.  ********.*********** ****  .

461. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ttgccggcggccagcgccgggccgagcttcca	Protospacer
*.  ********.*********** ****  .

462. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to JX100810 (Caulobacter phage CcrColossus, complete genome) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
accttgccggccggcgccgcgccgcgcttgac	Protospacer
 *. .* ************ **********.

463. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
tggccgggggccggggccgggccgcgctgcgt	Protospacer
*   *** ****** *************  *

464. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
attccggcggccggcgccacgccgcgcatcgc	Protospacer
 .* **************. ******* * *

465. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
attccggcggccggcgccacgccgcgcatcgc	Protospacer
 .* **************. ******* * *

466. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

467. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

468. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

469. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

470. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

471. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

472. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

473. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

474. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

475. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

476. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

477. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

478. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031954 (Phaeobacter inhibens strain 2.10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg---	CRISPR spacer
cgcgcggcgggcggggccgggccgcg---gggctg	Protospacer
. .******* *** ***********   ***

479. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_018423 (Phaeobacter inhibens 2.10 plasmid pPGA2_95, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccgggccgcgcttggg---	CRISPR spacer
cgcgcggcgggcggggccgggccgcg---gggctg	Protospacer
. .******* *** ***********   ***

480. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

481. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 8, identity: 0.75

tctgcggcggccggcgccggg----ccgcgcttggg	CRISPR spacer
tctgcggcggccgccgccgcgcctaccacgtt----	Protospacer
************* ***** *    **.**.*

482. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
attcggcgagcaggtcgagcgtggaccggctg	Protospacer
.  **.******** ***********  * **

483. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
ggacggcgaggagggcgagcgtgagcgctttc	Protospacer
*****.**** ************..*.*  *

484. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to KC252997 (Halovirus PH1, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
cgacgatgagcaggacgagcgtggtctggagg	Protospacer
 *****.*******.********* *  *. *

485. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgggat-gtcgaggcgttcgatgccggtggt	CRISPR spacer
-acgctttggtcgaggcgttcgatgcccatggc	Protospacer
 .**   * ****************** .***.

486. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ggcgggaggtcgcggcgttcgattgaagtcct	Protospacer
******* **** **********   .**  *

487. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
ccgaccgcggcgatccgccggcggccgaggcc	Protospacer
  *  * *********** ****** *****.

488. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
ccgaccgcggcgatccgccggcggccgaggcc	Protospacer
  *  * *********** ****** *****.

489. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aagtgct----cggcgatccgcaggcggcggaggct	CRISPR spacer
----gctacgccggcgaaccgcaggaggcggagggc	Protospacer
    ***    ****** ******* ******** .

490. spacer 4.2|28389|31|CP027025|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.742

gagcgggcatcgtcggggccggggagcgtgt	CRISPR spacer
gcacgggcatcgtcgaggccggcgagcacca	Protospacer
* .************.****** ****..

491. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP030197 (Salmonella enterica strain SA20051401 plasmid pSA20051401.1, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

492. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP024864 (Escherichia coli strain AR_0015 plasmid unitig_2_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

493. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP030177 (Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.2, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

494. spacer 4.3|28449|32|CP027025|CRT matches to NC_011413 (Escherichia coli SE11 plasmid pSE11-2, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

495. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP030785 (Escherichia albertii strain 2012EL-1823B plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

496. spacer 4.3|28449|32|CP027025|CRT matches to CP054565 (Escherichia coli strain SCU-478 isolate rectal swab from healthy college student plasmid pSCU-478-1, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

497. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP032813 (Escherichia coli strain ERL03-1416 plasmid pERL03-1416-2, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

498. spacer 4.3|28449|32|CP027025|CRT matches to NZ_CP010201 (Escherichia coli strain M10 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

gcttcacggacccgccgagcaccattgttggc	CRISPR spacer
acgtcacggacccgctgtgcaccatttcctgc	Protospacer
.* ************.* ******** .. **

499. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to MN234228 (Mycobacterium phage Tourach, complete genome) position: , mismatch: 8, identity: 0.75

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
cgaaaacgcgcagcgtggccctcctcgatcag	Protospacer
 *.. ** ************** ******  *

500. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
agtacacccgcagcgtggccctggccgagcgg	Protospacer
** ..****************** .***   *

501. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP024425 (Paracoccus yeei strain TT13 plasmid pTT13-3, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
ttaaggacgtgcaggtagcgcagtcgaacctg	Protospacer
. .  ***********.**********.** *

502. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP022992 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN2, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
aagccgacatgcaggtggcgcagacgcctcag	Protospacer
 .******.************** **  .*.*

503. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgacgtgcaggtggcgcag----tcgagccgg	CRISPR spacer
cggtctacgtgcaggtggcgcagggcctcacg----	Protospacer
***.* *****************    **. *

504. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP046255 (Sphingobium sp. CAP-1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

--cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
tcctgct--cgtgcaggtggcgcggtcgatcctt	Protospacer
  * **.  **************.***** **

505. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP046255 (Sphingobium sp. CAP-1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

--cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
tcctgct--cgtgcaggtggcgcggtcgatcctt	Protospacer
  * **.  **************.***** **

506. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NZ_CP009431 (Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgacgtgcaggtggcgcagtcgagccgg--	CRISPR spacer
cggcggacgtgcaggtggcacag--ggggtgatt	Protospacer
**** **************.***  *.* .*.

507. spacer 5.4|28817|32|CP027025|CRISPRCasFinder matches to MK450421 (Streptomyces phage Vash, complete genome) position: , mismatch: 8, identity: 0.75

ttgaccagcaccttccggtcgttggtc-cggta	CRISPR spacer
tcttccagcaccttccgcgcgttggtcaccat-	Protospacer
*.  *************  ******** * .*

508. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 8, identity: 0.75

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
gcttccaccgtcgacgacgcggacttcacgaa	Protospacer
*.. *************** ** ****** .

509. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
gagatcgtcgtcgacgacgggaccgtcaccgg	Protospacer
*  *.*..*************.** ******

510. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
aacatcgaagtcgacgacggaaccttcaccgc	Protospacer
. **.*.  ***********..**********

511. spacer 5.8|29061|32|CP027025|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.75

gccgacatggagaagatggacttcccctcgat--	CRISPR spacer
cacgacccggagaagatggactt--cctcggccg	Protospacer
  **** .***************  *****..

512. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 8, identity: 0.75

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
gacaccggcaacaccttcatcgccggccagga	Protospacer
******* ** ************ ..*  * *

513. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 8, identity: 0.75

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
gacaccggcaacaccttcatcgccggccagga	Protospacer
******* ** ************ ..*  * *

514. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
ggggcaggcgcccgcgcggcaggccgcgatcc	Protospacer
*  **** *****************.**.

515. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP021409 (Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
ctgcccgacgcccgcgcggcaggccgcgcagg	Protospacer
 .  * * *****************.** ***

516. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cccgcagccgcccccgccgcaggccggcgccg	Protospacer
 ************ *** *******.  *  *

517. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP015043 (Rhodovulum sp. P5 plasmid pRGUI04, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gccgcggccgcccgcgcggcgggcgtcttctg	Protospacer
*****.**************.***  *    *

518. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to CP000622 (Burkholderia phage phiE255, complete genome) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gcgcaagcagcgcgcgcggcaggccacggcaa	Protospacer
**   *** ** ***************** ..

519. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NC_009237 (Burkholderia phage phiE255 chromosome, complete genome) position: , mismatch: 8, identity: 0.75

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gcgcaagcagcgcgcgcggcaggccacggcaa	Protospacer
**   *** ** ***************** ..

520. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to MN693615 (Marine virus AFVG_250M1187, complete genome) position: , mismatch: 8, identity: 0.75

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ttgtaccgtgaccacctgccccaccaccacct	Protospacer
..*. ***** ******* *********.* *

521. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to MN694069 (Marine virus AFVG_250M891, complete genome) position: , mismatch: 8, identity: 0.75

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ttgtaccgtgaccacctgccccaccaccacct	Protospacer
..*. ***** ******* *********.* *

522. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to MN694089 (Marine virus AFVG_250M217, complete genome) position: , mismatch: 8, identity: 0.75

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ttgtaccgtgaccacctgccccaccaccacct	Protospacer
..*. ***** ******* *********.* *

523. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to MN694653 (Marine virus AFVG_250M216, complete genome) position: , mismatch: 8, identity: 0.75

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ttgtaccgtgaccacctgccccaccaccacct	Protospacer
..*. ***** ******* *********.* *

524. spacer 6.1|30573|31|CP027025|PILER-CR matches to NZ_CP033726 (Clavibacter michiganensis subsp. michiganensis strain UF1 plasmid pCM2U-F1, complete sequence) position: , mismatch: 8, identity: 0.742

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
ccatcaccgtccggaccgcccgcgagcacct	Protospacer
 **************.* ********    .

525. spacer 6.1|30573|31|CP027025|PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
ggctgacggtccggatctcccccgaggcgta	Protospacer
.  * ** ************* *******

526. spacer 6.1|30573|31|CP027025|PILER-CR matches to NZ_CP029836 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.742

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
caatcaccgtccggatctcctgcgggcagta	Protospacer
  ******************.***.*  *

527. spacer 6.1|30573|31|CP027025|PILER-CR matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
ggctgacggtccggatctcccccgaggcgta	Protospacer
.  * ** ************* *******

528. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

529. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

530. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

531. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

532. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

533. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
tcatccggaagacgacggtcggcaggtcgta	Protospacer
*  ... ********* **** *********

534. spacer 6.2|30634|31|CP027025|PILER-CR matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 8, identity: 0.742

tgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
acctttcgaagacgcccggcgccaggtgatc	Protospacer
  *.********** *** ******** .*

535. spacer 6.3|30572|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP033726 (Clavibacter michiganensis subsp. michiganensis strain UF1 plasmid pCM2U-F1, complete sequence) position: , mismatch: 8, identity: 0.75

gacatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
gccatcaccgtccggaccgcccgcgagcacct	Protospacer
* **************.* ********    .

536. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021374 (Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence) position: , mismatch: 8, identity: 0.75

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
tagttgaacacggtgacgaagatgctggttag	Protospacer
   ********* ************** . *

537. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
ggagcaagcacgctgacgaagatcttgccgac	Protospacer
*   ..*.*************** .*******

538. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
ggagcaagcacgctgacgaagatcttgccgac	Protospacer
*   ..*.*************** .*******

539. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to MH047631 (Microbacterium phage Triscuit, complete genome) position: , mismatch: 8, identity: 0.75

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
ctggttaccacgctgactgagatgctgccgac	Protospacer
 .  * * ********* .*************

540. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to LN997844 (Streptomyces reticuli genome assembly TUE45, plasmid : III) position: , mismatch: 8, identity: 0.75

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
gcccgccgccgccaggccgccagggaagaaca	Protospacer
 * ********** **.***********

541. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP048398 (Streptomyces sp. S4.7 plasmid pSSPS4.7a, complete sequence) position: , mismatch: 8, identity: 0.75

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gccgcaccgccgagggcgatgaggacggcgag	Protospacer
* *. ***************  ****** *

542. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 8, identity: 0.75

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
agaagaccggcgagggcgatcaggaccggggt	Protospacer
.. ****** *********** **** *.* *

543. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 8, identity: 0.75

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
gtcgccgcgatgacggccgccccctcggggcc	Protospacer
*. *** *************** ****    *

544. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 8, identity: 0.75

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
gtcgccgcgatgacggccgccccctcggggcc	Protospacer
*. *** *************** ****    *

545. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
ggctcgccaatgccggccgcccactcgccggc	Protospacer
*   * **.*** **************** .*

546. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 8, identity: 0.75

gcagccccgatgacggccgcccactcgcctac---	CRISPR spacer
gcaaccccgaggacggccgccca---gaccagacg	Protospacer
***.****** ************   * *.*

547. spacer 7.5|31123|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045412 (Roseovarius sp. THAF8 plasmid pTHAF8_b, complete sequence) position: , mismatch: 8, identity: 0.75

--tcgaccggcccgcgcccgtactcggccggcag	CRISPR spacer
ggacga--agcgcgcgcccgtactcggccagccc	Protospacer
   ***  .** *****************.**

548. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to KY210139 (Xanthomonas phage KPhi1, complete genome) position: , mismatch: 8, identity: 0.75

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
atcttgcgctgccggtccttgcggcctagcga	Protospacer
.****** *****.************.   *

549. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to MN908685 (Microbacterium phage PauloDiaboli, complete genome) position: , mismatch: 8, identity: 0.75

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
gtcttgccctgcgcgtccttgcgggcgtcacg	Protospacer
************  ********** * *..

550. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.75

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
cgcatgtcctgcccgtccttgcggcccgcgga	Protospacer
  * **.****** ************* .**

551. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.719

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
gcgcccaggtcctcgccctggacgatgacggc	Protospacer
. **********  ***********    **

552. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
ggatccgcctccgggccccgcacgaaccagga	Protospacer
....**.  *********.* ***********

553. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 9, identity: 0.719

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
ggatccgcctccgggccccgcacgaaccagga	Protospacer
....**.  *********.* ***********

554. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 9, identity: 0.719

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
ggatccgcctccgggccccgcacgaaccagga	Protospacer
....**.  *********.* ***********

555. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
gcgctgccgaggccgatctgcgagtactggaa	Protospacer
.   **.*************** ***** *

556. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.719

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
gtcgtgccgaggccgatctgctcgtggatcat	Protospacer
. ****.************** ***.  *  *

557. spacer 1.5|9130|32|CP027025|CRT matches to NC_049478 (Arthrobacter phage Mufasa8, complete genome) position: , mismatch: 9, identity: 0.719

gtagtcctcgaaggacagcagggtcgtggcga	CRISPR spacer
cgtgtcctcggtggacagcagggtcgcgcggg	Protospacer
   *******. **************.*  *.

558. spacer 1.8|9314|32|CP027025|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 9, identity: 0.719

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ggtgccgtccgggagggcgtgttcccacacgt	Protospacer
 ********** **** *******    *  *

559. spacer 1.8|9314|32|CP027025|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
gatctgatccgtgacgccgtgctcgacgaggt	Protospacer
 .* . .******* ******.******** *

560. spacer 1.9|9375|32|CP027025|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
cctgccaccacggcgcggacggcctcgacgcg	Protospacer
  .******.** ***************.

561. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
tgaacgcccgcgccgcggacggcgccgatcaa	Protospacer
 * .*  **************** .*****.

562. spacer 1.9|9375|32|CP027025|CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gctgccaccgcctcgcggacggcctcgccctc	Protospacer
. .******** .************** .* .

563. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
acttccaccgcgcagcggaccgcctcgacgac	Protospacer
* . ********* ****** *******. ..

564. spacer 1.9|9375|32|CP027025|CRT matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
ctggccaccgcgctgctgacggcctcggcgat	Protospacer
   **********.** **********.. .*

565. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
accgccagcgcgccgcggatggcctgaacaac	Protospacer
* ***** ***********.***** .*. ..

566. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
acggccactgcgccgcggccggcctcaccctc	Protospacer
*  *****.********* *******. .* .

567. spacer 1.9|9375|32|CP027025|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
accctcaccccgccggggacggcctcgaggta	Protospacer
* * .**** ***** ************

568. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP024312 (Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
ggcaagctcgcgccgcggacggtctagatcga	Protospacer
.**.   .**************.** *****

569. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gccccggccgcgtcgcggaaggcctcgatctc	Protospacer
. * * .*****.****** ********** .

570. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgcccagaacat	Protospacer
.********* ** ********** ... * *

571. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

572. spacer 1.10|9436|32|CP027025|CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgcccagaacat	Protospacer
.********* ** ********** ... * *

573. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgcccagaacat	Protospacer
.********* ** ********** ... * *

574. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

575. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgcccagaacat	Protospacer
.********* ** ********** ... * *

576. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

577. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
tcccagctcgacggctacagcgcccagaacat	Protospacer
.********* ** ********** ... * *

578. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

579. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

580. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagcgcat	Protospacer
 ********* ** ********** ..  * *

581. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

582. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

583. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagcgcat	Protospacer
 ********* ** ********** ..  * *

584. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.719

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
acccagctcgacggctacagcgcccagaacat	Protospacer
 ********* ** ********** ... * *

585. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 9, identity: 0.71

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
ttattgtggagcccgatctgcgcgtaccagg	Protospacer
    *** *** ***************. *

586. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.71

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
gtcgtgccgaggccgatctgctcgtggatca	Protospacer
. ****.************** ***.  *

587. spacer 1.13|9069|31|CP027025|CRISPRCasFinder matches to NZ_AP015030 (Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence) position: , mismatch: 9, identity: 0.71

gtgtcgccaagcgagaggcgcgtcgtgatgg	CRISPR spacer
ttcatcccaatcgagaggcgcatcgtgattc	Protospacer
 *  . **** **********.*******

588. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.71

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttgctcgtccttgaggccgtgttcggcgaca	Protospacer
.   .***** **************.***

589. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 9, identity: 0.71

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ctgctcgtccttgaggccgtgttcggcggca	Protospacer
*   .***** **************.**.

590. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 9, identity: 0.71

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
gatctgatccgtgacgccgtgctcgacgagg	Protospacer
 .* . .******* ******.********

591. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gacgccaccgcgccgaggacggccaacgcgg	Protospacer
..************* ********   .. *

592. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gggaaatccgcgccacgggcggcctcgatca	Protospacer
.* .   *******.***.***********.

593. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gggaaatccgcgccacgggcggcctcgatca	Protospacer
.* .   *******.***.***********.

594. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
ctggccaccgcgctgctgacggcctcggcga	Protospacer
   **********.** **********.. .

595. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
tgcgccagcgcgccgaggacggccatgccga	Protospacer
 ****** ******* ******** .* . .

596. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
agcgccagcgcgccgctgacggcaaaaccgg	Protospacer
******* ******** ******   . . *

597. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NC_008537 (Arthrobacter sp. FB24 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
cgcgcgaccgcgccgcggtcggccgttagac	Protospacer
 **** ************ ***** . *

598. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
tcttccagcgcggcgcggacggcctcggtga	Protospacer
  . *** **** **************.* .

599. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
agcgccagcgcgccgctgacggcaaaaccgg	Protospacer
******* ******** ******   . . *

600. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
ccctgcaccgcgccgcgcacggccccgacgc	Protospacer
  *  ************ ******.***.

601. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgcccagaaca	Protospacer
.********* ** ********** ... *

602. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

603. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgcccagaaca	Protospacer
.********* ** ********** ... *

604. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgcccagaaca	Protospacer
.********* ** ********** ... *

605. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

606. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgcccagaaca	Protospacer
.********* ** ********** ... *

607. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

608. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
tcccagctcgacggctacagcgcccagaaca	Protospacer
.********* ** ********** ... *

609. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

610. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

611. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagcgca	Protospacer
 ********* ** ********** ..  *

612. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

613. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

614. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagcgca	Protospacer
 ********* ** ********** ..  *

615. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
gtccagcccgtcgcctgcagcgccgcgccca	Protospacer
 .*****.********.******** . .*

616. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.71

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
acccagctcgacggctacagcgcccagaaca	Protospacer
 ********* ** ********** ... *

617. spacer 2.1|18044|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015221 (Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggtgacggtcacgggcggtgctcctgggcggt	CRISPR spacer
tgtgatggtcacggtcggtgctcctttgtccg	Protospacer
 ****.******** **********  *.

618. spacer 2.2|18105|32|CP027025|CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 9, identity: 0.719

acgcagctcctccaggccgggcctgacggcct	CRISPR spacer
aatcagctccgccacgccgggcctgaggctga	Protospacer
*  ******* *** *********** * .

619. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
tctccgatgagtacgacgacgagcagcgcctg	Protospacer
.... * ******************* *.**

620. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to MN369741 (Mycobacterium phage LoneWolf, complete genome) position: , mismatch: 9, identity: 0.719

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
ctctggtcgagtacgccgacgagttcaagttc	Protospacer
*******.******* *******.  .. .**

621. spacer 2.4|18227|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

ggatcgcgccgtcacatgcgggtgggcggctt	CRISPR spacer
acccgccgccttcagatgcgggtgggcggctg	Protospacer
.  .  **** *** ****************

622. spacer 2.4|18227|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ggatcgcgccgtcacatgcgggtgggcggctt	CRISPR spacer
acccgccgccttcagatgcgggtgggcggctg	Protospacer
.  .  **** *** ****************

623. spacer 2.4|18227|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 9, identity: 0.719

ggatcgcgccgtcacatgcgggtgggcggctt	CRISPR spacer
acccgccgccttcagatgcgggtgggcggctg	Protospacer
.  .  **** *** ****************

624. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
taccgggcggcgcgggaggccggactgcgggt	Protospacer
******.****** ********* *.*

625. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ccctcgcgcgccccggacccggcgaccagcac	Protospacer
  . *  *********** ******** ***.

626. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 9, identity: 0.719

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
ggcaccagcgccctggacgtggcgacggacga	Protospacer
.*.**********.*****.******  .*.

627. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
acggtgagcgccccggccgcggcgccctgggt	Protospacer
*  .. ********** ******* **** .*

628. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
acggtgagcgccccggccgcggcgccctgggt	Protospacer
*  .. ********** ******* **** .*

629. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
cgggatcgaagccgcgcgccaccgccagccgg	Protospacer
* . *.   ***  ******************

630. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.719

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
cgggatcgaagccgcgcgccaccgccagccgg	Protospacer
* . *.   ***  ******************

631. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
agctgggccagcgtcgcgccgccgcccgccgc	Protospacer
   *. *.************.***** ****

632. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
agctgggccagcgtcgcgccgccgcccgccgc	Protospacer
   *. *.************.***** ****

633. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
agctgggccagcgtcgcgccgccgcccgccgc	Protospacer
   *. *.************.***** ****

634. spacer 3.5|18865|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 9, identity: 0.719

ctcaggtccaccgacaacttcgcggccgacac	CRISPR spacer
cagaccaccaccgacaacatcccggccgaccg	Protospacer
*  *   *********** ** ********

635. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cccgcagccgcccccgccgcaggccggcgccg	Protospacer
 ************ *** *******.  *  .

636. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015043 (Rhodovulum sp. P5 plasmid pRGUI04, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
gccgcggccgcccgcgcggcgggcgtcttctg	Protospacer
*****.**************.***  *    .

637. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021409 (Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
ctgcccgacgcccgcgcggcaggccgcgcagg	Protospacer
 .  * * *****************.** **.

638. spacer 3.7|18987|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cttttcaggaggctggaggcgcgcaacgcgtc	CRISPR spacer
ccgcccgtcaggcggcaggcgcgcaacgcgtc	Protospacer
*. ..*.  **** * ****************

639. spacer 3.8|19048|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP017043 (Selenomonas sp. oral taxon 920 strain W5150 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cgcgtttgccccttgcagccccgattcatccg	CRISPR spacer
gggcgttgccccctgcacccccgattcaagca	Protospacer
 *   *******.**** **********  *.

640. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgcctggacgatgacggc	Protospacer
 ***************** ** **    .**

641. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gctgcggcggccggcgcctggacgatgacggt	Protospacer
 ***************** ** **    .**

642. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ccggcggcgtccggcgccgtgccgcgcaccac	Protospacer
.* ****** ********* ******* . .

643. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ggcgcggcggtcggcgccgggacgcgcaacga	Protospacer
  .*******.********** *****   *.

644. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_015951 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
agcgtgccggccggggcctggccgcgcttgat	Protospacer
  .*.* ******* *** ***********.

645. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ctggcggccgccggcgccgtgccgcgagtcga	Protospacer
.. ***** ********** ******  * *.

646. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ctttcggccgccggcgccgggccgagccttac	Protospacer
..* **** *************** **.* .

647. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 9, identity: 0.719

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gcggcagcagccggcgccgggccgcgagatag	Protospacer
 * **.**.*****************    .*

648. spacer 3.12|19280|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010408 (Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagcagggcgagcgtggacacggtg	CRISPR spacer
aggaggagagcaggccgagggtggacacggcc	Protospacer
.*. *. ******* **** **********.

649. spacer 3.14|19402|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016618 (Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

ccggtcttcgacagtctggggaacacgacgtg	CRISPR spacer
ccggtctgcgacaggctggggaagagctggga	Protospacer
******* ****** ******** *    * .

650. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgggatgtcgaggcgttcgatgccggtggt-	CRISPR spacer
atatggatgtcgaagcgatcgatgcc-gcgctg	Protospacer
.   *********.*** ******** *.* *

651. spacer 3.17|19585|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_014840 (Pantoea sp. At-9b plasmid pPAT9B03, complete sequence) position: , mismatch: 9, identity: 0.719

gactcggagaggatctccaggttgtcttcctt	CRISPR spacer
gcatttccgaggatctccaggttgtactcctg	Protospacer
*  *.   ***************** .****

652. spacer 3.19|19708|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013109 (Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcccagccggagggcagactcgtcgtgaa	CRISPR spacer
gctcttcagccggagggccgcctcgtcgtcct	Protospacer
**....************ * ********

653. spacer 3.19|19708|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013053 (Sinorhizobium americanum CCGM7 plasmid B, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcccagccggagggcagactcgtcgtgaa	CRISPR spacer
gctcttcagccggagggccgcctcgtcgtcct	Protospacer
**....************ * ********

654. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017303 (Rhodococcus sp. YL-1 plasmid pYLL1 sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
aagtgctcgtcgatcctcaggcggcatccaac	Protospacer
********* ****** ********.   . .

655. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgccggctggcgatccgctggcggcggaggcg	Protospacer
 . .* ..********** ************

656. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

657. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

658. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

659. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

660. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

661. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

662. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

663. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

664. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

665. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

666. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

667. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

668. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

669. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
tgatgatcggcgttccgcaggcggcggcctcg	Protospacer
 ..** ****** **************   *

670. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to CP000663 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence) position: , mismatch: 9, identity: 0.719

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
cgaagccgggcgatccgcaggtggccgaggcg	Protospacer
 .. **. *************.*** *****

671. spacer 4.1|28330|30|CP027025|CRT matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

agcggtggtcgcgttccatatggccaccgt	CRISPR spacer
gaacgtggtcgcgttcaatatggcctatct	Protospacer
..  ************ ********  . *

672. spacer 4.1|28330|30|CP027025|CRT matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 9, identity: 0.7

agcggtggtcgcgttccatatggccaccgt	CRISPR spacer
gaacgtggtcgcgttcaatatggcctatct	Protospacer
..  ************ ********  . *

673. spacer 4.1|28330|30|CP027025|CRT matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

agcggtggtcgcgttccatatggccaccgt	CRISPR spacer
gaacgtggtcgcgttcaatatggcctatct	Protospacer
..  ************ ********  . *

674. spacer 4.2|28389|31|CP027025|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.71

gagcgggcatcgtcggggccggggagcgtgt	CRISPR spacer
cgcggggcatcgtcggggcgggcgagctttc	Protospacer
 .  *************** ** **** * .

675. spacer 4.2|28389|31|CP027025|CRT matches to NZ_CP036407 (Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence) position: , mismatch: 9, identity: 0.71

gagcgggcatcgtcggggccggggagcgtgt	CRISPR spacer
ggattggcatcgtctgggcgggggagcggcg	Protospacer
*... ********* **** ********

676. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NC_011879 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence) position: , mismatch: 9, identity: 0.719

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
ggatgacccgcagcgcggccctgcccgagaca	Protospacer
.*.  **********.********.*** .*.

677. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to NC_015951 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
cggccgacgtgcatgcggcgcaggtccgggga	Protospacer
************* *.******* .  *  *.

678. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to MH588547 (Caulobacter phage CcrSC, complete genome) position: , mismatch: 9, identity: 0.719

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
acgccgccatgcaggtggcgcagtcgcagatg	Protospacer
  **** *.***************** .   *

679. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to CP003958 (Rhodococcus opacus PD630 plasmid 9, complete sequence) position: , mismatch: 9, identity: 0.719

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
cttggtgccgtcgacgaccgggccgtcaccga	Protospacer
 *.. ..*********** ***** ******

680. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to CP003952 (Rhodococcus opacus PD630 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
cttggtgccgtcgacgaccgggccgtcaccga	Protospacer
 *.. ..*********** ***** ******

681. spacer 5.6|28939|32|CP027025|CRISPRCasFinder matches to NZ_CP049837 (Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence) position: , mismatch: 9, identity: 0.719

acggggccccggtacgaggtcggccaggtgcg	CRISPR spacer
ggccgaccccggtatgaggtcggcccggtgta	Protospacer
.   *.********.********** ****..

682. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP015204 (Rhodococcus sp. 008 plasmid pR8C1, complete sequence) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
cgcaccgtcaccacctgcaccgcgaaccccag	Protospacer
 .************** **.******* .  .

683. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NC_007486 (Rhodococcus erythropolis PR4 plasmid pREC1, complete sequence) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
cgcaccgtcaccacctgcaccgcgaaccccag	Protospacer
 .************** **.******* .  .

684. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
cgcaccgtcaccacctgcaccgcgaaccccag	Protospacer
 .************** **.******* .  .

685. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
cgcaccgtcaccacctgcaccgcgaaccccag	Protospacer
 .************** **.******* .  .

686. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MT024862 (Microbacterium phage Alakazam, complete genome) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
tacaccgtcaccacgttcagcgcgctgggggc	Protospacer
 ************* **** ****   * *

687. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MN586028 (Gordonia phage MelBins, complete genome) position: , mismatch: 9, identity: 0.719

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
cgcaccatcaccaccctcatcgcgaccacgtt	Protospacer
 .****.********.********* *..*.

688. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to AP014315 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C66, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.719

-----ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
ccacatcc-----atcgacgacaaaattgttctcgaa	Protospacer
     *.*     *********.**** ********

689. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gccgcagccgcccgcccggctggcggtcagga	Protospacer
*************** **** *** .. ..*.

690. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
ctaccagccggccgcccggcaggccacgtgga	Protospacer
 .  ****** **** ************ .*.

691. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
gccgcagccgcgctcgcggcaggacttcatcg	Protospacer
*********** * ********* * . .  *

692. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ttcgacggcgtccaccaggcccagcaccgcgt	Protospacer
..   * *.******* ****** ********

693. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 9, identity: 0.719

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
gatccccgtgtccacctcgcccagcaggtcgc	Protospacer
   ************** ***** **   **.

694. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to NZ_CP023713 (Rhodococcus ruber strain YC-YT1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
caccggcgtgtccacctgacccacctccggcg	Protospacer
*  *  ************.****** ***

695. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to KY653127 (Corynebacterium phage IME1320_01, complete genome) position: , mismatch: 9, identity: 0.719

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
gaccgacatgtccacctggcccaccagctcgc	Protospacer
   *  *.****************** * **.

696. spacer 6.1|30573|31|CP027025|PILER-CR matches to NZ_LT984809 (Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence) position: , mismatch: 9, identity: 0.71

acatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
tcatcaccggccggatctcgcgcggtggtcg	Protospacer
 ******** ********* ****. *

697. spacer 6.3|30572|32|CP027025|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

gacatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
cggctgacggtccggatctcccccgaggcgta	Protospacer
 .  * ** ************* *******

698. spacer 6.3|30572|32|CP027025|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

gacatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
cggctgacggtccggatctcccccgaggcgta	Protospacer
 .  * ** ************* *******

699. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

700. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

701. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

702. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

703. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

704. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
ctcatccggaagacgacggtcggcaggtcgta	Protospacer
.*  ... ********* **** *********

705. spacer 6.4|30633|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccttcgaagacgaccgtcgccaggtcgta	CRISPR spacer
cacctttcgaagacgcccggcgccaggtgatc	Protospacer
.  *.********** *** ******** .*

706. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
gcgggccgccgccgggtcgcccgggaacacat	Protospacer
 *. ********* ******* *****  *..

707. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

708. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

709. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

710. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

711. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

712. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
cagcagagccgcctggtcgccgaggaagtctg	Protospacer
* .*.  **************..*******

713. spacer 7.1|30879|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccacgccgccgcctggtcgccagggaagtcgc	CRISPR spacer
ttccggcgccgccgggtcgccagggatgctgg	Protospacer
.. ** ******* ************ *..*

714. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021919 (Sagittula sp. P11 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
agaagaccgccgagggcgatctggccgggacc	Protospacer
.. ******************.** ***....

715. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

716. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

717. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

718. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

719. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

720. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

721. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

722. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

723. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

724. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

725. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

726. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

727. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

728. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

729. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

730. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

731. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

732. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

733. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

734. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

735. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

736. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

737. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

738. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

739. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

740. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

741. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
gacggcccgccgagggcgatccgcgcctcgcg	Protospacer
***.* ***************** .*   *.

742. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 9, identity: 0.719

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
acacggccgacgacgggcgcccactcgccccg	Protospacer
.**   ****.***** ************.

743. spacer 7.5|31123|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

tcgaccggcccgcgcccgtactcggccggcag	CRISPR spacer
aggaagagcccgcgcccgtgctcggcccgcgc	Protospacer
  **  .************.******* **.

744. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
cgctcctgctgccagaccttgcggccattggg	Protospacer
  **. . ******* ********** ****

745. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
cgctcctgctgccagaccttgcggccattggg	Protospacer
  **. . ******* ********** ****

746. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NZ_CP054030 (Rhizobium sp. JKLM19E plasmid pPR19E03) position: , mismatch: 9, identity: 0.719

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
gtcttgtcctgccagcccttgcgcacggccgg	Protospacer
******.********.*******  *  . *

747. spacer 8.2|31782|32|CP027025|CRISPRCasFinder matches to NZ_CP042264 (Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

agcggttccgcgcccatctcgaagttggacag	CRISPR spacer
cgcggttccgcgcgcttctcgaaggcgtcgtg	Protospacer
 ************ * ******** .*    *

748. spacer 8.2|31782|32|CP027025|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 9, identity: 0.719

agcggttccgcgcccatctcgaagttggacag	CRISPR spacer
aacggatcagcgcccatctcgaagtcctgcgc	Protospacer
*.*** ** ****************.  .*.

749. spacer 8.2|31782|32|CP027025|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 9, identity: 0.719

agcggttccgcgcccatctcgaagttggacag	CRISPR spacer
aacggatcagcgcccatctcgaagtcctgcgc	Protospacer
*.*** ** ****************.  .*.

750. spacer 1.3|9008|32|CP027025|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 10, identity: 0.688

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
ttattgtggagcccgatctgcgcgtaccagga	Protospacer
    *** *** ***************. *

751. spacer 1.4|9069|32|CP027025|CRT matches to NZ_AP015030 (Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcgccaagcgagaggcgcgtcgtgatggc	CRISPR spacer
ttcatcccaatcgagaggcgcatcgtgattca	Protospacer
 *  . **** **********.*******

752. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 10, identity: 0.688

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttgctcgtccttgaggccgtgttcggcgacaa	Protospacer
.   .***** **************.***

753. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 10, identity: 0.688

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ctgctcgtccttgaggccgtgttcggcggcaa	Protospacer
*   .***** **************.**.

754. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gggaaatccgcgccacgggcggcctcgatcag	Protospacer
.* .   *******.***.***********.

755. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gggaaatccgcgccacgggcggcctcgatcag	Protospacer
.* .   *******.***.***********.

756. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
tgcgccagcgcgccgaggacggccatgccgac	Protospacer
 ****** ******* ******** .* . ..

757. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
tcttccagcgcggcgcggacggcctcggtgac	Protospacer
  . *** **** **************.* ..

758. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
agcgccagcgcgccgctgacggcaaaaccggc	Protospacer
******* ******** ******   . . *.

759. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
agcgccagcgcgccgctgacggcaaaaccggc	Protospacer
******* ******** ******   . . *.

760. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 10, identity: 0.688

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
ccctgcaccgcgccgcgcacggccccgacgcc	Protospacer
  *  ************ ******.***.  .

761. spacer 1.10|9436|32|CP027025|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 10, identity: 0.688

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
gaccagctcgtcgcctacggcgtcgtgccggt	Protospacer
  ****************.***.** . .  *

762. spacer 1.10|9436|32|CP027025|CRT matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 10, identity: 0.688

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
gtgatcctcgtcgcccacagcgccggcgtgat	Protospacer
 .    *********.********** **  *

763. spacer 1.10|9436|32|CP027025|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 10, identity: 0.688

ccccagctcgtcgcctacagcgccggagtcct	CRISPR spacer
gtccagcccgtcgcctgcagcgccgcgcccag	Protospacer
 .*****.********.******** . .*

764. spacer 1.12|9008|31|CP027025|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.677

aacgtgtcgaggccgatctgcgcgtacttgt	CRISPR spacer
aacgggtcgaggccgatcttcgccggacgaa	Protospacer
**** ************** ***  . . .

765. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

766. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

767. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

768. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

769. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

770. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

771. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

772. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

773. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

774. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

775. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

776. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

777. spacer 1.17|9314|31|CP027025|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 10, identity: 0.677

cgtgccgtccgtgaggccgtgttcgacgagc	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcg	Protospacer
. . .***** **************.**.

778. spacer 1.18|9375|31|CP027025|CRISPRCasFinder matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 10, identity: 0.677

agcgccaccgcgccgcggacggcctcgatcg	CRISPR spacer
gtgatgaccgcgccggggacggactcgatgc	Protospacer
.  .. ********* ****** ******

779. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 10, identity: 0.677

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
gaccagctcgtcgcctacggcgtcgtgccgg	Protospacer
  ****************.***.** . .

780. spacer 1.19|9436|31|CP027025|CRISPRCasFinder matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 10, identity: 0.677

ccccagctcgtcgcctacagcgccggagtcc	CRISPR spacer
gtgatcctcgtcgcccacagcgccggcgtga	Protospacer
 .    *********.********** **

781. spacer 2.4|18227|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 10, identity: 0.688

ggatcgcgccgtcacatgcgggtgggcggctt	CRISPR spacer
acccgccgccttcagatgcgggtgggcggccg	Protospacer
.  .  **** *** ***************.

782. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
gaccggacggcggtggaggcctgttttaaggc	Protospacer
 *********** ******** **.. *

783. spacer 2.5|18288|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 10, identity: 0.688

taccggacggcgctggaggccggtccgatcca	CRISPR spacer
gtccggccggcgccggaggccggtcaggatgc	Protospacer
  **** ******.*********** *. .

784. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 10, identity: 0.688

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
gccgcaggcgccccggacgcagcgacgtgcga	Protospacer
. ..* .*************.***** ***.

785. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 10, identity: 0.688

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
cggggtcgaagccgcgcgccaccgccagccgg	Protospacer
* . ..   ***  ******************

786. spacer 3.3|18743|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

ccatacgtcagcgtcgcgccaccgccagccgg	CRISPR spacer
cggggtcgaagccgcgcgccaccgccagccgg	Protospacer
* . ..   ***  ******************

787. spacer 3.4|18804|32|CP027025|CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 10, identity: 0.688

atagtcctcgaaggacagcaaggtcgtggcga	CRISPR spacer
gcgctgggcgaaggacggcaaggtcgtgccgg	Protospacer
... *   ********.*********** **.

788. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

789. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

790. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

791. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

792. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

793. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

794. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

795. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

796. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

797. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

798. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

799. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

800. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

801. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

802. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

803. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

804. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

805. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

806. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

807. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

808. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

809. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

810. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

811. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

812. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

813. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

814. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

815. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

816. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

817. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

818. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

819. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

820. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

821. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

822. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

823. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

824. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

825. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

826. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

827. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

828. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

829. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

830. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

831. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

832. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

833. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

834. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

835. spacer 3.6|18926|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggaga	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

836. spacer 3.10|19158|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gagggcgtgtagctctcctcgaagggggtgcc	CRISPR spacer
gtcacgatgtagctctccgcaaagggggtgat	Protospacer
*  .  .*********** *.********* .

837. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gttgcggcgggcggcgcggggccgcctgccgt	Protospacer
 .******** ****** ******* . . *

838. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gacccggcggccggcaccgggccgctctgctc	Protospacer
  . ***********.********* **

839. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gacccggcggccggcaccgggccgctctgctc	Protospacer
  . ***********.********* **

840. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ggaagcgcggccggcggccggccgcgcttgcc	Protospacer
   .  ********** * ***********

841. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gaactggcggccagcgccgggctgcgctgcga	Protospacer
    .*******.*********.*****  *.

842. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_024366 (Mycobacterium phage OkiRoe, complete genome) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gtagcggcggccggcgccgtgcggcgcggaat	Protospacer
 . **************** ** ****  ..

843. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
aggcgggcggccagcgccgggcggcgctgcgt	Protospacer
     *******.********* *****  *

844. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041766 (Tomitella sp. HY188 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gcggcggcggccgccgccgcgccgcggactcc	Protospacer
 * ********** ***** ******  .

845. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015813 (Microbacterium chocolatum strain SIT 101 plasmid 3, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gtcacggcggtcggcgccgagccgcgcgagca	Protospacer
 ...******.********.*******  * .

846. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gacccggcgggcggcggcgggccgcgcgccga	Protospacer
  . ****** ***** ********** . *.

847. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to AB276040 (Ralstonia phage RSA1 DNA, complete genome) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gcttcggcggccggcgccggaccgtcatcttc	Protospacer
 ** ****************.***.  *.

848. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to U46938 (Mycobacterium phage DS6A, Spe1/NheI G fragment sequence) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
atgccggcggccggcgccgtgcggcgccgagc	Protospacer
 .  *************** ** ****. .*

849. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_009382 (Ralstonia phage phiRSA1, complete genome) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gcttcggcggccggcgccggaccgtcatcttc	Protospacer
 ** ****************.***.  *.

850. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to JN698994 (Mycobacterium phage DS6A, complete genome) position: , mismatch: 10, identity: 0.688

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
atgccggcggccggcgccgtgcggcgccgagc	Protospacer
 .  *************** ** ****. .*

851. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ttgaagatgtcgaggcgttcgcggccggggcg	Protospacer
   ..****************  ***** *

852. spacer 3.17|19585|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gactcggagaggatctccaggttgtcttcctt	CRISPR spacer
ttctcggcggggatctccaggttgtcgaagaa	Protospacer
  ***** *.****************

853. spacer 3.20|19769|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049700 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence) position: , mismatch: 10, identity: 0.688

aagtgctcggcgatccgcaggcggcggaggct	CRISPR spacer
gaactgcgagccatccgcaggcggcggaagct	Protospacer
.*..  . .** ****************.***

854. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 10, identity: 0.688

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
ctacgtcacggagcgtggccttgctcgatgcc	Protospacer
  .   * ** *********.**********

855. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to NC_004683 (Mycobacterium phage Che9c, complete genome) position: , mismatch: 10, identity: 0.688

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
gcgtctgccgcggcgttgccctgctcgatggt	Protospacer
. * .  ****.**** *************

856. spacer 5.2|28695|32|CP027025|CRISPRCasFinder matches to AY129333 (Mycobacterium virus Che9c, complete genome) position: , mismatch: 10, identity: 0.688

agggtacccgcagcgtggccctgctcgatgcg	CRISPR spacer
gcgtctgccgcggcgttgccctgctcgatggt	Protospacer
. * .  ****.**** *************

857. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 10, identity: 0.688

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
gtcacgaccgtcgaagacggggcaaaaatgat	Protospacer
***** ******** ********    *. ..

