CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP026613	Clostridioides difficile strain R1 chromosome, complete genome	10 crisprs	cas14j,csa3,WYL,cas3,DEDDh,DinG,RT,cas14k,cas2,cas1,cas4,cas5,cas7b,cas8b1,cas6,cas7,cas8b2	2	137	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026613_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_1

32260-32345

Orphan

Consensus_repeat	Method
GTTGGCGCTGTGCATTAGCACTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026613_1

>merge|CP026613|1|32260-32345|CRISPRCasFinder
GTTGGCGCTGTGCATTAGCACTTTAAGCAACAGAATAAACTGAACGCATCTGAAGTTTGTTTGTTGGCGCTGTGCGTTAGCACTTT

>CP026613|1|1|32260-32345|CRISPRCasFinder
GTTGGCGCTGTGCATTAGCACTTT	AAGCAACAGAATAAACTGAACGCATCTGAAGTTTGTTT
GTTGGCGCTGTGCGTTAGCACTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD43470.1\|52350_53421_+\|dna-integrity-scanning-protein-disa	unknown	unknown	gnl\|CDD\|237395
CP026613.2\|AVD43458.1\|27571_27922_+\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
CP026613.2\|AVD43455.1\|23356_24628_+\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
CP026613.2\|AVD43466.1\|46825_47320_+\|DNA-methylase	unknown	unknown	gnl\|CDD\|226397
CP026613.2\|AVD43471.1\|53509_54604_+\|PIN/TRAM-domain-containing-protein	unknown	unknown	gnl\|CDD\|227292
CP026613.2\|AVD43462.1\|39570_39984_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD43453.1\|21477_22005_+\|transcription-repressor-NadR	unknown	unknown	gnl\|CDD\|224740
CP026613.2\|AVD43464.1\|43969_45898_+\|elongation-factor-G	unknown	unknown	gnl\|CDD\|237186
CP026613.2\|AVD43452.1\|9987_10761_+\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274373
CP026613.2\|AVD43468.1\|48347_50795_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
CP026613.2\|AVD43460.1\|28675_28897_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD43465.1\|46354_46819_+\|CtsR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226869
CP026613.2\|AVD43459.1\|27934_28534_+\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|234616
CP026613.2\|AVD43461.1\|28967_30173_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|340861
CP026613.2\|AVD43467.1\|47335_48361_+\|protein-arginine-kinase	unknown	unknown	gnl\|CDD\|234894
CP026613.2\|AVD43463.1\|40296_43728_+\|pyruvate-carboxylase	unknown	unknown	gnl\|CDD\|237263
CP026613.2\|AVD43457.1\|25875_27513_+\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|235505
CP026613.2\|AVD43454.1\|22016_22898_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|182386
CP026613.2\|AVD43456.1\|24949_25405_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
CP026613.2\|AVD43469.1\|50974_52348_+\|DNA-repair-protein-RadA	unknown	unknown	gnl\|CDD\|236994

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD43470.1\|52350_53421_+\|dna-integrity-scanning-protein-disa	gnl\|CDD\|237395	PRK13482, PRK13482, DNA integrity scanning protein DisA; Provisional.	0
CP026613.2\|AVD43458.1\|27571_27922_+\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	1.04649e-45
CP026613.2\|AVD43455.1\|23356_24628_+\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
CP026613.2\|AVD43466.1\|46825_47320_+\|DNA-methylase	gnl\|CDD\|226397	COG3880, COG3880, Modulator of heat shock repressor CtsR, McsA [Signal transduction mechanisms].	2.05547e-43
CP026613.2\|AVD43471.1\|53509_54604_+\|PIN/TRAM-domain-containing-protein	gnl\|CDD\|227292	COG4956, COG4956, Integral membrane protein (PIN domain superfamily) [General function prediction only].	9.37001e-140
CP026613.2\|AVD43465.1\|46354_46819_+\|CtsR-family-transcriptional-regulator	gnl\|CDD\|226869	COG4463, CtsR, Transcriptional repressor of class III stress genes [Transcription].	1.67585e-42
CP026613.2\|AVD43464.1\|43969_45898_+\|elongation-factor-G	gnl\|CDD\|237186	PRK12740, PRK12740, elongation factor G-like protein EF-G2.	0
CP026613.2\|AVD43452.1\|9987_10761_+\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274373	TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily. This group of similar sigma-70 factors includes clades found in Bacilli (including the sporulation factors SigF:TIGR02885 and SigG:TIGR02850 as well as SigB:TIGR02941), and the high GC gram positive bacteria (Actinobacteria) where a variable number of them are found depending on the lineage.	6.4918e-87
CP026613.2\|AVD43468.1\|48347_50795_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
CP026613.2\|AVD43456.1\|24949_25405_+\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	7.52683e-52
CP026613.2\|AVD43459.1\|27934_28534_+\|recombination-protein-RecR	gnl\|CDD\|234616	PRK00076, recR, recombination protein RecR; Reviewed.	6.04881e-129
CP026613.2\|AVD43461.1\|28967_30173_-\|glycosyl-transferase	gnl\|CDD\|340861	cd17507, GT28_Beta-DGS-like, beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.3214e-147
CP026613.2\|AVD43467.1\|47335_48361_+\|protein-arginine-kinase	gnl\|CDD\|234894	PRK01059, PRK01059, ATP:guanido phosphotransferase; Provisional.	3.36621e-164
CP026613.2\|AVD43463.1\|40296_43728_+\|pyruvate-carboxylase	gnl\|CDD\|237263	PRK12999, PRK12999, pyruvate carboxylase; Reviewed.	0
CP026613.2\|AVD43457.1\|25875_27513_+\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|235505	PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated.	0
CP026613.2\|AVD43454.1\|22016_22898_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|182386	PRK10334, PRK10334, small-conductance mechanosensitive channel MscS.	1.89288e-61
CP026613.2\|AVD43453.1\|21477_22005_+\|transcription-repressor-NadR	gnl\|CDD\|224740	COG1827, COG1827, Predicted small molecule binding protein (contains 3H domain) [General function prediction only].	1.08485e-43
CP026613.2\|AVD43469.1\|50974_52348_+\|DNA-repair-protein-RadA	gnl\|CDD\|236994	PRK11823, PRK11823, DNA repair protein RadA; Provisional.	0