858. spacer 5.5|28878|32|CP027025|CRISPRCasFinder matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 10, identity: 0.688

gtcaccaccgtcgacgacggggccttcaccgc	CRISPR spacer
gtcaccaccgccgaggacggggcgggctggtt	Protospacer
**********.*** ********   *    .

859. spacer 5.6|28939|32|CP027025|CRISPRCasFinder matches to NC_019387 (Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence) position: , mismatch: 10, identity: 0.688

acggggccccggtacgaggtcggccaggtgcg	CRISPR spacer
cccccttcccgggacgaggtgggccaggtggt	Protospacer
 *    .***** ******* *********

860. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MN204492 (Streptomyces phage GirlPower, complete genome) position: , mismatch: 10, identity: 0.688

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
ctcaccgtcaacaccttcatcacgacgggatc	Protospacer
  ******** **********.***  * ..

861. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MK433268 (Streptomyces phage Popy, complete genome) position: , mismatch: 10, identity: 0.688

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
ctcaccgtcaacaccttcatcacgacgggatc	Protospacer
  ******** **********.***  * ..

862. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MF467948 (Streptomyces phage DrGrey, complete genome) position: , mismatch: 10, identity: 0.688

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
ctcaccgtcaacaccttcatcacgacgggatc	Protospacer
  ******** **********.***  * ..

863. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MN586054 (Streptomyces phage FrodoSwaggins, complete genome) position: , mismatch: 10, identity: 0.688

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
ctcaccgtcaacaccttcatcacgacgggatc	Protospacer
  ******** **********.***  * ..

864. spacer 5.9|29122|32|CP027025|CRISPRCasFinder matches to MN204504 (Streptomyces phage Soshi, complete genome) position: , mismatch: 10, identity: 0.688

gacaccgtcaccaccttcatcgcgaacgtgca	CRISPR spacer
ctcaccgtcaacaccttcatcacgacgggatc	Protospacer
  ******** **********.***  * ..

865. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

866. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

867. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

868. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

869. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

870. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

871. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

872. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

873. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

874. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

875. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

876. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

877. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

878. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

879. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

880. spacer 5.13|29395|32|CP027025|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.688

gccgcagccgcccgcgcggcaggccacggagg	CRISPR spacer
cgcgcagcagcccgcgcggccggcccttggcc	Protospacer
  ****** *********** **** . *.

881. spacer 5.14|29456|32|CP027025|CRISPRCasFinder matches to MN693478 (Marine virus AFVG_25M14, complete genome) position: , mismatch: 10, identity: 0.688

ccgccccgtgtccacctggcccaccaccgcgt	CRISPR spacer
ctctgccgtgtccacctcgtccaccaccagca	Protospacer
*. . ************ *.********.

882. spacer 6.3|30572|32|CP027025|CRISPRCasFinder,CRT matches to NZ_LT984809 (Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence) position: , mismatch: 10, identity: 0.688

gacatcaccgtccggatctcccgcgaggcgac	CRISPR spacer
ctcatcaccggccggatctcgcgcggtggtcg	Protospacer
  ******** ********* ****. *

883. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.688

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
acgaacggcacggtgacgaagatgctggcgag	Protospacer
.*    ..**** ************** ***

884. spacer 6.5|30694|32|CP027025|CRISPRCasFinder,CRT matches to MH651167 (Gordonia phage Angelique, complete genome) position: , mismatch: 10, identity: 0.688

gccttgaacacgctgacgaagatgctgccgac	CRISPR spacer
gggctgaccacgctgacgaagctgctgatctg	Protospacer
*  .*** ************* ***** .

885. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccaagggcgatccggccgatcgc	Protospacer
 .* *******.************ **.   .

886. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccaagggcgatccggccgatcgc	Protospacer
 .* *******.************ **.   .

887. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to KY365739 (Streptomyces phage BabyGotBac, complete genome) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccgagggcggtccggccgagtac	Protospacer
 .* **************.***** **..  .

888. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to MH178382 (Streptomyces phage Salete, complete genome) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccgagggcggtccggccgagtac	Protospacer
 .* **************.***** **..  .

889. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to KU189325 (Streptomyces phage Maih, complete genome) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccgagggcggtccggccgagtac	Protospacer
 .* **************.***** **..  .

890. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to MH178381 (Streptomyces phage BayC, complete genome) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccgagggcggtccggccgagtac	Protospacer
 .* **************.***** **..  .

891. spacer 7.2|30940|32|CP027025|CRISPRCasFinder,CRT matches to KP876466 (Streptomyces phage TP1604, complete genome) position: , mismatch: 10, identity: 0.688

gacagaccgccgagggcgatccggacggagtt	CRISPR spacer
tgctgaccgccgagggcggtccggccgagtac	Protospacer
 .* **************.***** **..  .

892. spacer 7.3|31001|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 10, identity: 0.688

gcagccccgatgacggccgcccactcgcctac	CRISPR spacer
acgcggccgacgacgggcgcccactcgccgcg	Protospacer
.*.   ****.***** ************

893. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 10, identity: 0.688

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
gtcttcccctgccagtccttacgcatgaccat	Protospacer
***** **************.**  .  . .*

894. spacer 8.2|31782|32|CP027025|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 10, identity: 0.688

agcggttccgcgcccatctcgaagttggacag	CRISPR spacer
agcggttccgcgcccatcacgcagcctcctgc	Protospacer
****************** ** **..   ..

895. spacer 1.1|8886|32|CP027025|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cccaccagttcctggccctggacgaacggatc	Protospacer
    **** *** ************** ..

896. spacer 1.1|8886|32|CP027025|CRT matches to NC_006552 (Pseudomonas phage F116, complete genome) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

897. spacer 1.1|8886|32|CP027025|CRT matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

898. spacer 1.1|8886|32|CP027025|CRT matches to MF490237 (Pseudomonas phage vB_PaeP_E220, complete genome) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

899. spacer 1.1|8886|32|CP027025|CRT matches to KM389216 (UNVERIFIED: Pseudomonas phage F_ET605sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

900. spacer 1.1|8886|32|CP027025|CRT matches to AY625898 (Pseudomonas aeruginosa phage F116, complete genome) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

901. spacer 1.1|8886|32|CP027025|CRT matches to KM389247 (UNVERIFIED: Pseudomonas phage JBD90 clone contig00001 genomic sequence) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

902. spacer 1.1|8886|32|CP027025|CRT matches to LT603684 (Pseudomonas phage phiC725A genome assembly) position: , mismatch: 11, identity: 0.656

aagcccaggtccgggccctggacgaaccagga	CRISPR spacer
cggcccaggtcctgggcctggacgatgggaag	Protospacer
 .********** ** *********   ....

903. spacer 1.3|9008|32|CP027025|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 11, identity: 0.656

aacgtgtcgaggccgatctgcgcgtacttgtt	CRISPR spacer
aacgggtcgaggccgatcttcgccggacgaag	Protospacer
**** ************** ***  . . .

904. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

905. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

906. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

907. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

908. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

909. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

910. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

911. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

912. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

913. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

914. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

915. spacer 1.8|9314|32|CP027025|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

916. spacer 1.8|9314|32|CP027025|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 11, identity: 0.656

cgtgccgtccgtgaggccgtgttcgacgagct	CRISPR spacer
ttcctcgtccctgaggccgtgttcggcggcga	Protospacer
. . .***** **************.**.

917. spacer 1.9|9375|32|CP027025|CRT matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 11, identity: 0.656

agcgccaccgcgccgcggacggcctcgatcgt	CRISPR spacer
gtgatgaccgcgccggggacggactcgatgcc	Protospacer
.  .. ********* ****** ******  .

918. spacer 2.3|18166|32|CP027025|CRISPRCasFinder,CRT matches to KT997836 (Uncultured Mediterranean phage uvDeep-CGR0-AD1-C123, complete genome) position: , mismatch: 11, identity: 0.656

ctctggttgagtacgacgacgagcagggtctc	CRISPR spacer
acgcatccgagcgcgacgacgagcagggtctt	Protospacer
 . .. ..***..******************.

919. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgaccagcgacccggacccggcgacgaaacc	Protospacer
   ******* ******* *******  .  .

920. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tccaccagcgacccggacccggcgacgaagcc	Protospacer
  .******* ******* *******  .  .

921. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgaccagcgacccggacccggcgacgaaacc	Protospacer
   ******* ******* *******  .  .

922. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgaccagcgacccggacccggcgacgaaacc	Protospacer
   ******* ******* *******  .  .

923. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgaccagcgacccggacccggcgacgaagcc	Protospacer
   ******* ******* *******  .  .

924. spacer 2.6|18349|32|CP027025|CRISPRCasFinder,CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 11, identity: 0.656

agtaccagcgccccggacgcggcgacctgcat	CRISPR spacer
tcgaccagcgacccggacccggcgacgaaacc	Protospacer
   ******* ******* *******  .  .

925. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NC_007960 (Nitrobacter hamburgensis X14 plasmid 2, complete sequence) position: , mismatch: 11, identity: 0.656

tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
gactcggcggacggcgtcgggccgcgcgaaac	Protospacer
  . ****** *****.**********  ..

926. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 11, identity: 0.656

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
acgctgatgtcgcggctttcgatgccggaaag	Protospacer
.    ******* *** *********** ..

927. spacer 3.16|19524|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to AP014720 (Arthrobacter sp. Hiyo8 plasmid pHiyo8-1 DNA, complete genome, strain: Hiyo8) position: , mismatch: 11, identity: 0.656

ggcgggatgtcgaggcgttcgatgccggtggt	CRISPR spacer
ctgaggatgccgacgcgttcgatgccgagccc	Protospacer
   .*****.*** *************.   .

928. spacer 5.3|28756|32|CP027025|CRISPRCasFinder matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 11, identity: 0.656

cggccgacgtgcaggtggcgcagtcgagccgg	CRISPR spacer
cggccggcgagcaggtggcgcagctcgttgac	Protospacer
******.** *************.. . . .

929. spacer 5.12|29334|32|CP027025|CRISPRCasFinder matches to NC_009427 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence) position: , mismatch: 11, identity: 0.656

ttcgcgggatcgacgacgaaatggttctcgat	CRISPR spacer
agcgcgggatcgacgtcgaagtggtagagcgc	Protospacer
  ************* ****.****     ..

930. spacer 8.1|31721|32|CP027025|CRISPRCasFinder matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 11, identity: 0.656

gtcttgccctgccagtccttgcggcccttggt	CRISPR spacer
cggatgccctcccagtccgtgcggcccggctc	Protospacer
    ****** ******* ********    .

931. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR594660 (Variovorax sp. PBL-H6 plasmid 2) position: , mismatch: 12, identity: 0.625

--tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ccggtgcgcgggccggcgccggccggcgtgaa--	Protospacer
    ****  ************ * ***.  .

932. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR594667 (Variovorax sp. SRS16 plasmid 2) position: , mismatch: 12, identity: 0.625

--tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ccggtgcgcgggccggcgccggccggcgtgaa--	Protospacer
    ****  ************ * ***.  .

933. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 12, identity: 0.625

--tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
cgactgcgcggcgcggcgccgggcgccgtgcg--	Protospacer
   *****  *  ***********  **. .*

934. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR594690 (Variovorax sp. WDL1 plasmid 2) position: , mismatch: 12, identity: 0.625

--tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ccggtgcgcgggccggcgccggccggcgtgaa--	Protospacer
    ****  ************ * ***.  .

935. spacer 3.11|19219|32|CP027025|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR594672 (Variovorax sp. PBL-E5 plasmid 2) position: , mismatch: 12, identity: 0.625

--tctgcggcggccggcgccgggccgcgcttggg	CRISPR spacer
ccggtgcgcgggccggcgccggccggcgtgaa--	Protospacer
    ****  ************ * ***.  .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP027023

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027023_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027023_1

79343-79493

TypeI-E

Consensus_repeat	Method
CGAGCAACCCCCGCGGGCGCGGGGACGAC	CRISPRCasFinder

2 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e

The CRISPR arrays of CP027023_1

>merge|CP027023|1|79343-79493|CRISPRCasFinder
CGAGCAACCCCCGCGGGCGCGGGGACGACGCGAGCTGCTCGGCGAGCCGCTCCGCCTCCGACGAGCAACCCCCGCGGGCGCGGGGACGACATCAGGCCCTCCTCGCGGAGCGCCCGGTGCACCGAGCAACCCCCGCGGGCGCGGGGACGAC

>CP027023|1|1|79343-79493|CRISPRCasFinder
CGAGCAACCCCCGCGGGCGCGGGGACGAC	GCGAGCTGCTCGGCGAGCCGCTCCGCCTCCGA
CGAGCAACCCCCGCGGGCGCGGGGACGAC	ATCAGGCCCTCCTCGCGGAGCGCCCGGTGCAC
CGAGCAACCCCCGCGGGCGCGGGGACGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP027023.1\|AVI00089.1\|74394_74784_-\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00094.1\|81666_82470_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
CP027023.1\|AVI00096.1\|83812_84985_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027023.1\|AVI00166.1\|77241_77745_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00085.1\|69286_70477_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224855
CP027023.1\|AVI00099.1\|91125_92001_-\|DUF721-domain-containing-protein	unknown	unknown	gnl\|CDD\|377496
CP027023.1\|AVI00090.1\|75640_75979_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367902
CP027023.1\|AVI00097.1\|84981_86694_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027023.1\|AVI00169.1\|92013_93501_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|197713
CP027023.1\|AVI00168.1\|80857_81661_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
CP027023.1\|AVI00098.1\|90707_91103_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00095.1\|82466_83642_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027023.1\|AVI00092.1\|79537_79858_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
CP027023.1\|AVI00087.1\|72040_73207_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275267
CP027023.1\|AVI00084.1\|67920_69285_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380274
CP027023.1\|AVI00086.1\|70506_71796_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
CP027023.1\|AVI00093.1\|79854_80865_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP027023.1\|AVI00167.1\|78674_79088_-\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00091.1\|76187_76523_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00088.1\|73241_73988_-\|phage-Gp37/Gp68-family-protein	unknown	unknown	gnl\|CDD\|377854