>CP026613.2|AVD43461.1|28967_30173_-|glycosyl-transferase
MSKKVLIMSASTGGGHNRAALAIKEELTSKTLDGEPIECEIIDSLKLVNNTMDKIISRGYEKSAIYTPKAYGSVYRLSETNLLSKNEFKDNLLITFMAKKFKKLIRSEKPDLIIGTHPFPMIALSTLKKNFNLHNNESNAYTDHFYKHYTNTINVPPLISVLTDYTTHSTWIQNEIDYYIVGHEYVKELLVFDGVEPSKIRTFGIPVEKSFLSHRDKDTVLSELNLSPDKLTVLLMGGSFGAGNIKETLDELLDTDRDFQILVITGKNESLKEKIEKKLISRYHDKNVCVLGYTDKMNDILASIDVLVSKPGGLTTTEALLKDVPMIVPYYIPGQEEENLDFLSNCGAALRTTKKYNLSILLKVLIDDPSRLEMLKRNIKSIRKSNSAQNIANLILNIISG
>CP026613.2|AVD43460.1|28675_28897_+|hypothetical-protein
MKPIMNLEEHNAMKEKRVKKMKSKDKPKYDDFEDISFSNKKKTKKNVRNKNAEFRNNYKNYQYDYEEDFYEPI
>CP026613.2|AVD43459.1|27934_28534_+|recombination-protein-RecR
MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSICCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGPDMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKPMGIKVTRIAHGLPVGGDLEYADEVTISKALEGRREI
>CP026613.2|AVD43458.1|27571_27922_+|YbaB/EbfC-family-nucleoid-associated-protein
MAKKGFGGGMMPGGGNMNNLLKQAQKMQENMQKAQQELESKEVEASVGGGAVTVKVNGKKEVIDITIKPEVVDPDDIEMLQDLVLSAVNQALRNIDDIQASQMSKVTGGMNIPGLF
>CP026613.2|AVD43457.1|25875_27513_+|DNA-polymerase-III-subunit-gamma/tau
MHKALYRAYRPQKFEDVIGQDHIIKTLKNQIYSDNIGHAYLFCGTRGTGKTSTAKIFSRAVNCLNKINEEPCNECEICESVLKDNTMDVVEIDAASNNSVDDIRELRESVKYSPANAKYKVYIIDEVHMLSQGAFNALLKTLEEPPSYVIFILATTEPHKIPATILSRCQRYDFKRVTVKDMTLRMKKICEDEGIDIDDKALNLIARNSQGALRDALSILDQCMSFGESKIDYKDVVELMGSVNIEQLFELSQCIVEQDTKKSLEILNEFVLWGKDIRNLINDLIDHFRNLMVCKVSSELDEIISLPEETIEQLKIQSKNIDINDLIRILNILSITQDDIKSSSNPRVLVEITIMKIAQPMFDESKEALIKRVENLEKMIELGNFKSEKIGNNKEKEYEVDREIDVKQENVVYEDVKNEDVILIESSWKNILKQIKKDKKMPIYALLSEVKSFNVYSNMLYVIFDDKFDFAKTRLSSQDTINYLEKTIRDVLNRSFNVKIVLTSEVKDINLEVKEKKDIGEEILKNIVSEEILEIKDSIDENESK
>CP026613.2|AVD43456.1|24949_25405_+|nucleoside-deaminase
MESSFYMKEALKEAYKAYNKKETPIGAIIVKDNQIIARAHNLTETLKDSTAHAEILAIKQASEKLGGWRLTDCDLYVTMEPCIMCSGAIVNSRIKKLIIGTRHVKNSYIEKQHEFKLDYFNNNNVKVAFDVLQEECSIILQEFFKALRKRD
>CP026613.2|AVD43455.1|23356_24628_+|serine--tRNA-ligase
MLDIKRIRENLDDIKKAMERRGEKEFDLDAVVELDNKRREILQEVEVMKNELNVNSKNIPQLIKEGKDVTEEKARLKELSDKIKGIDEKVKEVEAKMEYALMRIPNVPHPEVPQGETDEDNVQIRTWGEPTKFDFEHKAHWDIGTGLGILDFERAGKITGSRFTLYRGLGARLERSLMNFFLNTHTAKHGYTEVLPPFMANRNSFIGTGQLPKFEEDMFKIEGLEYFLIPTAEVPVTNIHANEILDVAELPIKYCAYTPCFRSEAGSAGRDTRGLVRQHQFNKVELVKFVKPEDSYNELESLTHDAETMLQMLGLPYRVVKICTGDLGFTAAFKYDLEVWMPSYNRYVEISSCSNFEDFQARRAGIRFKRDKKSKAEYVHTLNGSGLAIGRCLAAILENYQQADGSVVVPEELRPYMGVDVIR
>CP026613.2|AVD43454.1|22016_22898_+|mechanosensitive-ion-channel-family-protein
MNFLSLAKSASTNSNITKRTLENMLDNFSDNIPNIIYAIIVFVIGIYISKIVRRMVSKFLIKYGMSKGVNNFIVYGIYISMLSIISLISLGIIGIQTTSVVAVLGAAGFSIGLAFKEILSNLGSGMIILFFKPFNIGDYIQGSGVEGTVSDIQIFSTVLKTPDNKTIIIPNFQLTSNNIINYTHQNKRRIDFSYNISYDSDIDLVKSILNEIFINEKRILDDPRPIIGLNSIGNNTMQIVARPWVKTDDYWDVYFDVMEKVKNKFDENNIKVPFVPSSLLFNNMSNLNTMDKR
>CP026613.2|AVD43453.1|21477_22005_+|transcription-repressor-NadR
MERRCNMNSNERRSKLIDILKESKHPVKGGTLAELLNVSRQVIVQDIAIIRARGFEIIATPQGYIIYNQPYFTKQIKCKNHKDSKEIYDELKIIVDLGGIIKDVIVNHPTYGQITAELNIYSKMDIDNFMKKVETNEFKQLSVLTECSHIHTIEAIKEETIEAIVKELKDNGILS
>CP026613.2|AVD43452.1|9987_10761_+|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor
MKNVANATHYLNMDTKELFNLYNKNKNVDIRNILIERHLYLARLLAKKYINKGVDFEDIYQVASLALIYAIDRYDVEKGFEFSSFATPTIVGEIKKYFRDKVWTLRVPRRIQELSKKISDAKIKLEQENKKHPKVKDIADYIGVSEEDVLEAMEASYGYQPMSLDSSSNDDSEDKDITLIDKIGKEEGNFGSIEYEDFINKFIETLNELEVKIFKDRFFFDKTQSSIAKELGISQMTVSRLEKKVVEKLKKEYEKNL
>CP026613.2|AVD43462.1|39570_39984_+|hypothetical-protein
MYIVIGNEIVDSEELKVIIDKNSKFKVEKDLSKSTKREDVIAYQLSIDLNYLDSLISEQCNLASLSDEEKFDEYMTLSDELALNLEELMPKYTIINARAYKLDEVDGVVKIILAVAYADLGHLKLSDVLMRISRQVD
>CP026613.2|AVD43463.1|40296_43728_+|pyruvate-carboxylase
MLKKFNKILVANRGEIAIRIFRACSELGIKSVGIYSKEDKYGLFRTKADESYLIGEGKGPIDAYLDMDGIIDLAKRKKVDAIHPGYGFLAENAEFARKCEENGITFIGPSSKVMNMMGDKINSKKIAKEVNVQTIPGVEKAIRSTEEAKEVANKIGYPVMIKASNGGGGRGMRIVHHEEDLELEYETACSESRKAFGEDIIFIEKYIADPKHIEVQILGDNYGNIVHLYERDCSVQRRHQKIIEYAPAFSLDDKVRKEICEDAVKLSKHVGYSNAGTLEFLVDANGGHYFIEMNTRVQVEHTVTEMVTGIDIVQSQILIAQGYSLDSEEINIKSQDDVEIRGYSIQCRITTEDPKNKFMPDTGKIQVYRTGSGFGIRLDGGNGFTGANISPHYDSLLVKTISWDRTFQGAINKTIRSIKELRVRGVKTNVGFLVNVLNNPIFSNGKCSTKFIDENPDLFEITESKDRGTKLLQFIGDVIVNDNACKEKPLFDALHDPRMDKDGSKAEGSKILFDKLGKSAYIEKIKNDKKLLLTDTTMRDAHQSLLATRIRTYDLLKAAKPTEKYQKDLFSLEMWGGATYDVAYRFLKESPWRRLQKLREEIPSIMFQMLLRASNGVGYKNYPDNVIEEFTKESARQGIDVFRIFDSLNWVENMKPSINTALETGKIVEATMCYTGDILDKTKTKYNLEYYIKMAQELESLGADIIAIKDMSGLLKPYSAYTLVKELKKNIKAPIHLHTHDTSGNGVATCLMASEAGVDIIDAALESMAGLTSQPSLNAIVEALKNTERDTGIDLFGYDELGKYYKDLRKVYSKFESDLTNSCAEIYNFEIPGGQYTNLKPQADSLGLVNRFDEVKEKYKEANEVVGDIIKVTPSSKVVGDLAIFMTKNKLDKDNIIEEGKNLSFPDSVVDYCKGMIGQPEGGIPKDLQEVVLKGEEAITVRPGSLLPEEDFDEIAKYLNEKYDINANIRNVISYALYPKVYEDYIKHLQHYNDISKLESDVFFYGLNKNEECEVEIEEGKVLTIRLVEIGEVKENGFRTIGFELNGMVREVEIKDKNFSGKINNVEKADMNDPLQIGASIPGKVIKIMVKEEDEVKANQPLIVIEAMKMETIIVAKTDGVIKSIKVKEDDMVEDKQLLMIMK
>CP026613.2|AVD43464.1|43969_45898_+|elongation-factor-G
MKVYDSKMLRNVAVLGHSGCGKTNLIETIAYTANTNKIPKLTDKVNMTYSMGLIPIEYNDYKFNLLDTPGYFDFSGDVVSSLRASDAAIIVIDATAPIQVGTEKSLELTESIPKIMFINKIDNEKARYKDAIAMLREKYNNKIVPMISPIYKDKNFVKLHNVFENIDDLEGEFKEQAMSVKEALMELIAETDDQILDKYFNGEELTTEEIQKGIIIGIQRGDIIPVICGSTINNIGTKEILDTISNYLEPIFTEESKPFRGLVFKTMVDPFVGKMSYIKITEGVLSKDKDVFNINKNVKEKIANIYTLKNSELVEVEKAKAGDIVVVTKINSLKTGDTISIDKDAEALENIDFPKPQIYYAVTPKNKGDEEKVASVLNRLVEEDPTLHSYRNTETKQALLGGQGELHIKTIKNKMKDKFGVDVELNDLKVPYRETIKGKSDVQGKHKKQSGGHGQYGDVKIRFERCESDFEFAEEIFGGSVPKQYIPAVEKGIKDSMQKGILAGYPVTNIKATLYDGSYHDVDSSEMAFKMAASVAFKKGMEEAHPILLEPIMKLKITVPEEYMGDVMGDINKRRGKIFGMEPDDKGKQIIFAEAPQAETFKYAIDLRAMTQGRGYFEMELERYGEVPSQFAEKIIGLATAK
>CP026613.2|AVD43465.1|46354_46819_+|CtsR-family-transcriptional-regulator
MATMTDIIEKFIKDLMEEDNSIQIQRNELANLFSCAPSQINYVLTTRFTIDRGYYIESKKGGGGYVQIEKIRKSKDGHIRELLNEKIGNQISYKKAKELLEGLKESDLINERELKLILYAIDDKSLCMPIYELKEKVRSNILKNIIIGLFSIEE
>CP026613.2|AVD43466.1|46825_47320_+|DNA-methylase
MLCQKCNKNKASVYYNKIVNGEKTEMYLCSECAKENTEMNFNLDMPFSMMDIFSNLGFQPKKELEEKLVCPKCNTTYSEFKNNGRFGCSECYNAFSSQVNPMLQNIHGHIEHTGKAPKKSFYKISVENEIKELKEDLDRAIKNEEYELAAQFRDKIKYLKGSID
>CP026613.2|AVD43467.1|47335_48361_+|protein-arginine-kinase
MKENIVMKSRVRLARNLNNYSFPNKLDKECAMEIIEKVKNAFINSNLEQKEEFDFYKIEDLDQSKKMLMVEEHIISPDLAESDKSAVIVKKDKTVSIMINEEDHIRIQTMCDDLNLEYAYSVANEIDDLLESSLEYAFSTKLGYLTSCPTNTGTGMRASVMMHLPALSQLGYMDELYKISSQIGIAIRGIYGERTEALGNIYQISNQLTLGRTESNIIENVSGLTKDAISKEIKAREILQKKLGIKLEDKIFRSIGTLENSRIMSSAEAMSHLSNIKMGIEMNYIDKLDLRAIEQLMIGIQPAHQSIMYKSDDVENRDINRATYIRETLEKLRGGMNCELQ
>CP026613.2|AVD43468.1|48347_50795_+|ATP-dependent-Clp-protease-ATP-binding-subunit
MNFNRFTQRAKKAIDLAFESAKGLGHNIVGSEHILLGLLREEEGIAAKVLSKVGFTEAYLEGKIVDMEGKGEEISEDIVLSPRSKQILELSGMFANKLKTNYIGTEHILLAIIQEGEGIANKILNYAGVNDRTLAQLTIDMMGISDKNQYKAENSYTGNQNQAESKVLDKYGRNLTLYAKQNKIDPVIGREKEIQRVIQILSRRTKNNPVLIGDPGVGKTAIAEGLATNIALGNVPETLKNKTLYSLEMGSLLAGAKYRGEFEERIKEVVDEVVKNGNIILFIDEMHTIIGAGSTGEGSIDASNILKPALARGEIQVIGATTIDEYRKHVEKDSALERRFQPVMVDEPTKEDSIKILEGLRDKYEAHHKVKITDDAIKAAVELSTRYISDRYLPDKAIDLIDEAASKVRLKENTPPSEIKKLELEIENIDKEKEEAVRCQDFEKAAKIRDEQGLLKKQLEDVRERWSKSSKHSDLVDGEVIAEVVGLWTGIPVNKILEEEADRLLRLEEILHNRVIGQEQAVKSISKAIRRSRAGLKDPNRPIGSFLFLGPTGVGKTELSKALAEVQFGDENQIIRIDMSEYMEKHAVSRMIGSPPGYVGHDEGGQLTEKVRRNPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSKGRTVDFKNTIVIMTSNVGASTIGRQKTLGFSIAKGDEEEKSQYEKMKENIMGELKQRFRPEFLNRIDDIIVFHSLNENHISKIVLLMAAKLQERLKEMDIKLEMSDEAVKLISKSGFDLEYGARPLKRALQKELEDELSEAILKGNVKKGSNVVAKVKDEKIVFETK
>CP026613.2|AVD43469.1|50974_52348_+|DNA-repair-protein-RadA
MAKIKTKYVCQSCGYETAKWLGKCPECTKWNTFVEEIDQKSTKKEVFIIDKSSSKPVTINSIESKEEERFTTDINELDRVLGGGIVKGSLVLVGGDPGIGKSTLLIQVSSNVANLGKTVLYITGEESESQIKMRAKRLGINSENLYIFAENNLSIIESYLEVVNPELIILDSIQTVFSPEISSAPGTVSQIKEGTSKFMKISKKMGISTFIVGHVTKEGSLAGPKLLEHMVDTVLYFEGERYNTYRLVRAVKNRFGSTNELGVFEMRDLGLVELDNPSKILISEKPKDVAGSVIISTVEGTRPMLLELQALVSPTSFGIPKRTSTGVDYNRVGMLLAVLEKRVGLQIQNQDVYINIVGGIKINEPSIDLGIAISVASSFRNIPIDEDIAVTGEVGLTGEVRAVSFIEKRIAECKKLGFKKIVVPRSNYDVIKDTKGIEIWPVDNLRQAINIVLGRNQ
>CP026613.2|AVD43470.1|52350_53421_+|dna-integrity-scanning-protein-disa
MENFLDNKNMLYALKMISPGTPLRLGLNNVLRAKTGGLIVIATNEDVMKIVDGGFAINAEYSPSYLYELAKMDGAIVLSGDVKKILFANAQLIPDYFIETSETGTRHRTAERVAKQTGAIVIGISQRRNVITVYRGNEKYVVEDISKIFTKANQAIQTLEKYKTVLDQAITNLNALEFNDLVTIYDVALVMQKMEMVMRVTSIIEKYVIELGDEGTLVSMQLEELMGTTRIDQKLIFKDYNKENTEIKELMKKVKNLNSEELIELVNMAKLLGYSGFSESMDMPIKTRGYRILSKIHRLPTAIIENLVNYFENFQQILDASIEELDEVEGIGEIRATYIKNGLIKMKQLVLLDRHI
>CP026613.2|AVD43471.1|53509_54604_+|PIN/TRAM-domain-containing-protein
MIRKVTRILFILLGFTIGITTYLTLMKDFEILTFGKETYGYIAAVVAGIIIAILGYFIEPWVVNKVKEIAKIVDKELSKYPQTDILLGSMGLIVGFVIAYLLSGLVNRIPIVGGILSLLLYLFLGYLGMKVALKSKNDLFNIGKLGRLANPIKDKDKDKENKKDIKAIPPKVLDTSVIIDGRIADICKTGFIEGKLIIPAFVLEELRHIADSSDDLKRVRGRRGLDILNIIQKELNIEVEISERDFDDIAEVDSKLLKLAQVLNGKVVTNDYNLNKVAQFQGVEVLNINELANAIKPVAIPGEDMVVQVVKEGKEAQQGVAYLDDGTMIVVDGGRKYMNETIKVLVTSVLQTPAGRMIFAKPKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_2