Protein	Function_ID	Function_description	E-value
CP027023.1\|AVI00169.1\|92013_93501_-\|transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	0.00341542
CP027023.1\|AVI00094.1\|81666_82470_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	5.628e-45
CP027023.1\|AVI00096.1\|83812_84985_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	7.58316e-21
CP027023.1\|AVI00088.1\|73241_73988_-\|phage-Gp37/Gp68-family-protein	gnl\|CDD\|377854	pfam07505, DUF5131, Protein of unknown function (DUF5131). This is a family of bacterial and phage proteins of unknown function. There are three highly conserved cysteine residues in the disposition, Cx6Cxxc, amongst many highly conserved residues.	2.30825e-142
CP027023.1\|AVI00085.1\|69286_70477_+\|hypothetical-protein	gnl\|CDD\|224855	COG1944, COG1944, Uncharacterized conserved protein [Function unknown].	1.3045e-69
CP027023.1\|AVI00099.1\|91125_92001_-\|DUF721-domain-containing-protein	gnl\|CDD\|377496	pfam05258, DUF721, Protein of unknown function (DUF721). This family contains several actinomycete proteins of unknown function.	4.5072e-11
CP027023.1\|AVI00090.1\|75640_75979_-\|hypothetical-protein	gnl\|CDD\|367902	pfam04317, DUF463, YcjX-like family, DUF463. These proteins possess a P-loop motif.	0.00472102
CP027023.1\|AVI00095.1\|82466_83642_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.19695e-141
CP027023.1\|AVI00092.1\|79537_79858_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	9.87869e-38
CP027023.1\|AVI00087.1\|72040_73207_+\|hypothetical-protein	gnl\|CDD\|275267	TIGR04474, conserved_hypothetical_protein, three-Cys-motif partner protein. Members of this family occur regularly as a partner to as a member of family pfam07505, which has been called a phage protein but which seems to occur also in other contexts. Members average about 400 residues in length, but the conserved region covered by the model averages 260 residues and excludes the C-terminus. Conserved motifs suggest enzymatic activity. Note that its frequent partner protein (see pfam07505) has a three-cysteine motif that resembles the Cx3CxxC motif of radical SAM proteins, and that in one branch (see TIGR04471) actually becomes Cx3CxxC. We suggest the name three-Cys-motif partner protein (tcmP), and renaming pfam07505 to three-Cys-motif family protein.	1.21063e-31
CP027023.1\|AVI00084.1\|67920_69285_+\|hypothetical-protein	gnl\|CDD\|380274	NF033432, ThioGly_TfuA_rel, TfuA-related McrA-glycine thioamidation protein.	1.62469e-62
CP027023.1\|AVI00168.1\|80857_81661_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	5.0968e-68
CP027023.1\|AVI00093.1\|79854_80865_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	2.22083e-125
CP027023.1\|AVI00086.1\|70506_71796_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.1778e-50
CP027023.1\|AVI00097.1\|84981_86694_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	3.55507e-90

>CP027023.1|AVI00167.1|78674_79088_-|hypothetical-protein
MGGWHSTGRTQWRAEFSKPQPQPWRSRPAVKCYFVEGAGLTCVLVDGRLGPQVTHEGIRLIGRIPSELLEEMESYADRHEVGLRSTGGGELIADGFEIDLGAQRAGDAVVTWALFCNPGEIAGTSWDVAPAEVWHHW
>CP027023.1|AVI00166.1|77241_77745_+|hypothetical-protein
MPEGVERVLPEIVGRDMFDALVIRTDFSDDGSWNAVVGELRRPWGPDGEFPARVQVVDAPAWSGTTADEVLAAVDEDEYLSVVFLADRHTMQSPTRALLALSTVWEDEGDLDPVYYQELIESPEPREFRAAPAAVHSVHVNVTLGNMGFAEFAAAASAEPDQVLRPV
>CP027023.1|AVI00091.1|76187_76523_+|hypothetical-protein
MRDSRSRAFVRLTFANPASLVYLGLVVAAALSLVFASATGDTGFAAVWILLITAPTSMFLLLPDFTNGDSALATGYFLAALALSALLHAFLLGLVYRGVRGGTASRVHASA
>CP027023.1|AVI00090.1|75640_75979_-|hypothetical-protein
MTAESVVAEYRHEALVMLGRSEEAQAEARKAYATELAKPWLRAVPDSDDAQRAATEAAAQAQTRTAEHLLAVRLEQLHTQARPEPVRPAPWSQRLPEHAARPLDGEALEAIA
>CP027023.1|AVI00089.1|74394_74784_-|hypothetical-protein
MPYPQPLTPEDKLADAKKQLGLPRIVVICGSTRFMTEMAEADLRETHAGKIVVKPGIDMKSPHALWSDPVEAAELKVRLDDLHRAKIRLADEVLVVGDYIGDSTRAEIAYARSLDRPVRFTHPEVDPDA
>CP027023.1|AVI00088.1|73241_73988_-|phage-Gp37/Gp68-family-protein
MSDRSAIEWTEATWNPTTGCDRVSSGCDNCYALTLAKRLKAMGAAKYQNDGDPRTSGPGFDVTLHPDALDVPYGWKSPRTVFVNSMSDLFHARVPIAFVRQVFQVMADTPQHNYQVLTKRARRLRQLAPKLDWPTNLWMGVSVETEKELVRVDDLREAPAAVRFLSCEPLLGPLPGLNLDGIHWVIAGGESGPGHRALDPSWVTQIRDTCQSAGVAFFFKQWGGRTPKAGGRLLEGELWDQMPVPAGV
>CP027023.1|AVI00087.1|72040_73207_+|hypothetical-protein
MSSSTGGDYWVDKALPSVFKHDLLKRYLPQFGGMTGTHSDAKRVVYLDGYAGEGRYENGESASGEIALQVAEDLASSAGITLECFFSEPQRKSFDRLLDVVQPYKARGVRAHAHHGEVDGLLDQVVERAAREPLFLFLDPCGLVLPQDRLVKVLTRKRPVSKWPPTELLMNFSMMAVWRLGGHVRSSKGDEKSLHRFDEVCGGNWWREYFADAVASRDKTGAAADAIEAVAAEYAARLADRTGMLVQSVPVSHSPSKRPVYRLVFATRRSHGLWVFGDAVARARAEWWKNLEEREEGTLFSIAPDPKEVEAQAKPEIAENLARLLDRGYEIKLVDYPLEIFGSYYGQVTEPVVRQAVQLLHKQGRTPSNGKGVPRTRNIVLRPGPRQT
>CP027023.1|AVI00086.1|70506_71796_+|MFS-transporter
MPHDIHPPPPAPDHTWRKPYLRYIAGRGVSTAGTNLVNVVMAFAVLQTGGSGLSAGLVLGCSVAAQTLLLPYGGVLADRIHRRTLAASANLVLACVQTLLGILLTAAPDQVTLWMFAAAATTTGAATALAQPAFQGLIVEIVPATALQNANASLRLILNLARIAVPGLGSLLGAAFGFGQVLIIGGLSFAACALILTGLRPQPSARPRTTSRHSWREGWHAFSSRPWMWAYALAGTLAVPLWLAGYQLLGPLILSKSSGGPAYWGWAVSAFSAGMVLGSLVALRWHPRRLMLACVTVQLIWPLPLAVLATTPQLPLLLPSMLLSGISLELAVVFFETAKQQQVPEHLIGRVTSLTMLGENALVPLGYILAGAVADWAGASTVMWTCALGILLSNAVLLLLPGIRRLQSVASPAPVLKEDLRVSSQTNSA
>CP027023.1|AVI00085.1|69286_70477_+|hypothetical-protein
MTTTPEQTAPTSHKVFTTGTHRVRTPEETWALIAPQLSTFGITRVADVTGLDIIGIPVAVAYRPLSRTLSVSQGKGHNLLLAKISAVMESVEMWHAEFACPEPTHRAVPAHALDLPYKLADLAQHEGSLLDDNSPLDWVAATGLTSTRPVPVPRDSVQLTSVAGQTWRPRGLLVSSNGLASGNSYAEAALHALYEVIERDALSRLTPAPGDVRRNIRVDTIDDPMCTPLIEKILAKDVFLDVAAVPNRWGVPCFAAFVWSEDFALLTAGSGAHSSSSVALSRALTEAVQSRLTLINGSRDDLTATYSHALRGSTRKPAVDPQAFPYREALPQPSRTFDDIDAELDWACRMVTDLTGHEPLAVDLSTNNDFAIVKVICPGLSNTTRHVIPRPDYMPL
>CP027023.1|AVI00084.1|67920_69285_+|hypothetical-protein
MKVHAFIGPTLNESTAKKNAPEICIHPPARHGDFIGGDFSSGDIVVLIDGLYHGHPPIRHKEILDVMAQGVTVIGASSMGALRSAELNEFGMVGIGRIFEGFRDGRLEADDEVAVLHTEGPDWQVLSDALVNMRHAVEEAREAAVLSPDQAERLVEAARSLHYPRRSWKAVERACEGDPELRDAARRVGAFVSERGPAISLKYQDACEALRYAHGLLHAPAPAASPASPQKWPAGWRTTYLRKWHLDFNGAGFDGRFVSRAAQFDYQRLFGPDQVQRWRRYVLSAMTGLVPDGPLRDLEEQALAVAAKEHLHPDTVPADRTGHWVGEEERRRLSQQQLLLTLLVRSSRPAVDLGDEASAMWLLPQQEVTGGIISASLDINEKVVLTSFSKHIDHLKVSVLQRHLDTLWNLGNQPDEASRNAAARDRGFTSASEAVEALRPFFLKDHNDRRQIGA
>CP027023.1|AVI00092.1|79537_79858_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSPGTTVIVLIAAPPWLRGHLTRWFVEVAAGIFVGNPNPRIRDRLWATLTDRIHDGQAVMVEPATTEQGWTTRTAGRDRWTPVDFDGLTLIARPRQDGQVWRPQTT
>CP027023.1|AVI00093.1|79854_80865_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MADPWWRTGPQDVHRLEDRISSLYAERCHIDRDDNAIVLVNKARTIHVPAAWLAVLLVGPGSRITHPAITLLADSGTAVCWVGEQGVRLYATGTSTARGSQLQLRQAWLVTRPKERVAVARRMYDMRFPGEDTTGLTLQQLRGREGTRIRRLYSQHAQRTGVPWTKRDYKPGDAFAAGDDVNRLLSAANSALYGICHAAITGLGASPALGFVHTGNALSFVLDIADLYKAEFTIPLAFDLTAQGLTSERDARTALRDAIVRGKLLPRIVADIKRLLIPEGTDLIDEDLGALWDDGNTVVSSGRNWSGTDHLDIIPETPKPSKRPDPDDTTPGESTP
>CP027023.1|AVI00168.1|80857_81661_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MPYLSKIALNPRRRTAVSLLSSPHRLHAAVLAGLAVQPVVERVLWRLENNTPHRAEVLVLTESRPSWAHLVDDAGWPGADGGAPLIADYTPLLERIVRGREFGFRLTANPVQSVPRPTRPSEEQATRLKEKADHGNRHRGFRVAHRTVEQQLTWLLKRSERHGFTIPDATAAPPGPGLQAGDGEPEAPAPSAGPAVAIVSRDILRFTKHKAGPRITLSTATFEGRLRVTDPDALRSALLGGIGPAKGYGQGLLTLAPLSPTEKADHG
>CP027023.1|AVI00094.1|81666_82470_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTTDCCVLVLRLAAPLQSWGGPSRYNRRETRPQPTKSGVLGLLAAAEGRDREASLTDLVGLQLGIRVDQPGTLLRDYHTYSDYRGIPLLSAKTNAKGQQTRTTPPKYTGVTQRFYLQDAVFVAALHGPKPLLKSLEEAVRNPVYPLSLGRRSCPPVGPVSLGLRSDTDLEDALKDVPWQAGSHRRAQAQGATVSLETTVEDPDSDQLAVDVPDTFDLKSGTRFGRRAVRHFWVTLPTGRAQPDTASPDTGTAGQADHDPFALLGW
>CP027023.1|AVI00095.1|82466_83642_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRKHLFVEVHILQSLPPSNVNRDDSGTPKQAVYGGARRARVSSQAWKRATRTEYARQVPEADRATRTKRIATLLAQRLVQPADQGGAGLTQEQADRLAAALLEPLGITKSAKKDDQSAYLLFFGKKQLDALVKLLDDRAAELAALGNEELKSEVKKLAVVQTLSTGHPAEVALFGRMVADLPTLNVDASVQVAHALSTHAARTEFDYYTAVDDENTEDHGAGMIGTVEFNSSTLYRYAVLGVHQLRDNLSDADETRETAVRFVDAFARSMPTGHQNSFAHRTLPHLVLLTVRTDQPVNLVSAYEEPVTGVTGLAAESIVRLADELRAVGDTWGNKPLRTLATYTAEGDKVTEVFGSSLPFPALLDSVNALVGEWLDGGVLAPSEASEAGA
>CP027023.1|AVI00096.1|83812_84985_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTLHSSRAARGTAGRARPFFWEEATEEWHAARGEERRAEFPEYVTRKLRAVREGVGREAGTVASMRTIHRIFLSDGEPERLPNSYLAEHYTLTLFGLHQHAASSPVHQTGVGLGTACLRLQQSQALTGPSVQRRLITATTAQDMHELAQHLRRLVPLLRQAGIGVDYTRLFHEMAQWDGPGRNRVLRAWGLQYTDPGEEEGDRAGEEPAPYWVTFVPGSGDAGAELAALRSGTGREAGTVAAMWPFYRTRMGSELRDRGSLTLDLVAEHTALTLFARHQQTHAHRMHLPGASPGTAAGLLARKATAGGEGKSTAASLEKRFGVLLTSGDCDELAAHLRSLVPLLNRASIELDYDLLRSALRLWDDPRRPHATSRFRQRWDHDFHRAATS
>CP027023.1|AVI00097.1|84981_86694_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEGEAAMDVDGDLAHGAALTAVGLDGATKPVGLLNILTQAHSIRRLELPVHTMLPVVIRQLLLPIMFDALGVPQNRQEWGERFRRGRFSGQELERLTHYLGPERYGDRFRLFAAERPFAQVAGLKALSGETKSAAQLVPSVASGNNVPLFSALSEADELLLTPGDALLWLLHVHCWDTASIKTGAEGDPQAKNGKTTGNPIGPLGQLGIVVPVGETLYETLLLNTPVLPDGLAAGDRPQWAWDERPAGLDCKSPASPAWSERPASGLLDLLTFQARRVRLFTCETEQGLRVNRVIVSAGDRLARTPDYDPHTAWHHTAKPKKDQPHRRPRRHASGRAAWQGLSTLLTMALPKEGDGPYTSQLLRQIGDLQSDQVLAGQYPIGVEISGLEYGNQSAVVENAIGDDLPLPVNALLAQDKWLREALLECVEQADLVARALDGLNNDLRRASGGDPLPRDKGSRPSTQFLHSLDRTMRRLLVGLRTVDVDDDELLERAQLAWEQTVWIAAGREAGLLLAAAPPRAIVGRTVKNGDKEFVYRSGKAIGVFRKKLAEILERAAEERDTEAEEVAAA
>CP027023.1|AVI00098.1|90707_91103_+|hypothetical-protein
MLLRAAGVASAEVVAHRHTWEWLAARAADHDHFRTPSAVDDLPDGRIRTTVSGRSLIALLIVLWETRETAGLNGDWALASTTYQRAAIVLTGVTSQGATIRIVLDDGHGQDKQHDGDGEDGQNQGPVGWSR
>CP027023.1|AVI00099.1|91125_92001_-|DUF721-domain-containing-protein
MTDTTQTTTVPTQPENSGTEASGADLARLMLQRARQDAKQRGNDRPGPARRPKKTSNIQYHGRAPVGLAGAFQSLLADRGWNVPTVGGSILDRWPDIAATIAPRLATHTTAVAYDPETGQLDLMPDSPAYATQLRLMTPRIITAANEQAGAAAVRTVRVRQPGTLPATPAPTPASVKTAEPTGPVKTRETASEGFHRVLALHHKVWQPFQQDPALAAAVGRQEQVRLDLGARAFPDAGEDQEGQAPTSLEGNRAQQRQANDATRIAAILRARAERAGRVVPPGAPVLRQAG
>CP027023.1|AVI00169.1|92013_93501_-|transcriptional-regulator
MAGEVVLLSELWVPEASQWLSSSAGRVALEGYSWMQAVHWVAGSGLYQPRRHRSSGLRSFTKTTIYIAQLLAELTPCRPGIEYLVRRSGLSERTVGYHLAALRETGLLAYVVKGTRVRGERAQASEFARMIPAEYDAALGIRTVLRDETAPAYTRAVTGIAEAGRKLMTKLGKQAARKVRRPRPKTSSKVSSEASPMGPPEGADEVAETAVSAGSRCTPMGGGADGSSPAAGTYLPSESSKLASGQSESSPRKKSKGRAGGRKTKGRRKLNRIGRRYQLARELTQQVEWLRGCSMPRIAWVAQNVADAGWTVTEVLAWLHLRGTAQRVYRGSGLLAVLLANAENVLDTPGKRADAIAKWRGAQEAQRRHDIERVRAERERYEGDWQNPASRAVRTEIDSAVAQLKSLSRPVVQDLPDDASGPGAASYEVGEAEFADIRAAARDGLAHGDTSLINDTIHACGPDEALRVYGPELISRARWIDQIRRSSLTTLTFGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027023_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027023_2