150173-150251

Orphan

Consensus_repeat	Method
TGTTTATAATGTGGATAATATTTAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026613_2

>merge|CP026613|2|150173-150251|CRISPRCasFinder
TGTTTATAATGTGGATAATATTTAATGTAATAAGTTAAAGCAATATGAATCAACTGTTTATAATGTGGATAATATTATA

>CP026613|2|2|150173-150251|CRISPRCasFinder
TGTTTATAATGTGGATAATATTTAA	TGTAATAAGTTAAAGCAATATGAATCAAC
TGTTTATAATGTGGATAATATTATA

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD43562.1\|165845_166925_+\|butyrate-kinase	unknown	unknown	gnl\|CDD\|235099
CP026613.2\|AVD43566.1\|168957_169710_+\|2-oxoglutarate-oxidoreductase	unknown	unknown	gnl\|CDD\|239470
CP026613.2\|AVD43563.1\|166914_167592_+\|ATP-binding-protein	unknown	unknown	unknown
CP026613.2\|AVD43553.1\|131135_131528_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
CP026613.2\|AVD43555.1\|145223_146408_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|235596
CP026613.2\|AVD43561.1\|164921_165824_+\|phosphate-butyryltransferase	unknown	unknown	gnl\|CDD\|180267
CP026613.2\|AVD43559.1\|163436_164618_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227193
CP026613.2\|AVD43552.1\|130675_131107_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
CP026613.2\|AVD43565.1\|167878_168958_+\|3-methyl-2-oxobutanoate-dehydrogenase-subunit-VorB	unknown	unknown	gnl\|CDD\|235942
CP026613.2\|AVD43560.1\|164614_164734_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD43558.1\|162600_163440_+\|TIGR00159-family-protein	unknown	unknown	gnl\|CDD\|224539
CP026613.2\|AVD43557.1\|149153_149693_+\|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein	unknown	unknown	gnl\|CDD\|274161
CP026613.2\|AVD43548.1\|127307_128141_+\|energy-coupling-factor-transporter-ATPase	unknown	unknown	gnl\|CDD\|275313
CP026613.2\|AVD43549.1\|128128_128995_+\|energy-coupling-factor-transporter-ATPase	unknown	unknown	gnl\|CDD\|237455
CP026613.2\|AVD43564.1\|167634_167850_+\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|225131
CP026613.2\|AVD43550.1\|128988_129792_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
CP026613.2\|AVD43556.1\|146780_149132_+\|anaerobic-ribonucleoside-triphosphate-reductase	unknown	unknown	gnl\|CDD\|235937
CP026613.2\|AVD43567.1\|169710_170268_+\|2-oxoacid:ferredoxin-oxidoreductase-subunit-gamma	unknown	unknown	gnl\|CDD\|376567
CP026613.2\|AVD43551.1\|129824_130556_+\|tRNA-pseudouridine(38-40)-synthase-TruA	unknown	unknown	gnl\|CDD\|234577
CP026613.2\|AVD43554.1\|132036_132741_+\|N-acetylmuramoyl-L-alanine-amidase-CwlD	unknown	unknown	gnl\|CDD\|274337

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD43562.1\|165845_166925_+\|butyrate-kinase	gnl\|CDD\|235099	PRK03011, PRK03011, butyrate kinase; Provisional.	0
CP026613.2\|AVD43566.1\|168957_169710_+\|2-oxoglutarate-oxidoreductase	gnl\|CDD\|239470	cd03375, TPP_OGFOR, Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor. In the TCA cycle, OGFOR catalyzes the oxidative decarboxylation of 2-oxoglutarate to succinyl-CoA. In the reductive tricarboxylic acid cycle found in the anaerobic autotroph Hydrogenobacter thermophilus, OGFOR catalyzes the reductive carboxylation of succinyl-CoA to produce 2-oxoglutarate. Thauera aromatica OGFOR has been shown to provide reduced ferredoxin to benzoyl-CoA reductase, a key enzyme in the anaerobic metabolism of aromatic compounds. OGFOR is dependent on TPP and a divalent metal cation for activity.	1.15077e-77
CP026613.2\|AVD43553.1\|131135_131528_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	3.31674e-84
CP026613.2\|AVD43555.1\|145223_146408_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|235596	PRK05764, PRK05764, aspartate aminotransferase; Provisional.	7.27196e-180
CP026613.2\|AVD43561.1\|164921_165824_+\|phosphate-butyryltransferase	gnl\|CDD\|180267	PRK05805, PRK05805, phosphate butyryltransferase; Validated.	1.26101e-179
CP026613.2\|AVD43559.1\|163436_164618_+\|hypothetical-protein	gnl\|CDD\|227193	COG4856, COG4856, Uncharacterized protein conserved in bacteria [Function unknown].	2.38896e-22
CP026613.2\|AVD43552.1\|130675_131107_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	1.05591e-98
CP026613.2\|AVD43565.1\|167878_168958_+\|3-methyl-2-oxobutanoate-dehydrogenase-subunit-VorB	gnl\|CDD\|235942	PRK07119, PRK07119, 2-ketoisovalerate ferredoxin reductase; Validated.	0
CP026613.2\|AVD43558.1\|162600_163440_+\|TIGR00159-family-protein	gnl\|CDD\|224539	COG1624, COG1624, Uncharacterized conserved protein [Function unknown].	1.4029e-80
CP026613.2\|AVD43557.1\|149153_149693_+\|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein	gnl\|CDD\|274161	TIGR02491, Anaerobic_ribonucleoside-triphosphate_reductase, anaerobic ribonucleoside-triphosphate reductase activating protein. This enzyme is a member of the radical-SAM family (pfam04055) and utilizes S-adenosyl methionine, an iron-sulfur cluster and a reductant (dihydroflavodoxin) to produce a glycine-centered radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, TIGR02487). The two components form an alpha-2/beta-2 heterodimer. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism, Protein fate, Protein modification and repair].	1.03956e-50
CP026613.2\|AVD43548.1\|127307_128141_+\|energy-coupling-factor-transporter-ATPase	gnl\|CDD\|275313	TIGR04520, ECF_ATPase_1, energy-coupling factor transporter ATPase. Members of this family are ATP-binding cassette (ABC) proteins by homology, but belong to energy coupling factor (ECF) transport systems. The architecture in general is two ATPase subunits (or a double-length fusion protein), a T component, and a substrate capture (S) component that is highly variable, and may be interchangeable in genomes with only one T component. This model identifies many but not examples of the upstream member of the pair of ECF ATPases in Firmicutes and Mollicutes. [Transport and binding proteins, Unknown substrate].	4.67177e-174
CP026613.2\|AVD43549.1\|128128_128995_+\|energy-coupling-factor-transporter-ATPase	gnl\|CDD\|237455	PRK13637, cbiO, energy-coupling factor transporter ATPase.	0
CP026613.2\|AVD43564.1\|167634_167850_+\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|225131	COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion].	6.6539e-10
CP026613.2\|AVD43550.1\|128988_129792_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	8.11538e-50
CP026613.2\|AVD43556.1\|146780_149132_+\|anaerobic-ribonucleoside-triphosphate-reductase	gnl\|CDD\|235937	PRK07111, PRK07111, anaerobic ribonucleoside triphosphate reductase; Provisional.	0
CP026613.2\|AVD43567.1\|169710_170268_+\|2-oxoacid:ferredoxin-oxidoreductase-subunit-gamma	gnl\|CDD\|376567	pfam01558, POR, Pyruvate ferredoxin/flavodoxin oxidoreductase. This family includes a region of the large protein pyruvate-flavodoxin oxidoreductase and the whole pyruvate ferredoxin oxidoreductase gamma subunit protein. It is not known whether the gamma subunit has a catalytic or regulatory role. Pyruvate oxidoreductase (POR) catalyzes the final step in the fermentation of carbohydrates in anaerobic microorganisms. This involves the oxidative decarboxylation of pyruvate with the participation of thiamine followed by the transfer of an acetyl moiety to coenzyme A for the synthesis of acetyl-CoA. The family also includes pyruvate flavodoxin oxidoreductase as encoded by the nifJ gene in cyanobacterium which is required for growth on molecular nitrogen when iron is limited.	1.49735e-43
CP026613.2\|AVD43551.1\|129824_130556_+\|tRNA-pseudouridine(38-40)-synthase-TruA	gnl\|CDD\|234577	PRK00021, truA, tRNA pseudouridine(38-40) synthase TruA.	1.99745e-131
CP026613.2\|AVD43554.1\|132036_132741_+\|N-acetylmuramoyl-L-alanine-amidase-CwlD	gnl\|CDD\|274337	TIGR02883, spore_cwlD, N-acetylmuramoyl-L-alanine amidase CwlD. Members of this protein family are the CwlD family of N-acetylmuramoyl-L-alanine amidase. This family has been called the germination-specific N-acetylmuramoyl-L-alanine amidase. CwlD is required, along with the putative deactylase PdaA, to make muramic delta-lactam, a novel peptidoglycan constituent found only in spores. CwlD mutants show a germination defect. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination].	2.54204e-77