90081-90467

TypeI-E

Consensus_repeat	Method
CGTCGTCCCCGCGCCCGCGGGGG	CRISPRCasFinder
TCGTCCCCGCGCCCGCGGGG	PILER-CR
TCGTCCCCGCGCCCGCGGGGGT	CRT

6 spacers

cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of CP027023_2

>merge|CP027023|2|90081-90467|CRISPRCasFinder,PILER-CR,CRT
TGTCGTCTCCGCGCCCGCGGGGGTTGTCCCCCCCAGGTCACGGGCGGTTTCACCCTGCAACTGTCGTCCCCGCGCCCGCGGGGATGGACCCATCGGCGAGTCCCTCGGCTACGAGCTCATCAACTGCTCCCCGCGCCCGCGGGGGTTGTCCGAGGATCTTGTCCTCGGGGGTCACGCGAGTCGCGTCGTCCCCGCGCCCGCGGGGGGCTCCTTATGCACGGTCTGATCAATGAACGGCGAGTCGTCGTCCCCGCGCCTGCGGGGGTTGCTCGGAGCGCCGCATCGACACGGTGTGGCGTAACCCCTCGTCCCTGCGCCCGCGGGGGTTGCTCAGCAGGCCTCCTGCTCGCGTTCGTCGGTGCCATGTCGTCCCCACGCCCGCCGTCC

>CP027023|2|2|90081-90467|CRISPRCasFinder
TGTCGTCTCCGCGCCCGCGGGGG	TTGTCCCCCCCAGGTCACGGGCGGTTTCACCCTGCAAC
TGTCGTCCCCGCGCCCGCGGGGA	TGGACCCATCGGCGAGTCCCTCGGCTACGAGCTCATCA
ACTGCTCCCCGCGCCCGCGGGGG	TTGTCCGAGGATCTTGTCCTCGGGGGTCACGCGAGTCG
CGTCGTCCCCGCGCCCGCGGGGG	GCTCCTTATGCACGGTCTGATCAATGAACGGCGAGT
CGTCGTCCCCGCGCCTGCGGGGG	TTGCTCGGAGCGCCGCATCGACACGGTGTGGCGTAACC
CCTCGTCCCTGCGCCCGCGGGGG	TTGCTCAGCAGGCCTCCTGCTCGCGTTCGTCGGTGCCA
TGTCGTCCCCACGCCCGCCGTCC

>CP027023|2|1|90083-90405|PILER-CR
TCGTCTCCGCGCCCGCGGGG	GTTGTCCCCCCCAGGTCACGGGCGGTTTCACCCTGCAACTG
TCGTCCCCGCGCCCGCGGGG	ATGGACCCATCGGCGAGTCCCTCGGCTACGAGCTCATCAAC
TGCTCCCCGCGCCCGCGGGG	GTTGTCCGAGGATCTTGTCCTCGGGGGTCACGCGAGTCGCG
TCGTCCCCGCGCCCGCGGGG	GGCTCCTTATGCACGGTCTGATCAATGAACGGCGAGTCG
TCGTCCCCGCGCCTGCGGGG	GTTGCTCGGAGCGCCGCATCGACACGGTGTGGCGTAACCCC
TCGTCCCTGCGCCCGCGGGG

>CP027023|2|1|90083-90407|CRT
TCGTCTCCGCGCCCGCGGGGGT	TGTCCCCCCCAGGTCACGGGCGGTTTCACCCTGCAACTG
TCGTCCCCGCGCCCGCGGGGAT	GGACCCATCGGCGAGTCCCTCGGCTACGAGCTCATCAAC
TGCTCCCCGCGCCCGCGGGGGT	TGTCCGAGGATCTTGTCCTCGGGGGTCACGCGAGTCGCG
TCGTCCCCGCGCCCGCGGGGGG	CTCCTTATGCACGGTCTGATCAATGAACGGCGAGTCG
TCGTCCCCGCGCCTGCGGGGGT	TGCTCGGAGCGCCGCATCGACACGGTGTGGCGTAACCCC
TCGTCCCTGCGCCCGCGGGGGT

Protein	Signature genes	Signature genes Name	Protein_function
CP027023.1\|AVI00169.1\|92013_93501_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|197713
CP027023.1\|AVI00094.1\|81666_82470_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
CP027023.1\|AVI00103.1\|96170_97340_-\|transcriptional-regulator	unknown	unknown	unknown
CP027023.1\|AVI00096.1\|83812_84985_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP027023.1\|AVI00097.1\|84981_86694_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
CP027023.1\|AVI00100.1\|94280_94577_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
CP027023.1\|AVI00102.1\|95583_96165_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
CP027023.1\|AVI00104.1\|97547_98117_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379324
CP027023.1\|AVI00101.1\|94678_95587_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274444
CP027023.1\|AVI00105.1\|98113_98863_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
CP027023.1\|AVI00167.1\|78674_79088_-\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00095.1\|82466_83642_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP027023.1\|AVI00106.1\|99205_100081_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00092.1\|79537_79858_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
CP027023.1\|AVI00099.1\|91125_92001_-\|DUF721-domain-containing-protein	unknown	unknown	gnl\|CDD\|377496
CP027023.1\|AVI00168.1\|80857_81661_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
CP027023.1\|AVI00098.1\|90707_91103_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00093.1\|79854_80865_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP027023.1\|AVI00091.1\|76187_76523_+\|hypothetical-protein	unknown	unknown	unknown
CP027023.1\|AVI00166.1\|77241_77745_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027023.1\|AVI00169.1\|92013_93501_-\|transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	0.00341542
CP027023.1\|AVI00094.1\|81666_82470_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	5.628e-45
CP027023.1\|AVI00105.1\|98113_98863_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.68048e-24
CP027023.1\|AVI00096.1\|83812_84985_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	7.58316e-21
CP027023.1\|AVI00097.1\|84981_86694_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	3.55507e-90
CP027023.1\|AVI00100.1\|94280_94577_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	7.95467e-08
CP027023.1\|AVI00102.1\|95583_96165_-\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	6.92478e-34
CP027023.1\|AVI00104.1\|97547_98117_-\|ATP-binding-protein	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	3.82324e-17
CP027023.1\|AVI00101.1\|94678_95587_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|274444	TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F. This enzyme is the partner of the peroxiredoxin (alkyl hydroperoxide reductase) AhpC which contains the peroxide-reactive cysteine. AhpF contains the reductant (NAD(P)H) binding domain (pfam00070) and presumably acts to resolve the disulfide which forms after oxidation of the active site cysteine in AphC. This proteins contains two paired conserved cysteine motifs, CxxCP and CxHCDGP. [Cellular processes, Detoxification, Cellular processes, Adaptations to atypical conditions].	1.26558e-12
CP027023.1\|AVI00095.1\|82466_83642_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.19695e-141
CP027023.1\|AVI00092.1\|79537_79858_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	9.87869e-38
CP027023.1\|AVI00099.1\|91125_92001_-\|DUF721-domain-containing-protein	gnl\|CDD\|377496	pfam05258, DUF721, Protein of unknown function (DUF721). This family contains several actinomycete proteins of unknown function.	4.5072e-11
CP027023.1\|AVI00168.1\|80857_81661_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	5.0968e-68
CP027023.1\|AVI00093.1\|79854_80865_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	2.22083e-125

>CP027023.1|AVI00097.1|84981_86694_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEGEAAMDVDGDLAHGAALTAVGLDGATKPVGLLNILTQAHSIRRLELPVHTMLPVVIRQLLLPIMFDALGVPQNRQEWGERFRRGRFSGQELERLTHYLGPERYGDRFRLFAAERPFAQVAGLKALSGETKSAAQLVPSVASGNNVPLFSALSEADELLLTPGDALLWLLHVHCWDTASIKTGAEGDPQAKNGKTTGNPIGPLGQLGIVVPVGETLYETLLLNTPVLPDGLAAGDRPQWAWDERPAGLDCKSPASPAWSERPASGLLDLLTFQARRVRLFTCETEQGLRVNRVIVSAGDRLARTPDYDPHTAWHHTAKPKKDQPHRRPRRHASGRAAWQGLSTLLTMALPKEGDGPYTSQLLRQIGDLQSDQVLAGQYPIGVEISGLEYGNQSAVVENAIGDDLPLPVNALLAQDKWLREALLECVEQADLVARALDGLNNDLRRASGGDPLPRDKGSRPSTQFLHSLDRTMRRLLVGLRTVDVDDDELLERAQLAWEQTVWIAAGREAGLLLAAAPPRAIVGRTVKNGDKEFVYRSGKAIGVFRKKLAEILERAAEERDTEAEEVAAA
>CP027023.1|AVI00096.1|83812_84985_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTLHSSRAARGTAGRARPFFWEEATEEWHAARGEERRAEFPEYVTRKLRAVREGVGREAGTVASMRTIHRIFLSDGEPERLPNSYLAEHYTLTLFGLHQHAASSPVHQTGVGLGTACLRLQQSQALTGPSVQRRLITATTAQDMHELAQHLRRLVPLLRQAGIGVDYTRLFHEMAQWDGPGRNRVLRAWGLQYTDPGEEEGDRAGEEPAPYWVTFVPGSGDAGAELAALRSGTGREAGTVAAMWPFYRTRMGSELRDRGSLTLDLVAEHTALTLFARHQQTHAHRMHLPGASPGTAAGLLARKATAGGEGKSTAASLEKRFGVLLTSGDCDELAAHLRSLVPLLNRASIELDYDLLRSALRLWDDPRRPHATSRFRQRWDHDFHRAATS
>CP027023.1|AVI00095.1|82466_83642_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRKHLFVEVHILQSLPPSNVNRDDSGTPKQAVYGGARRARVSSQAWKRATRTEYARQVPEADRATRTKRIATLLAQRLVQPADQGGAGLTQEQADRLAAALLEPLGITKSAKKDDQSAYLLFFGKKQLDALVKLLDDRAAELAALGNEELKSEVKKLAVVQTLSTGHPAEVALFGRMVADLPTLNVDASVQVAHALSTHAARTEFDYYTAVDDENTEDHGAGMIGTVEFNSSTLYRYAVLGVHQLRDNLSDADETRETAVRFVDAFARSMPTGHQNSFAHRTLPHLVLLTVRTDQPVNLVSAYEEPVTGVTGLAAESIVRLADELRAVGDTWGNKPLRTLATYTAEGDKVTEVFGSSLPFPALLDSVNALVGEWLDGGVLAPSEASEAGA
>CP027023.1|AVI00094.1|81666_82470_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTTDCCVLVLRLAAPLQSWGGPSRYNRRETRPQPTKSGVLGLLAAAEGRDREASLTDLVGLQLGIRVDQPGTLLRDYHTYSDYRGIPLLSAKTNAKGQQTRTTPPKYTGVTQRFYLQDAVFVAALHGPKPLLKSLEEAVRNPVYPLSLGRRSCPPVGPVSLGLRSDTDLEDALKDVPWQAGSHRRAQAQGATVSLETTVEDPDSDQLAVDVPDTFDLKSGTRFGRRAVRHFWVTLPTGRAQPDTASPDTGTAGQADHDPFALLGW
>CP027023.1|AVI00168.1|80857_81661_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MPYLSKIALNPRRRTAVSLLSSPHRLHAAVLAGLAVQPVVERVLWRLENNTPHRAEVLVLTESRPSWAHLVDDAGWPGADGGAPLIADYTPLLERIVRGREFGFRLTANPVQSVPRPTRPSEEQATRLKEKADHGNRHRGFRVAHRTVEQQLTWLLKRSERHGFTIPDATAAPPGPGLQAGDGEPEAPAPSAGPAVAIVSRDILRFTKHKAGPRITLSTATFEGRLRVTDPDALRSALLGGIGPAKGYGQGLLTLAPLSPTEKADHG
>CP027023.1|AVI00093.1|79854_80865_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MADPWWRTGPQDVHRLEDRISSLYAERCHIDRDDNAIVLVNKARTIHVPAAWLAVLLVGPGSRITHPAITLLADSGTAVCWVGEQGVRLYATGTSTARGSQLQLRQAWLVTRPKERVAVARRMYDMRFPGEDTTGLTLQQLRGREGTRIRRLYSQHAQRTGVPWTKRDYKPGDAFAAGDDVNRLLSAANSALYGICHAAITGLGASPALGFVHTGNALSFVLDIADLYKAEFTIPLAFDLTAQGLTSERDARTALRDAIVRGKLLPRIVADIKRLLIPEGTDLIDEDLGALWDDGNTVVSSGRNWSGTDHLDIIPETPKPSKRPDPDDTTPGESTP
>CP027023.1|AVI00092.1|79537_79858_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSPGTTVIVLIAAPPWLRGHLTRWFVEVAAGIFVGNPNPRIRDRLWATLTDRIHDGQAVMVEPATTEQGWTTRTAGRDRWTPVDFDGLTLIARPRQDGQVWRPQTT
>CP027023.1|AVI00167.1|78674_79088_-|hypothetical-protein
MGGWHSTGRTQWRAEFSKPQPQPWRSRPAVKCYFVEGAGLTCVLVDGRLGPQVTHEGIRLIGRIPSELLEEMESYADRHEVGLRSTGGGELIADGFEIDLGAQRAGDAVVTWALFCNPGEIAGTSWDVAPAEVWHHW
>CP027023.1|AVI00166.1|77241_77745_+|hypothetical-protein
MPEGVERVLPEIVGRDMFDALVIRTDFSDDGSWNAVVGELRRPWGPDGEFPARVQVVDAPAWSGTTADEVLAAVDEDEYLSVVFLADRHTMQSPTRALLALSTVWEDEGDLDPVYYQELIESPEPREFRAAPAAVHSVHVNVTLGNMGFAEFAAAASAEPDQVLRPV
>CP027023.1|AVI00091.1|76187_76523_+|hypothetical-protein
MRDSRSRAFVRLTFANPASLVYLGLVVAAALSLVFASATGDTGFAAVWILLITAPTSMFLLLPDFTNGDSALATGYFLAALALSALLHAFLLGLVYRGVRGGTASRVHASA
>CP027023.1|AVI00098.1|90707_91103_+|hypothetical-protein
MLLRAAGVASAEVVAHRHTWEWLAARAADHDHFRTPSAVDDLPDGRIRTTVSGRSLIALLIVLWETRETAGLNGDWALASTTYQRAAIVLTGVTSQGATIRIVLDDGHGQDKQHDGDGEDGQNQGPVGWSR
>CP027023.1|AVI00099.1|91125_92001_-|DUF721-domain-containing-protein
MTDTTQTTTVPTQPENSGTEASGADLARLMLQRARQDAKQRGNDRPGPARRPKKTSNIQYHGRAPVGLAGAFQSLLADRGWNVPTVGGSILDRWPDIAATIAPRLATHTTAVAYDPETGQLDLMPDSPAYATQLRLMTPRIITAANEQAGAAAVRTVRVRQPGTLPATPAPTPASVKTAEPTGPVKTRETASEGFHRVLALHHKVWQPFQQDPALAAAVGRQEQVRLDLGARAFPDAGEDQEGQAPTSLEGNRAQQRQANDATRIAAILRARAERAGRVVPPGAPVLRQAG
>CP027023.1|AVI00169.1|92013_93501_-|transcriptional-regulator
MAGEVVLLSELWVPEASQWLSSSAGRVALEGYSWMQAVHWVAGSGLYQPRRHRSSGLRSFTKTTIYIAQLLAELTPCRPGIEYLVRRSGLSERTVGYHLAALRETGLLAYVVKGTRVRGERAQASEFARMIPAEYDAALGIRTVLRDETAPAYTRAVTGIAEAGRKLMTKLGKQAARKVRRPRPKTSSKVSSEASPMGPPEGADEVAETAVSAGSRCTPMGGGADGSSPAAGTYLPSESSKLASGQSESSPRKKSKGRAGGRKTKGRRKLNRIGRRYQLARELTQQVEWLRGCSMPRIAWVAQNVADAGWTVTEVLAWLHLRGTAQRVYRGSGLLAVLLANAENVLDTPGKRADAIAKWRGAQEAQRRHDIERVRAERERYEGDWQNPASRAVRTEIDSAVAQLKSLSRPVVQDLPDDASGPGAASYEVGEAEFADIRAAARDGLAHGDTSLINDTIHACGPDEALRVYGPELISRARWIDQIRRSSLTTLTFGA
>CP027023.1|AVI00100.1|94280_94577_-|XRE-family-transcriptional-regulator
MSDADPMQRVNALLDDVLPSPRVRQQLRLAAGLTQQEVADAVGVKRLAVARWELGQTHPRRPHRAVYIHLLKGLAERFPEVAELDAGSTTPTSGRGSG
>CP027023.1|AVI00101.1|94678_95587_-|FAD-dependent-oxidoreductase
MNTPHETDVLVVGAGPSGVAAAVMAASLNLRTIIVEADSVGGKLHVIGALENVPGNWSTGPQLAEALAADLNRLQQAGRCSVVQGRGVSVTGYDDRAELVLEDGRALSAQLIVVATGVATLAPPDADWISAPARMSVSPLWRTEPADLAGRTYVLGGDRPLGTWLRTHPHSSTTLHVLCPPADDYKIAEVAGDKRVRIVPVSHVVLSQMAYGDEWSLQVKDRQGERKSYVAKTVLNNLGNTPAGLDGLASSEDGYCSPGKQHPRIRVAGDLRSAQFQRVTTAQGSGAEAVLASYYASVLKPC
>CP027023.1|AVI00102.1|95583_96165_-|cysteine-hydrolase
MWKAEWVDPRSTALLVIDVQQGFVNQHSRGVIPAVVRLVEGWQAVGAPVVLSRFHNEPGSPYETITGWTRLRTPEEQALVADLAPFAATAAAIIDKPQASVFTPEGARTIHEAGWTDLVLCGIDTDACVYDSAVAAYQAGYRPWIVTDACASTGGARYHDAALLLAARNIGAEQLVTSEVVLSRISGTQGAHA
>CP027023.1|AVI00103.1|96170_97340_-|transcriptional-regulator
MITVDRWTGEEALLLRSVMRASVREFAGRLGISPRTVSNWQRNKASVCRPQMAQILDTALLQCTPAEQEAFSLRLAALRGTAALLNAESAARPAPCTVVSHKFLPVYLGERSAPLYAAGSPSELGPGGLEQRVLTADHHSAQSSTVHAYACGVAVVHLEEHHRLESLTELALWRYRTYLKEPGWVGGWMAHLLARHGDDKDQPAQSLVPQYVLSAYELRTHSWSSAGLDTALQLLATPSVLVNRQNPADVVPLGPGVEEAKFREGWAHPEAVTFDGGVSCGVVGWSGLAYHPQPDERALTMSQIVALELDVQALWALSSHILHTIEDGQDPVMPTAYGWRFLRSAYFRLTTARPTETAQHRVMREAILATSELPDRLRAAQDALRDSNP
>CP027023.1|AVI00104.1|97547_98117_-|ATP-binding-protein
MTGRNTGQSVPRPRAILMSGLQGSGKTTLARALEKAGFRRLCPDEEMFRRYGHYGRDFPRGQFRIREAPVLKDIALELKELLAAGHEVVVDHGFWTPEERAQWAATVVKAGGEPILIYLPLPHEVRWDRIRRRNEQSLVDPNSIEFSEEDLLRHAGRFTPPTDDEPHIVYDGQPDSVLAAIQLSRRFDA
>CP027023.1|AVI00105.1|98113_98863_-|GntR-family-transcriptional-regulator
MGRADNRPPYARIAGHYRDLIESGALVAGTLLPSIKNLSEEWSVSTATVEKALRVLKEERLVAGIHGIGTEVLGTQVSLSSGAERHDRSSRTQSSWGVGEKSSGHTAGVVPAPVDVAEVMGIAPGADVIRRSRVYRDAHGLVSHSTSWIPVRFAVEIPDLARSERLKGGISLDLIARVTGRHAVRRVDEETARIATAHDLELLELEAGTVAAILVLTARFLDSNGELLEYGVDLGAPGRTRRTTSEVLR
>CP027023.1|AVI00106.1|99205_100081_+|hypothetical-protein
MTTTLPVREIETVSRERKRRARSRTRSHLDTLVISTLQAHEYDLDPACISLVCPSCRTWVPIRVAQTERATAKIVPHHTEPAGTEDPVRCPGSHRLVDINVSVARWLQRLTEGVAETNGRRSNRVTRKPRTAVAPAVMQIVGGLVDDKTARKLTEAHIKGCSVCVVKDDEGNIVRAADVDSRCADGRRLTQLAAHTKRVGPARRKAQMEREEWSDRWERGRRLLHQVLWHQHAKAVGDADAQRVDDTLTAVIQTLNPHKPEAPQLTDWERAELMGVIALLATQKEQLERHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	79372-79403	0	1.0
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	79433-79464	0	1.0
CP027023_2	2.1\|90104\|38\|CP027023\|CRISPRCasFinder	90104-90141	38	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90104-90141	0	1.0
CP027023_2	2.2\|90165\|38\|CP027023\|CRISPRCasFinder	90165-90202	38	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90165-90202	0	1.0
CP027023_2	2.3\|90226\|38\|CP027023\|CRISPRCasFinder	90226-90263	38	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90226-90263	0	1.0
CP027023_2	2.4\|90287\|36\|CP027023\|CRISPRCasFinder	90287-90322	36	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90287-90322	0	1.0
CP027023_2	2.5\|90346\|38\|CP027023\|CRISPRCasFinder	90346-90383	38	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90346-90383	0	1.0
CP027023_2	2.6\|90407\|38\|CP027023\|CRISPRCasFinder	90407-90444	38	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90407-90444	0	1.0
CP027023_2	2.7\|90103\|41\|CP027023\|PILER-CR	90103-90143	41	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90103-90143	0	1.0
CP027023_2	2.8\|90164\|41\|CP027023\|PILER-CR	90164-90204	41	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90164-90204	0	1.0
CP027023_2	2.9\|90225\|41\|CP027023\|PILER-CR	90225-90265	41	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90225-90265	0	1.0
CP027023_2	2.10\|90286\|39\|CP027023\|PILER-CR	90286-90324	39	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90286-90324	0	1.0
CP027023_2	2.11\|90345\|41\|CP027023\|PILER-CR	90345-90385	41	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90345-90385	0	1.0
CP027023_2	2.12\|90105\|39\|CP027023\|CRT	90105-90143	39	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90105-90143	0	1.0
CP027023_2	2.13\|90166\|39\|CP027023\|CRT	90166-90204	39	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90166-90204	0	1.0
CP027023_2	2.14\|90227\|39\|CP027023\|CRT	90227-90265	39	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90227-90265	0	1.0
CP027023_2	2.15\|90288\|37\|CP027023\|CRT	90288-90324	37	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90288-90324	0	1.0
CP027023_2	2.16\|90347\|39\|CP027023\|CRT	90347-90385	39	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	90347-90385	0	1.0
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	445067-445098	5	0.844
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	256054-256085	5	0.844
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	JQ067093	Pseudomonas phage PaMx74, partial genome	6939-6970	6	0.812
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP012701	Sphingopyxis macrogoltabida strain EY-1 isolate activated sludge plasmid 1, complete sequence	53418-53449	6	0.812
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP024313	Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence	258297-258328	7	0.781
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_015169	Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence	88297-88328	7	0.781
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	284797-284828	7	0.781
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	KP790011	Gordonia phage Gsput1, complete genome	40217-40248	7	0.781
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP010408	Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence	158578-158609	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1326332-1326363	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP045120	Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence	59465-59496	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	806040-806071	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1687158-1687189	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP009803	Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence	10178-10209	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1854284-1854315	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	420087-420118	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	508616-508647	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	610897-610928	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	15177-15208	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	118388-118419	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	321976-322007	8	0.75
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	MH271298	Microbacterium phage Floof, complete genome	34862-34893	8	0.75
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1732842-1732873	8	0.75
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	80419-80450	8	0.75
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	38266-38297	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	91326-91357	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	840841-840872	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	JX006077	Saccharomonospora phage PIS 136, complete genome	20738-20769	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	920977-921008	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	44332-44363	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP022424	Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence	229019-229050	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	809683-809714	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	70675-70706	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	92436-92467	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_008697	Nocardioides sp. JS614 plasmid pNOCA01, complete sequence	23947-23978	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	24932-24963	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	27871-27902	9	0.719
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	608036-608067	9	0.719
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	67529-67560	9	0.719
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	269170-269201	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	345491-345522	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	260139-260170	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	273946-273977	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_007763	Rhizobium etli CFN 42 plasmid p42b, complete sequence	179811-179842	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	161828-161859	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	161637-161668	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	161635-161666	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP020907	Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence	177883-177914	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	159020-159051	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	267603-267634	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	161636-161667	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	162315-162346	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	160138-160169	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	741453-741484	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	165600-165631	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	172517-172548	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	161635-161666	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_021906	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence	176786-176817	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	267603-267634	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	160138-160169	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	266044-266075	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	270291-270322	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	162315-162346	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	264409-264440	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013512	Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence	157775-157806	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	267603-267634	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP005086	Sphingobium sp. TKS plasmid pTK2, complete sequence	142525-142556	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	152858-152889	10	0.688
CP027023_1	1.1\|79372\|32\|CP027023\|CRISPRCasFinder	79372-79403	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	290950-290981	10	0.688
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	50088-50119	10	0.688
CP027023_1	1.2\|79433\|32\|CP027023\|CRISPRCasFinder	79433-79464	32	NC_014213	Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence	181535-181566	11	0.656

1. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgagctgctcggcgagccgctccgcctccga	Protospacer
********************************

2. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
atcaggccctcctcgcggagcgcccggtgcac	Protospacer
********************************

3. spacer 2.1|90104|38|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ttgtcccccccaggtcacgggcggtttcaccctgcaac	CRISPR spacer
ttgtcccccccaggtcacgggcggtttcaccctgcaac	Protospacer
**************************************

4. spacer 2.2|90165|38|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tggacccatcggcgagtccctcggctacgagctcatca	CRISPR spacer
tggacccatcggcgagtccctcggctacgagctcatca	Protospacer
**************************************