>CP026613.2|AVD43557.1|149153_149693_+|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein
MKIRMSSTISYDSIVDGPGLRMVIWTQGCIHNCKECHNPQTHDLCGGFYMDTEEIINKVKSLKLQKGITLSGGEPFLQPEPLEVIAREAKTNGLDVWSYTGFTFEQLLDKRNSAYFKNLNLLKQIDILVDGKFVAEKKDISLKFRGSSNQRIIDVQKSLKYKKVFLVEQYMKDDLSIAE
>CP026613.2|AVD43556.1|146780_149132_+|anaerobic-ribonucleoside-triphosphate-reductase
MVEFVKKRDGRVIPFNEDRITRAIFLAATNVAEREGIVPDYKLSEQLTQEVIKFLNHKYSESVPSVEDIQDSVVKVLIETGHAKTSEEYIIYRTERSRIRNSKTRLMKAIEEITFEDAEDADIKRENANINGNTAMGTMLQYGSTVSKEFCKTHILKPEHSFAHDNGDIHIHDMDFLNMGTLTCCQIDVKKLFNGGFSTGHGFLREPQDIISYGALAAIAIQSNQNDQHGGQSIPFFDYGLAEGVYKTFKKFYIGNLAKALKLFKGIENNDVIKNIVYNTEKETNQKVGLKRDELYLNLEKEKLIQTFDIDEELVNKMQNFAFEESYKETDKKTYQSMEAFIHNLNTMHSRAGAQVPFSSVNFGTDTSEEGRMVTKNLLLSQERGLGNGETPIFPILIFKVKEGINLNPEDPNYDLFKLSCRVSAKRLFPNFSFLDAPFNAKYYKKGEPDTEATYMGCRTRVLSNVCGSETVSGRGNISFTTVNLPRLGIKHGIINNEKANLDGFFEELDEKINLIIEQLLERLEVQGNKKMKNFPFLMGQGVWKGSDELGPEDTLKEVIKQGTLTIGFIGLAECLIALIGKHHGESKEAQELGLKIVSHMRDKMDEATDKYKLNFSLMGTPAEGLSGRFTKIDKKVYGEIKGITDKEYYTNSFHVPVYYNISAYDKIEIEAPYHELTNAGHITYVELDGDPSDNLEAFETVIKAMKDLGIGYGSINHPVDRDPICGFSGVITSNICPVCGRNEDESDIKFERIRRITGYLVGTVDRFNNAKKAEVRDRVKHR
>CP026613.2|AVD43555.1|145223_146408_-|pyridoxal-phosphate-dependent-aminotransferase
MLSKRLNFITPSYTIGISSKVKEMENNGIKVINLSIGEPDFNVPNNAKSYGIDSLNKDYTKYDLVPGLKILREEICKKLIEENNCKYSIDEIVVSSGAKNSITNTLLALTDEGDEVLLPKPYWVSYPEMVKLVNAVPIFIDTKKENDFKLTKEELEKSITDKTKILVINNPSNPTGSVYTKDELIEIVDVCIQNKIYILADEIYEKICYSGEFTSIASLSEEAKDITITINGFSKSAAMTGLRLGYTASNKAIAKAMSSIQGHLISHPSLTAQYIAYGALKDCSTDIDNMVKTYKSRRDLIKSKLDSIENIGYVNPNGAFYAFIDLSKVSEKFEYKDSFSIEFCNQFLEEYNVAVVPGIAFGMDKYIRISYACSENTFLSGLNKLKEFVYKIMA
>CP026613.2|AVD43554.1|132036_132741_+|N-acetylmuramoyl-L-alanine-amidase-CwlD
MRKYIKHIIFSFAMICLVVVSIFEIKNISEDVIKYMPVTNKTIILDAGHGGIDPGALNKDKSTSEKDINLAITLKLRELIESSGGLVILTREDDSSLYKEENNKTTRQKYNENLKNRKEIISNSNANMFVSIHLNAFEQSKYYGAQTFYPKDKQDSKELSKCIQEELKRVVDKTNNREVKPRDDIYLLKENNIPSVLIECGFLSNEKESKLLTDETYQEKIAWAIYIGIQKYLS
>CP026613.2|AVD43553.1|131135_131528_+|30S-ribosomal-protein-S9
MANVQYYGTGRRKSSVARVRLVAGEGNILVNGRALENYFNYETLIRDVKQPLVLTGNENKYDVIVKVEGGGFTGQAGAIRHGISRALLKADLDLRPALKKEGFLTRDARMKERKKYGLKAARRAPQFSKR
>CP026613.2|AVD43552.1|130675_131107_+|50S-ribosomal-protein-L13
MKSYIAKPADVQRKWYLVDAEGKTLGRLATEIATVLRGKHKPTFTPHVDGGDFVVVVNAEKIVLSGKKLDQKYYRYHTGYVGGLKEISYRDMMDKKPEEVISHAVSGMLPKNKLRSRMMTRLRVFAGAEHTHAAQNPEVLNFK
>CP026613.2|AVD43551.1|129824_130556_+|tRNA-pseudouridine(38-40)-synthase-TruA
MRNIKITIQYNGKNYCGWQKQLDSLGIQGTIERAIYDITKEKVSLIGSGRTDSGVHAIGQIANFKTNSSISIESIPMALNAKLPKDISVIDACEVNDDFHSRYSAKGKTYKYLVYNSKFRNPILSEISYQVKYELDFDKMCSEAKLLLGTHDFKGFMSSGSSVKDTVRTIYDIDIIRKDDLITFEISGNGFLYNMVRIIVGTLVDIGRGRINEPFLDIIQSKTRSRCGHTAPAQGLFLKKVHY
>CP026613.2|AVD43550.1|128988_129792_+|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MLKDITIGQYYPTSSAIHKLDPRIKLVATIVFMISIFVVNKFWPYIVVLLCLLAMIKLANIPIKYIVKGVKPLKWIILFTFFINIFFLPGDEIWSFGFLTITSQGLRQAIFMAIRLIFLVVGTSLLTLTTSPIELTDGIERLLNPFKKIGLPVHELAMMMTIALRFIPTLLDETDKIMKAQMSRGADFESKNLINRAKNLVPLLVPLFVSAFRRADELAMAMEARCYRGGHNRTKMRESVISRRDYMACVFQVVYLGAIIATRFIAI
>CP026613.2|AVD43549.1|128128_128995_+|energy-coupling-factor-transporter-ATPase
MSIIVKNLTHIYNEGMPFASKALDDISFEIKDRDFVGLIGHTGSGKSTLIQHLNGLLKPSSGEIFINDFNITDKNLNLTEIRKRVGVVFQYPEYQLFEETIDKDIAFGPSNLGLEESEIHNRVKASMEAVGLDYEEFKDKSPFELSGGQKRRVAIAGVIAMNPEVLILDEPTAGLDPGGRDEIFNLIKSLHEKKNMTIILSSHSMDDMAKLAKTLIVMNHGSVEFIGTPREVFKSNASKLKDIGLDIPQVLELALKLREKGFDISEDILTLEEAKQEILKVVRGRGLC
>CP026613.2|AVD43548.1|127307_128141_+|energy-coupling-factor-transporter-ATPase
MDNIVKVNNISFEYITDEAKLKAIDNLSLDVKKGEFVAIIGHNGSGKSTLSKNLNAILMPTEGNILIDGMNTKEEERLWDIRQTAGMVFQNPDNQIVATIVEEDVAFGPENLGIEPKEIRRIVEESLKSVGMYDLRDRQPHLLSGGQKQRVAIAGIIAMRPKCIIFDEATAMLDPSGRKEVMKTIKRLNKEENITVIHITHFMEEAVEADRVVVMEKGKKILEGTPREVFSKIKMLKEIGLDVPCMTELSSLLIEEGINISGDILTVDEMVMELCRL
>CP026613.2|AVD43558.1|162600_163440_+|TIGR00159-family-protein
MLDINSFLNGFFNIILRMSIYDLIDISIVAYIFYKIFMFIKDTRAEQVFKGIIFLLLATQLSNTFKLHTVYWISLKALDYGVIAALIIFQPEFRAGLEHIGRAKFNLFGKNVNTSEETLNRNIEEIVEALYSLSRQKIGALIIMERETRISDIINTGTIIDAEISRQLLINIFIPNTPLHDGAVVIRDSKVKAAACFLPLTESKDLSKDLGTRHRAGIGVSEVSDCITLIVSEETGGVSIAKAGKLYRDISRERMMNILRSNLKTNTETRSFFKGGIFK
>CP026613.2|AVD43559.1|163436_164618_+|hypothetical-protein
MINRLKNNTKIKIISFLSAIALWMYVMAVVDPEETKGFEDIPVSISNMNDLKDKNLVIYPDEKLTADVYIKGSLSKVQSVKKEDIHVHGTIEDPIQGQKEVYLKANIPQGVTIEFKHDVLVVNLEKNIKEKRDIKVEVSGNSKKNINKIELSKEFVDVSGPRTLVKEVKSVRANLDVGNETDDFSKKLQLIPLNSDGTKVEGVTLSSSFVTAKIELLKEKIVPIRVNLNDNKDNDALKNYKLSKEQVTIKGKKEDIDKINYIKTKPIDLADLANGEEKEVSLEVPEGITLEGASITIKLNDTKQLSAEFLYSAGDIELRNIPTNMDNPSVISDVDIKVVVESTEDLSKLNKKDISLYIDLSQGPEEDSKYKIKYETTYQFKKINIEPNIVEVE
>CP026613.2|AVD43560.1|164614_164734_+|hypothetical-protein
MNKYFEYLVVTRCDKKTYKIKFVNFMFLLHLVYFSYIIK
>CP026613.2|AVD43561.1|164921_165824_+|phosphate-butyryltransferase
MRSFEEVIKFAKERGPKTISVACCQDKEVLMAVEMARKEKIANAILVGDIEKTKEIAKSIDMDIENYELIDIKDLAEASLKSVELVSQGKADMVMKGLVDTSIILKAVLNKEVGLRTGNVLSHVAVFDVEGYDRLFFVTDAAMNLAPDTNTKKQIIENACTVAHSLDISEPKVAAICAKEKVNPKMKDTVEAKELEEMYERGEIKGCMVGGPFAIDNAVSLEAAKHKGINHPVAGRADILLAPDIEGGNILYKALVFFSKSKNAGVIVGAKAPIILTSRADSEETKLNSIALGVLMAAKA
>CP026613.2|AVD43562.1|165845_166925_+|butyrate-kinase
MSKIFKILTINPGSTSTKIAVFDNEDLVFEKTLRHSSEEIGKYEKVSDQFEFRKQVIEEALKEGGVKTSELDAVVGRGGLLKPIKGGTYSVSAAMIEDLKVGVLGEHASNLGGIIAKQIGEEVNVPSYIVDPVVVDELEDVARISGMPEISRASVVHALNQKAIARRYAREINKKYEDINLIVAHMGGGVSVGAHKNGKIVDVANALDGEGPFSPERSGGLPVGALVKMCFSGKYTQDEIKKKIKGNGGLVAYLNTNDAREVEERIEAGDEKAKLVYEAMAYQISKEIGASAAVLKGDVKAILLTGGIAYSKMFTEMIADRVKFIADVKVYPGEDEMIALAQGGLRVLTGEEEAQVYDN
>CP026613.2|AVD43563.1|166914_167592_+|ATP-binding-protein
MITNDKRIRIITGHYGSGKSEFAMNYVVKLRDMVSGKVAIADLDVVNVYFRTREKKELMKSLGIQPIDSSINAPTLDLPAVSAEVMSPMVDHSYNSVIDLGGDNVGARVIGRFSHLLKEGDYDMLFVINANREKTQTSEEVIQYIKEIEKSSKLKVTGLINNTHLIRFTTIDDVLRGQKVAKEVSEKCNIPIRYVACLENLVEQLPKDLEGEIFPIKLYMREDWM
>CP026613.2|AVD43564.1|167634_167850_+|4Fe-4S-dicluster-domain-containing-protein
MAKGKVSFNQERCKGCGLCVEACPVKIIQLDSNVINKKGYNPATVFEMEKCIGCASCATMCPDVVITVERD
>CP026613.2|AVD43565.1|167878_168958_+|3-methyl-2-oxobutanoate-dehydrogenase-subunit-VorB
MAKILMKGNEAFGKAAIEAGCKYFFGYPITPQSELPEYLSRELPKIGGAFVQAESEVSAINMVYGGAGAGARVMTSSSSPGVALKQEGITYAVGAEVPCVVLNVMRGGPGLGSIQPSQADYFMSTRGGGNGDYRTPVFAPATVQEAVDMIMEAFDVADYYRSPVMVVADGMIGQMMEPVEFRAPEKKRELPPKDWATVGTKGKRKPNVINSLYLEPEVLEDHCWHLQEKFDAMEKNEVQYEMYKTEDAEFVFAAYGTTSRVVKSAIDILREEGIKAGLIRPKVLWPFPFEAFNQIPNARNILTVEMSMGQMVEDVKMAVEGRLPVYFHGRPGGMTPTPAEIVEKAKKIIAGELVAGGAR
>CP026613.2|AVD43566.1|168957_169710_+|2-oxoglutarate-oxidoreductase
MAVVFKKTEGLQDTQTHYCPGCTHGIIHRLVGEVLEELGVLGDAVGVVPVGCSVLGYKYFNCDTQEAAHGRAPAAATGIKRVHPENTVFTYQGDGDLASIGTAEIVHAAARGEKITTIFVNNTTYGMTGGQMAPTTLVGQRATTAQSGRNAETQGYPIRVSEMLATLTGAVFVERVAVDTPAHVRQAKKAIKKAFQVQQAGLGFGIVEVLSTCPTNWGLAPNDALQWLRDNMIPYYPLGNFKNVEVEEVK
>CP026613.2|AVD43567.1|169710_170268_+|2-oxoacid:ferredoxin-oxidoreductase-subunit-gamma
MSTARVICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEKFKDDVIPGGKIIVNSSLIKEKVDRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPRKEKFVPLNREALQKGMDATCSKATN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_3

597150-597257

TypeV

Consensus_repeat	Method
TATTAATTGTATTTACTTATTTGATTG	CRISPRCasFinder

1 spacers

cas14j

The CRISPR arrays of CP026613_3

>merge|CP026613|3|597150-597257|CRISPRCasFinder
TATTAATTGTATTTACTTATTTGATTGTATTACTTATTAACTGTGCTTAAGTATTAATTATATTTATTTGACTGTAGTACCTATTAATTGTATTTACTTATTTAATTG

>CP026613|3|3|597150-597257|CRISPRCasFinder
TATTAATTGTATTTACTTATTTGATTG	TATTACTTATTAACTGTGCTTAAGTATTAATTATATTTATTTGACTGTAGTACC
TATTAATTGTATTTACTTATTTAATTG

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD43930.1\|609215_609821_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP026613.2\|AVD43913.1\|585350_587588_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379314
CP026613.2\|AVD43922.1\|600556_601648_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
CP026613.2\|AVD43925.1\|604234_604804_-\|hydrolase	unknown	unknown	gnl\|CDD\|225198
CP026613.2\|AVD43927.1\|606223_606457_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD43912.1\|584330_585245_+\|tRNA-epoxyqueuosine(34)-reductase-QueG	unknown	unknown	gnl\|CDD\|272993
CP026613.2\|AVD43917.1\|592589_593708_+\|transposase	cas14j	-	gnl\|CDD\|223747
CP026613.2\|AVD43926.1\|604964_606215_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
CP026613.2\|AVD43920.1\|596517_597120_+\|DUF445-family-protein	unknown	unknown	gnl\|CDD\|226834
CP026613.2\|AVD43921.1\|597912_599832_+\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234752
CP026613.2\|AVD43928.1\|606507_607095_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP026613.2\|AVD43918.1\|594756_595518_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD43915.1\|589341_590190_+\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257
CP026613.2\|AVD43929.1\|607386_608847_+\|NADP-dependent-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|143401
CP026613.2\|AVD43919.1\|595520_596339_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378056
CP026613.2\|AVD43924.1\|602552_603893_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340412
CP026613.2\|AVD43914.1\|588836_589307_+\|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL	unknown	unknown	gnl\|CDD\|349967
CP026613.2\|AVD43923.1\|601995_602193_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367559
CP026613.2\|AVD43916.1\|590477_591482_+\|BMP-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380577
CP026613.2\|AVD44850.1\|588025_588643_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD43914.1\|588836_589307_+\|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL	gnl\|CDD\|349967	cd18094, SpoU-like_TrmL, SAM-dependent tRNA methylase related to TrmL. tRNA (Um34/Cm34) methyltransferase TrmL catalyzes the methyl transfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH at position 34 in both tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	5.50942e-94
CP026613.2\|AVD43930.1\|609215_609821_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.98889e-15
CP026613.2\|AVD43925.1\|604234_604804_-\|hydrolase	gnl\|CDD\|225198	COG2316, COG2316, Predicted hydrolase (HD superfamily) [General function prediction only].	2.44224e-43
CP026613.2\|AVD43912.1\|584330_585245_+\|tRNA-epoxyqueuosine(34)-reductase-QueG	gnl\|CDD\|272993	TIGR00276, iron-sulfur_cluster-binding_protein, epoxyqueuosine reductase. This model was rebuilt to exclude archaeal homologs, now that there is new information that bacterial members are epoxyqueuosine reductase, QueG, involved in queuosine biosynthesis for tRNA maturation. [Protein synthesis, tRNA and rRNA base modification].	6.10174e-73
CP026613.2\|AVD43917.1\|592589_593708_+\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.18365e-56
CP026613.2\|AVD43922.1\|600556_601648_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	6.44186e-23
CP026613.2\|AVD43920.1\|596517_597120_+\|DUF445-family-protein	gnl\|CDD\|226834	COG4399, COG4399, Uncharacterized protein conserved in bacteria [Function unknown].	4.65122e-22
CP026613.2\|AVD43921.1\|597912_599832_+\|threonine--tRNA-ligase	gnl\|CDD\|234752	PRK00413, thrS, threonyl-tRNA synthetase; Reviewed.	0
CP026613.2\|AVD43928.1\|606507_607095_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.18346e-15
CP026613.2\|AVD43926.1\|604964_606215_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.2188e-58
CP026613.2\|AVD43915.1\|589341_590190_+\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	7.86682e-108
CP026613.2\|AVD43929.1\|607386_608847_+\|NADP-dependent-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|143401	cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11. NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase (NP-GAPDH, EC=1.2.1.9) catalyzes the irreversible oxidation of glyceraldehyde 3-phosphate to 3-phosphoglycerate generating NADPH for biosynthetic reactions. This CD also includes the Arabidopsis thaliana osmotic-stress-inducible ALDH family 11, ALDH11A3 and similar sequences. In autotrophic eukaryotes, NP-GAPDH generates NADPH for biosynthetic processes from photosynthetic glyceraldehyde-3-phosphate exported from the chloroplast and catalyzes one of the classic glycolytic bypass reactions unique to plants.	0
CP026613.2\|AVD43919.1\|595520_596339_+\|hypothetical-protein	gnl\|CDD\|378056	pfam08812, YtxC, YtxC-like family. This family includes proteins similar to B. subtilis YtxC an uncharacterized protein.	1.10485e-55
CP026613.2\|AVD43924.1\|602552_603893_+\|ATP-binding-protein	gnl\|CDD\|340412	cd16935, HATPase_AgrC-ComD-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Staphylococcus aureus AgrC and Streptococcus pneumoniae ComD which are involved in quorum sensing. This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) including Staphylococcus aureus AgrC which is an HK of the accessory gene regulator (agr) quorum sensing two-component regulatory system (TCS) AgrC-AgrA. The agr system plays a part in the transition from persistent to virulent phenotype. This family also includes Streptococcus pneumoniae ComD HK of the ComD-ComE TCS, involved in quorum sensing and genetic competence.	1.92723e-38
CP026613.2\|AVD43913.1\|585350_587588_+\|ATP-binding-protein	gnl\|CDD\|379314	pfam13654, AAA_32, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	0
CP026613.2\|AVD43923.1\|601995_602193_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|367559	pfam03551, PadR, Transcriptional regulator PadR-like family. Members of this family are transcriptional regulators that appear to be related to the pfam01047 family. This family includes PadR, a protein that is involved in negative regulation of phenolic acid metabolism.	4.63441e-09
CP026613.2\|AVD43916.1\|590477_591482_+\|BMP-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380577	cd06354, PBP1_PrnA-like, periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea. Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea. The PnrA lipoprotein, also known as Tp0319 or TmpC, represents a novel family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC) transport system (pnrABCDE). It shows a striking structural similarity to another basic membrane lipoprotein Med which regulates the competence transcription factor gene, comK, in Bacillus subtilis. The members of PnrA-like subgroup are likely to have similar nucleoside-binding functions and a similar type 1 periplasmic sugar-binding protein-like fold.	2.26184e-85
CP026613.2\|AVD44850.1\|588025_588643_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	5.08843e-109

>CP026613.2|AVD43920.1|596517_597120_+|DUF445-family-protein
MDNLIRILILAVIGGFIGYVTNVVAIRLIFRPIEPIKIPILNIEIVGLIPKRRVEIAANVGEIIQEEFLSMDEILANIITDEDKEEVVRYIKARVKIIIHEKVSFIPGGIKNMIQDYLGEIIESEVKKSIDELSKNIINKANERIDIQKMVEDKINELDLYELEEIIIRIAKKELKHIEFLGLVLGFLIGIVQGLVTMFI
>CP026613.2|AVD43919.1|595520_596339_+|hypothetical-protein
MVEKDNISSMKFLRNNNVNDRLIYTNDIVEVVIDSAKQEVLNKKILNGTKAEQRALNIDEISTEITSMIISIMKEKLLKEYILKCYGRTYPEDKNNIYIYSLNIFAKKEIFMRETVFTRVRNYIEENDFINVEGFIRFRMREFMKYISAIGDIAVEEYLIKKDQDEFIRVLKYFIDTQEEKIDLLKVHIMEDNTFVLYDKNGNKIDSIDDEEIINMVIRENLNYEDFLISTLLTLCPKKIEILDLLNNNCSKEIIDTVEAIFENKVSIIMEN
>CP026613.2|AVD43918.1|594756_595518_+|hypothetical-protein
MEFTREPFILDDDLCLALVDKRISYLMENELKLRNIEIIKTVECKELYESIKYHPDICICNLGKGDIIVAPNVYNQYKELLSRYKFNIIKGEANLLNRYPYDIPYNIAIVGDYAIHNFKYTDKAILDYIENNKLKKINIEQGYSKCSICIVDRTSIITSDKGIWKSMKNTEIECLLIEKGHINLFEMNYGFIGGCTGLISKDKLAFCGDVKKHPDYERIKSFVESKNKEIVTLSCENLLDIGSIVPLMTRKER
>CP026613.2|AVD43917.1|592589_593708_+|transposase
MIAVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIDVYKNDKETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALKDLENAYNKFFKEKAGFPKFKSKKINRFSYKTNFTNGNIMYCGQRIKLPKLGMVKIRDKQVPKGRILNATISKEPSGRYYVSLCCTDVDIEAFENANNQIGLDLGIKEFCISSSGELIENPKYLKKSLNKLAKLQRELSRKTIGSLNRNKARLKVARLQEHIANQRKDFLQKLSTKLIKENDIICIEDLQVKNMIRNRKLSRLISDVSWSEFIRQLEYKANWYGRQIVKVGKFFASSQICNKCGYKNEEVKDLNIRDWICPSCNETHDRDINASINILKEGLRLITIQNK
>CP026613.2|AVD43916.1|590477_591482_+|BMP-family-ABC-transporter-substrate-binding-protein
MRFKRILIFILTVAMTAGMLVGCDSNQSNNPSSSKDNKSDISDKSNSKKSVSMILDIEGTNNEAMNNSALLALNNAQKKLNIDTNKVESDDSSTFSNSIDILCNDNYDLIIAVGARFAKPLEMVAKKYPKQQFAIIDYEYDKQPSNITSISYEDNKSGYLAGLIAGKMTESDKVGFIGGTKSSSRDKFETGFKEGVKFSNSSIKDISVEYADVFKDRKSVESIAKKMMDNGVDIIFSTTEDDSKAVIGAVRTKNKKVIATNKDQHELAPENVISSIVKDFENSTYNLIQSFVKGNYKGGKVIENTVKSGSTGLAQNSSQNIPPDVLEYVSKNNK
>CP026613.2|AVD43915.1|589341_590190_+|DegV-family-protein
MKNLKIICDSLSDVPKDLLDKYDIDIVSLTVILEEKEYKDRIDISGDEFYKRLREENVYPKTSQATYAQFKEIFEKYTNEGREILYIAGSATATGTYQSAVMAKNDVEGKIYTYDSNLLCMGTGLLVIKAGELASEGKTVDEILPVLDELKEKAFVIFSVDTLEYLQKGGRISSTKAAIGSILNIKPILEIRDGLVSQISQVRGKKNVISKMMELIKSNCGDDLSDQIVYIGYSDDFKEKEQLSKVMEDELRPKEIRFFQIGVCIGAHAGPGVTGIICLKNK
>CP026613.2|AVD43914.1|588836_589307_+|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL
MSLNIVLVEPEIPQNTGNIIRTCAATGSTLHLVKPLGFSLDDKHLKRCGLDYWDIADIQYYDSFEELQEKYPNSKYFFSTTKAKQSHSDVKYEENCFIVFGKETKGLPETLLKANMDTCIRVPMLDVEKARSLNLSNSVAIVVYEALRQIGYPNMR
>CP026613.2|AVD44850.1|588025_588643_+|endonuclease-III
MLDELEKLYPDAKCELNYGTAFELLIATILSAQCTDVRVNKVTSELFKKYNTAKDFANLSIEEISKEIKSCGLYKSKSQKIKDTSEQLCELYDGEVPDSLEKLIKLPGVGRKTAGVVLSNAFNHPAIAVDTHVFRVSNRIGIVDEPNPQKTEFALMEAIPKERWSHSHHVLIFHGRRMCKARNPECASCPIKEDCNYYKELNETK
>CP026613.2|AVD43913.1|585350_587588_+|ATP-binding-protein
MKYNNTSEINPLDCILGQERAVEAMELGLKINNPAYNIYIAGESGTGKSTYALKVLNEYASKKNTHKDWCYIYNFENPREPIIVELEKGFGRELKKDMEKLIESLLEDFKNAFESENFEIEKNKLLDEYEIEKDMLLKQIKKYGEEKGFKLKQSKMGIVFIPLKEEEDESDESDEEFYKAKRELENMAIQVVYKIRNLEEIAEKAVLELEEEIAKLVVEPHIKRLCEKYENYDKIQDYLENIKKDIIEYMYLFYLDEEELKDKYDKEHFIKYKINLFVDNGSSKNKESAPVVVEINPSPANLFGKAEYDYANGNIKTDFTKLLSGAFHRANGGYLVLYADQLLKYTMSWEILKKTLQTKKVILETQTAIKPENMPLDVKLVLIGSHYIYDILYRYDEDFEKYFKVFVDFDSEMDKNEGNEEGIARFIASQCDKNNLRHFTKSAVEEVVKFSTRLSGDLEKLSTKFNKIMEVVIEGSAYAEFRNSEYTEQCDVKKAISEKRKRINRVETHMDESIENGFTLIETEGRKVGVINGLSVLSTGEYSFGRASRITATTSPGSKGIVNIEREVNMSGSIHNKGVLILGGYLSENFAQDLLLSLNAYVCFEQNYGGIDGDSASSAELYVLLSSLSGVPIKQNIAVTGSINQKGDIQVVGGISEKIEGFYSICKTKGLNGEQGVIIPRKNQRNLVLSDEVNDAVQDGKFKIYTVERVEEAIEILTDVKFEEIRKLVKEKLISFSKIQTVSKE
>CP026613.2|AVD43912.1|584330_585245_+|tRNA-epoxyqueuosine(34)-reductase-QueG
MNNRELKEFCNLIGLNCVGVAGVDKYDNLENILKDRYKKGYLTGMEEPIIENRINPRNIMEDANSIIVCAFPYYINRQEKNKNSNLSKYCHGKDYHIVVKKFLQQICDYISKKVTDFKYKIFADNGPLVDRYLAYLSGIGYFGINNNIITDEYGSYVFIGYIVNNYKFEEDKPLEKSCFKCGKCVKYCPGNAILGNYDMNPKKCLSYITQKKGDLSQEEKAVLKSGKKVFGCDICQEVCPHNVEIPTTHILEFKENIIDYLDYDEIQNISNKEFKRRYGDRAFSWRGKNIIKRNMEIILDKYND
>CP026613.2|AVD43921.1|597912_599832_+|threonine--tRNA-ligase
MIKVALKDGSIKEFENAISVMDVAKSISEGLARNVVAASVNGEVVGLDHIIDTDCDLNLFKFEDKEGKEVFRHTSAHILAQAIKRLYPEAKLAIGPSIENGFYYDIDLDHRLVPEDLEKIEAEMKKIAKEDLKIERFELPRNEALELMKEQGEDYKVELISDLPESEIISFYKQGDFTDLCRGPHLPSTKKVKAVKLQSVAGAYWRGDENNKMLQRIYGTSFEKNKDLEEYLHLLEEAKKRDHRKLGKELGLFMIPEEGPGFPMFLPKGMELKNELLKFWREIHRKAGYIEIESPIILNRKLWETSGHWYHYKENMYTVKIDDEDYAIKPMNCPGGLIYYNSQLHSYRDFPMRVAELGRVHRHELSGALQGLMRVRAFTQDDSHIFMLPEQIKDEIKGVANLIDGIYKTFGFEYNLELSTRPENSMGSNEEWEAAENGLREALEELGLPYTINEGDGAFYGPKIDFHLKDCLGRTWQCGTIQLDMQLPRQFDNTYIGQDGEKHRPVMIHRVAFGSIERFIGILIEHYAGKFPVWLSPTQVKILPISDKFMDYANEVKKELFDKGIRVELDDRAEKIGFKIREAQLEKVPYMLIVGEKEVADNNVSVRSRDKGEIGSIKLDEFIASISKEIESRESIIQD
>CP026613.2|AVD43922.1|600556_601648_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MIEKVGEKSKIIKTSKEYKRTIIEEKDREWTQKLNDILSRNNFSNDELDKIKELIPKEILTSENVGEVVTEDGYARPEYDEVFKSLFTLNNEYGLLVNFINDILKDAPYANRNIKPFTQIKRIIRLETDPTINYIGEKRPRLDILAEDEENNHINIEMQRAFENDYLERAEYYLSRVHGRKLEEGKEYKEIGKTIGIHILNHVKYNHIEDYVNCLRLTMDGHPEIYSSKTALYFIELPKIHKSDYIVNRIMLWGKLIINPSSLDVRVIAKNDSIIKKALDRLKELGSNEEYLLNLKRGAYIMNKSRNFKEEIERETAIRVAKEKDYKIIIMLKKNGFKLDDILNKFNAFDLSEDEIKEVYENN
>CP026613.2|AVD43923.1|601995_602193_-|PadR-family-transcriptional-regulator
MTIASDVIRCDTKTSILKHLLKKDSYSYEINKSILEKTKGLYELKEAILYTAFRRLEQSGAITSY
>CP026613.2|AVD43924.1|602552_603893_+|ATP-binding-protein
MIKSSLFWNIFIAISFMIEWFLCKKMLDYTSEKKISNKKINFCIVGIIVFANIIYFFDAPLNIRVIISMIVTIAFYKISYDVRFIKSVLISLIYWMLLIAIDALSISLTVWLNSINDMSNMGTGDIYRIESIILGKILLISALFLYRALKIKFNIEINKRTLFYIVIPIVANIASFFVIFKYIFNLKFGNLIHNFQFVVISVVLLVSSITLILIAKKLQQYNTLVVENNMIKNTLKCENEYYEDIEKKYLKTRLLSHDMKNHILCINAMIKKGIDVTSYLNNLQVEIQSNDLLFNTGNFILDAILSEKKEVCDRNDIELKIGINFSCCEAVELVDICHIFSNILDNAIEACNKIDSGNRVICVKGDIMQNFYLIKVENTKTNKIITKNGDILTDKKGSLHGLGIKSVKNSVNKYGGNVVIEYDDKKFVVKIAIPLRNVKKVVNNII
>CP026613.2|AVD43925.1|604234_604804_-|hydrolase
MSYMPTLEQAWEILRKYNKEEFHIRHAQIVSGVMRYYAKEYDPERVEFWEIVGLLHDLDFEMYPDEHCVKQRELMTELDLDKSIIDSTISHGYGLTGSDVKPEQFMEKVLFAVDELTGLIGAAAIMRPSKSVSDLELKSVKKKFKDKSFAAGCSRDVIRSGAEMLGWELDKLIQTTIEAMRSLIPEMAI
>CP026613.2|AVD43926.1|604964_606215_-|MFS-transporter
MVKSLNTFNKNFNLMILGQIISLFGASILKFALSLYILDITGKAEIFATILAVSSIPIIIFSPIGGAIADIFNRRNLMVIFDFSSSITVLVLALFLFNNNGSILLVGIIMTILSVISTMYQPTVQSSTPLLVDNEHLMNANGIVAGVASLTNIAGPVLGGVLYGVIGINAIIVISCVSFFLSAIMEIFIQIPFIKQEQTSNIIKTIFIDINDGIVHICKENRFILKILFLAIAINLFLSSMLIVGIPYIVKITMGASNFLYGLAEGAISFSSLVAAVSIGIFSKYLKITNLYISFTICALMFIPMAFSVYPFILNTGFPVPFLIFIVSSMLIFFTTTLISIYAITIIQLKTPNELLGKVMSILFAGTTIAMPLGQVMYGKLFDLLSDRVYIIILGVGFITLIIAFISKITLRNEKL
>CP026613.2|AVD43927.1|606223_606457_-|hypothetical-protein
MIELIQRLNDVIYKINDKLNIHTKLVDPSSELMPLYSMLSIIVSIFLIILGIKVRKKVLIVIAIIAIIVNVLIILDR
>CP026613.2|AVD43928.1|606507_607095_-|TetR/AcrR-family-transcriptional-regulator
MINMAKSFTEIEKDNIRKRLISECEINWSKYGYKKTNIDELCSKSGIAKGTFYTFFDSKEKLFFEVLNGIQNRLISSVDEILGNMPQKEGFAKALKMLYRLYDKNPFLYSPNNTDYITLLNKIPKEMLSQLEYNNVQSFYSLIERHNLKLKIEKEKAFGVCNALLSSLLLKEDIGYDYIEVFDFMVDNLVEHILE
>CP026613.2|AVD43929.1|607386_608847_+|NADP-dependent-glyceraldehyde-3-phosphate-dehydrogenase
MFNELRTKENVYKNLINGKWVESNSRKPIEIYSPIDNSLVGKVQSMTKHEVDEAIKNTKESIKVWADMPVYKRANIFHKAADLLLENIDEIANILVLEIAKDMKSARAEVERTADFLRYTADVGKNMEGEAISGDNFPGGTRNKMSYVSRVPLGTVLAISPFNYPVNLSMSKIAPALIGGNAVVLKPATQGAISALHVVEIMRKAGIPDGVLNTITGRGSEIGDYVVTHKGINFINFTGSTEVGQHISKISGMVPLLLELGGKDAAIVLEDADLDFAAKNIVSGAYSYSGQRCTAVKRILVQESVADKLVEKIKPLVENLTIGNPKDEVVITPLIDNKATDFVQGLVDDALHKGAKLIVGNIRKNNLFYPTLLDNVNTDMKIAWEEPFGPVLPIIRVKDISQAIEIANQSEYGLQSSVFTSDIDRAFYIADKLEVGTVQINNKTERGPDHFPFLGVKASGMGTQGVKYSIEAMTRPKAVVVNVRGL
>CP026613.2|AVD43930.1|609215_609821_+|TetR/AcrR-family-transcriptional-regulator
MPKGIVLTPEQQAERREKIVAVALSLMAENGFQKTSMREIAVLANMGKSSLYDFFKTKDEIVVYAVEKEIEKTIQQVHRIIDDELSPQQCLRKIMLNHLRFPKQYRTVLMWLNTESDYLEEEYRKRLKDARYAYQDIIKSVIDNGVTTGIFRKTDTALVTRLLINSMLSISYTSRLSDSSEKMLDETMNIFLHGIMNDGGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_6

1244809-1245435

Orphan

I-A

Consensus_repeat	Method
GTTTTATATTAACTAAGTGGTATGTAAAG	PILER-CR
GTTTTATATTAACTAAGTGGTATGTAAAG	CRISPRCasFinder
GTTTTATATTAACTAAGTGGTATGTAAAG	CRT

9 spacers

The CRISPR arrays of CP026613_6

>merge|CP026613|6|1244809-1245435|PILER-CR,CRISPRCasFinder,CRT
GTTTTATATTAACTAAGTGGTATGTAAAGCTCAAAATTAAATAGTTGGCTATGGTTAAGGGATTGCCGTTTTATATTAACTAAGTGGTATGTAAAGATAATAGCAGATATGATGTTTAATAACGGAAGTATAAGGTTTTATATTAACTAAGTGGTATGTAAAGCTGAATGAACCTAAGGTAGTTGAACAGATTGAAAAGACGTTTTATATTAACTAAGTGGTATGTAAAGTATGTCAGGACTTCTTAAACCATATTCAGCATACACTCGTTTTATATTAACTAAGTGGTATGTAAAGAAATTTAATATTGCTGGAAAAGGAGAAATGGATATTGGTTTTATATTAACTAAGTGGTATGTAAAGAATGCTGAACTTAAAGTAATGATGCTATTTTGGGACAGTTTTATATTAATTAAGTGGTATGTAAAGAAATTTGCAAGGCTAAATTGCCCCTTAATTAATGGTGGTTTTATATTAACTAAGTGGTATGTAAAGAGTTTTTCTATATATTCAGATATTTCACTTTTATCTTGTTTTATATTAACTAAGTGGTATGTAAAGGAAATATGTATAGAAGCATTGAAACAAGATAAATATTGTTTTATATTAACTAAGTGGTATGTAAAG

>CP026613|6|2|1244809-1245435|PILER-CR
GTTTTATATTAACTAAGTGGTATGTAAAG	CTCAAAATTAAATAGTTGGCTATGGTTAAGGGATTGCC
GTTTTATATTAACTAAGTGGTATGTAAAG	ATAATAGCAGATATGATGTTTAATAACGGAAGTATAAG
GTTTTATATTAACTAAGTGGTATGTAAAG	CTGAATGAACCTAAGGTAGTTGAACAGATTGAAAAGAC
GTTTTATATTAACTAAGTGGTATGTAAAG	TATGTCAGGACTTCTTAAACCATATTCAGCATACACTC
GTTTTATATTAACTAAGTGGTATGTAAAG	AAATTTAATATTGCTGGAAAAGGAGAAATGGATATTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AATGCTGAACTTAAAGTAATGATGCTATTTTGGGACA
GTTTTATATTAATTAAGTGGTATGTAAAG	AAATTTGCAAGGCTAAATTGCCCCTTAATTAATGGTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AGTTTTTCTATATATTCAGATATTTCACTTTTATCTT
GTTTTATATTAACTAAGTGGTATGTAAAG	GAAATATGTATAGAAGCATTGAAACAAGATAAATATT
GTTTTATATTAACTAAGTGGTATGTAAAG

>CP026613|6|6|1244809-1245435|CRISPRCasFinder
GTTTTATATTAACTAAGTGGTATGTAAAG	CTCAAAATTAAATAGTTGGCTATGGTTAAGGGATTGCC
GTTTTATATTAACTAAGTGGTATGTAAAG	ATAATAGCAGATATGATGTTTAATAACGGAAGTATAAG
GTTTTATATTAACTAAGTGGTATGTAAAG	CTGAATGAACCTAAGGTAGTTGAACAGATTGAAAAGAC
GTTTTATATTAACTAAGTGGTATGTAAAG	TATGTCAGGACTTCTTAAACCATATTCAGCATACACTC
GTTTTATATTAACTAAGTGGTATGTAAAG	AAATTTAATATTGCTGGAAAAGGAGAAATGGATATTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AATGCTGAACTTAAAGTAATGATGCTATTTTGGGACA
GTTTTATATTAATTAAGTGGTATGTAAAG	AAATTTGCAAGGCTAAATTGCCCCTTAATTAATGGTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AGTTTTTCTATATATTCAGATATTTCACTTTTATCTT
GTTTTATATTAACTAAGTGGTATGTAAAG	GAAATATGTATAGAAGCATTGAAACAAGATAAATATT
GTTTTATATTAACTAAGTGGTATGTAAAG

>CP026613|6|1|1244809-1245435|CRT
GTTTTATATTAACTAAGTGGTATGTAAAG	CTCAAAATTAAATAGTTGGCTATGGTTAAGGGATTGCC
GTTTTATATTAACTAAGTGGTATGTAAAG	ATAATAGCAGATATGATGTTTAATAACGGAAGTATAAG
GTTTTATATTAACTAAGTGGTATGTAAAG	CTGAATGAACCTAAGGTAGTTGAACAGATTGAAAAGAC
GTTTTATATTAACTAAGTGGTATGTAAAG	TATGTCAGGACTTCTTAAACCATATTCAGCATACACTC
GTTTTATATTAACTAAGTGGTATGTAAAG	AAATTTAATATTGCTGGAAAAGGAGAAATGGATATTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AATGCTGAACTTAAAGTAATGATGCTATTTTGGGACA
GTTTTATATTAATTAAGTGGTATGTAAAG	AAATTTGCAAGGCTAAATTGCCCCTTAATTAATGGTG
GTTTTATATTAACTAAGTGGTATGTAAAG	AGTTTTTCTATATATTCAGATATTTCACTTTTATCTT
GTTTTATATTAACTAAGTGGTATGTAAAG	GAAATATGTATAGAAGCATTGAAACAAGATAAATATT
GTTTTATATTAACTAAGTGGTATGTAAAG

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD44446.1\|1234929_1236009_+\|endolytic-transglycosylase-MltG	unknown	unknown	gnl\|CDD\|376862
CP026613.2\|AVD44452.1\|1244363_1244522_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44447.1\|1236180_1236855_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|226607
CP026613.2\|AVD44462.1\|1250368_1250785_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|180266
CP026613.2\|AVD44448.1\|1236841_1238089_+\|U32-family-peptidase	unknown	unknown	gnl\|CDD\|223896
CP026613.2\|AVD44459.1\|1248363_1248528_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366353
CP026613