5. spacer 2.3|90226|38|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ttgtccgaggatcttgtcctcgggggtcacgcgagtcg	CRISPR spacer
ttgtccgaggatcttgtcctcgggggtcacgcgagtcg	Protospacer
**************************************

6. spacer 2.4|90287|36|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gctccttatgcacggtctgatcaatgaacggcgagt	CRISPR spacer
gctccttatgcacggtctgatcaatgaacggcgagt	Protospacer
************************************

7. spacer 2.5|90346|38|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcggagcgccgcatcgacacggtgtggcgtaacc	CRISPR spacer
ttgctcggagcgccgcatcgacacggtgtggcgtaacc	Protospacer
**************************************

8. spacer 2.6|90407|38|CP027023|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctcagcaggcctcctgctcgcgttcgtcggtgcca	CRISPR spacer
ttgctcagcaggcctcctgctcgcgttcgtcggtgcca	Protospacer
**************************************

9. spacer 2.7|90103|41|CP027023|PILER-CR matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gttgtcccccccaggtcacgggcggtttcaccctgcaactg	CRISPR spacer
gttgtcccccccaggtcacgggcggtttcaccctgcaactg	Protospacer
*****************************************

10. spacer 2.8|90164|41|CP027023|PILER-CR matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

atggacccatcggcgagtccctcggctacgagctcatcaac	CRISPR spacer
atggacccatcggcgagtccctcggctacgagctcatcaac	Protospacer
*****************************************

11. spacer 2.9|90225|41|CP027023|PILER-CR matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gttgtccgaggatcttgtcctcgggggtcacgcgagtcgcg	CRISPR spacer
gttgtccgaggatcttgtcctcgggggtcacgcgagtcgcg	Protospacer
*****************************************

12. spacer 2.10|90286|39|CP027023|PILER-CR matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctccttatgcacggtctgatcaatgaacggcgagtcg	CRISPR spacer
ggctccttatgcacggtctgatcaatgaacggcgagtcg	Protospacer
***************************************

13. spacer 2.11|90345|41|CP027023|PILER-CR matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gttgctcggagcgccgcatcgacacggtgtggcgtaacccc	CRISPR spacer
gttgctcggagcgccgcatcgacacggtgtggcgtaacccc	Protospacer
*****************************************

14. spacer 2.12|90105|39|CP027023|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tgtcccccccaggtcacgggcggtttcaccctgcaactg	CRISPR spacer
tgtcccccccaggtcacgggcggtttcaccctgcaactg	Protospacer
***************************************

15. spacer 2.13|90166|39|CP027023|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ggacccatcggcgagtccctcggctacgagctcatcaac	CRISPR spacer
ggacccatcggcgagtccctcggctacgagctcatcaac	Protospacer
***************************************

16. spacer 2.14|90227|39|CP027023|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tgtccgaggatcttgtcctcgggggtcacgcgagtcgcg	CRISPR spacer
tgtccgaggatcttgtcctcgggggtcacgcgagtcgcg	Protospacer
***************************************

17. spacer 2.15|90288|37|CP027023|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ctccttatgcacggtctgatcaatgaacggcgagtcg	CRISPR spacer
ctccttatgcacggtctgatcaatgaacggcgagtcg	Protospacer
*************************************

18. spacer 2.16|90347|39|CP027023|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tgctcggagcgccgcatcgacacggtgtggcgtaacccc	CRISPR spacer
tgctcggagcgccgcatcgacacggtgtggcgtaacccc	Protospacer
***************************************

19. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.844

gcgagctgctcggcgagccgctc-cgcctccga	CRISPR spacer
gcgggctgctcgtcgagccgctcgcgacgccg-	Protospacer
***.******** ********** ** * ***

20. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 5, identity: 0.844

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
gtgacgccctcctcgcgcagcacccggtgcac	Protospacer
.* * ************ ***.**********

21. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to JQ067093 (Pseudomonas phage PaMx74, partial genome) position: , mismatch: 6, identity: 0.812

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgagctgctcgacgaggcgctccgcctgggc	Protospacer
 ***********.**** **********  *

22. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP012701 (Sphingopyxis macrogoltabida strain EY-1 isolate activated sludge plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

gcgagc-tgctcggcgagccgctccgcctccga	CRISPR spacer
-cgggcgtcctcggcgtcccgctccgcctccgc	Protospacer
 **.** * *******  **************

23. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP024313 (Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence) position: , mismatch: 7, identity: 0.781

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
acgagctgctcggcgagctgttccgccacgtc	Protospacer
.*****************.*.****** *

24. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_015169 (Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence) position: , mismatch: 7, identity: 0.781

-gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
agcgggtc-ttcggccagccgctccgccgccga	Protospacer
 ***.*.. .***** ************ ****

25. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

gcgagctgctcggcgagccgct--ccgcctccga	CRISPR spacer
gcgatctgctcgtcgagccgctcgccaactct--	Protospacer
**** ******* *********  **. ***.

26. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to KP790011 (Gordonia phage Gsput1, complete genome) position: , mismatch: 7, identity: 0.781

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gccaccgcgtcagcgagccgctcagcctccga	Protospacer
** * *   **.*********** ********

27. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP010408 (Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
agcagctgctcggtgagccgcgccgcctcgtt	Protospacer
.  **********.******* *******

28. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tcgcccagcttggcgagccgctcggcctccag	Protospacer
 **  * ***.************ ******..

29. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP045120 (Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cggagctgctcggcgagcccctccacccctac	Protospacer
  ***************** ****.**.*..

30. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tcgcccagcttggcgagccgctcggcctccag	Protospacer
 **  * ***.************ ******..

31. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tcgagcggctcggccagccgctcctcgagcgt	Protospacer
 ***** ******* ********* *   **

32. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP009803 (Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tccgggtgctgggcgatccgctccgcctccag	Protospacer
 * .* **** ***** *************..

33. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tccggctgctcggccagacgctccgccagcca	Protospacer
 * .********** ** *********  * *

34. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tccggctgctcggccagacgctccgccagcca	Protospacer
 * .********** ** *********  * *

35. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tcgcccagcttggcgagccgctcggcctccag	Protospacer
 **  * ***.************ ******..

36. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tcgcccagcttggcgagccgctcggcctccag	Protospacer
 **  * ***.************ ******..

37. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

-gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
tgccgg-tgctgggcgcgccgctccgcctcatc	Protospacer
 ** .* **** **** *************

38. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcttcgtgctcggcgatccgctgcgcctcggc	Protospacer
**    ********** ***** ****** *

39. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.75

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ttgaggaactcggcgagccgctccgtcttcgg	Protospacer
 .***  .*****************.**.**.

40. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to MH271298 (Microbacterium phage Floof, complete genome) position: , mismatch: 8, identity: 0.75

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
ttcaggcccgcctcgcggagcgcctggaagta	Protospacer
 ******** **************.** .

41. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
ttcaggcccgcctcgcggagcggcccgggaga	Protospacer
 ******** ************ ** * * .

42. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
ttcaggcccgcctcgcggagcggcccgggaga	Protospacer
 ******** ************ ** * * .

43. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgagctgctcgtcgcgccgctctacccggcg	Protospacer
************ ** *******..**.   .

44. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgagctgctcgtcgcgccgctctacccggcg	Protospacer
************ ** *******..**.   .

45. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcctcgtgctcggcgaggcgctcggcctcgtc	Protospacer
**    *********** ***** *****

46. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to JX006077 (Saccharomonospora phage PIS 136, complete genome) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cgttcctgctcggcgcgctgctccgcctccag	Protospacer
     ********** **.***********..

47. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
acctgctgctcggcgagctgctccaccacacg	Protospacer
.*  **************.*****.** *  .

48. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gtcttctgctcggcgtgccgctctgccttggt	Protospacer
*.   ********** *******.****. *

49. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP022424 (Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cccggctgctcggccagccgctgcgccacgtc	Protospacer
 * .********** ******* **** *

50. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cctgggtgcccggcgagccgatccgcctcatc	Protospacer
 * .* ***.********** ********

51. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cggagatcctcggcgagccgctccggcccgcc	Protospacer
  *** * ***************** *.*

52. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgggctgctcggcgagccggtcgaggaacgt	Protospacer
***.**************** ** .    **

53. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_008697 (Nocardioides sp. JS614 plasmid pNOCA01, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cgcagctgctcggcgaaccactccgcggccct	Protospacer
   *************.**.******  **

54. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgagctgctcgtcgaggcgctcaatccgctt	Protospacer
************ **** ***** ..*. *

55. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
gcgagctgctcgtcgaggcgctcaatccgctt	Protospacer
************ **** ***** ..*. *

56. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 9, identity: 0.719

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
agtttgccctgctcgcgcagcgcccggttctg	Protospacer
* .  ***** ****** ********** *

57. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
tcgccgccctcctcgcggagcaccccgtcgac	Protospacer
 .   ****************.*** **  **

58. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcgagccgttcctggctcat	Protospacer
 *** ***************.***   ..*.

59. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctggtcggcgagccgctcctggctcat	Protospacer
 *** *** ***************   ..*.

60. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcgagccgttcctggctcat	Protospacer
 *** ***************.***   ..*.

61. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

62. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_007763 (Rhizobium etli CFN 42 plasmid p42b, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

63. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

64. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

65. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

66. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP020907 (Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

67. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

68. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

69. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

70. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

71. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

72. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

73. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

74. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

75. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

76. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_021906 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

77. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

78. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

79. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

80. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

81. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

82. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

83. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013512 (Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

84. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

85. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP005086 (Sphingobium sp. TKS plasmid pTK2, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
cgctgatgctcggcgatgcgctccgcctctat	Protospacer
    * **********  ***********..

86. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcaagccgctcctggctcat	Protospacer
 *** *********.*********   ..*.

87. spacer 1.1|79372|32|CP027023|CRISPRCasFinder matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 10, identity: 0.688

gcgagctgctcggcgagccgctccgcctccga	CRISPR spacer
ccgatctgctcggcgagccgttcctggctcat	Protospacer
 *** ***************.***   ..*.

88. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 10, identity: 0.688

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
acgtaatcctcctcgcggagcgccaggagctt	Protospacer
*.  ...***************** ** ** .

89. spacer 1.2|79433|32|CP027023|CRISPRCasFinder matches to NC_014213 (Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence) position: , mismatch: 11, identity: 0.656

atcaggccctcctcgcggagcgcccggtgcac	CRISPR spacer
cccaggccctcctggaggagcgccctacctgg	Protospacer
 .*********** * ********* .. ..

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP027024

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP027024_2	2.1\|99774\|71\|CP027024\|CRT	99774-99844	71	CP027022.1	83357-83427	11	0.845

1. spacer 2.1|99774|71|CP027024|CRT matches to position: 83357-83427, mismatch: 11, identity: 0.845

aaccgactcctcaccgactgcacctccaccacccaggccaccacctgccccagcaccgaa	CRISPR spacer
aaccgactcctcaccgactgcacctccaccacccaggccaccacctgccccagcaccgaa	Protospacer
************************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027024_1	1.1\|99489\|37\|CP027024\|CRISPRCasFinder	99489-99525	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99489-99525	0	1.0
CP027024_2	2.2\|99864\|41\|CP027024\|CRT	99864-99904	41	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99864-99904	0	1.0
CP027024_2	2.3\|99924\|41\|CP027024\|CRT	99924-99964	41	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99924-99964	0	1.0
CP027024_2	2.4\|99984\|29\|CP027024\|CRT	99984-100012	29	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99984-100012	0	1.0
CP027024_2	2.5\|100032\|41\|CP027024\|CRT	100032-100072	41	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	100032-100072	0	1.0
CP027024_2	2.6\|99858\|37\|CP027024\|CRISPRCasFinder	99858-99894	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99858-99894	0	1.0
CP027024_2	2.7\|99918\|37\|CP027024\|CRISPRCasFinder	99918-99954	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99918-99954	0	1.0
CP027024_2	2.8\|99978\|25\|CP027024\|CRISPRCasFinder	99978-100002	25	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99978-100002	0	1.0
CP027024_2	2.9\|100026\|37\|CP027024\|CRISPRCasFinder	100026-100062	37	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	100026-100062	0	1.0
CP027024_2	2.1\|99774\|71\|CP027024\|CRT	99774-99844	71	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	99774-99844	11	0.845

1. spacer 1.1|99489|37|CP027024|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacggccgccgcaccagccagaccggaacagccg	CRISPR spacer
gccgacggccgccgcaccagccagaccggaacagccg	Protospacer
*************************************

2. spacer 2.2|99864|41|CP027024|CRT matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaaccgcaccacccagaccaaagctggcacagccaccac	CRISPR spacer
ggcaaccgcaccacccagaccaaagctggcacagccaccac	Protospacer
*****************************************

3. spacer 2.3|99924|41|CP027024|CRT matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gaccagctcaccagcgaaaccacaggtggctccaaccgcgc	CRISPR spacer
gaccagctcaccagcgaaaccacaggtggctccaaccgcgc	Protospacer
*****************************************

4. spacer 2.4|99984|29|CP027024|CRT matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaaccagacatcgaatggcgccaccac	CRISPR spacer
ggcaaccagacatcgaatggcgccaccac	Protospacer
*****************************

5. spacer 2.5|100032|41|CP027024|CRT matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagctcgcctcggtaagcgttggcgcagacacctaccg	CRISPR spacer
aaccagctcgcctcggtaagcgttggcgcagacacctaccg	Protospacer
*****************************************

6. spacer 2.6|99858|37|CP027024|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

caggtcggcaaccgcaccacccagaccaaagctggca	CRISPR spacer
caggtcggcaaccgcaccacccagaccaaagctggca	Protospacer
*************************************

7. spacer 2.7|99918|37|CP027024|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gacgccgaccagctcaccagcgaaaccacaggtggct	CRISPR spacer
gacgccgaccagctcaccagcgaaaccacaggtggct	Protospacer
*************************************

8. spacer 2.8|99978|25|CP027024|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gccgacggcaaccagacatcgaatg	CRISPR spacer
gccgacggcaaccagacatcgaatg	Protospacer
*************************

9. spacer 2.9|100026|37|CP027024|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaaaaaccagctcgcctcggtaagcgttggcgcag	CRISPR spacer
gcgaaaaaccagctcgcctcggtaagcgttggcgcag	Protospacer
*************************************

10. spacer 2.1|99774|71|CP027024|CRT matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 11, identity: 0.845

aaccgactcctcaccgactgcacctccaccacccaggccaccacctgccccagcaccgaa	CRISPR spacer
aaccgactcctcaccgactgcacctccaccacccaggccaccacctgccccagcaccgaa	Protospacer
************************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage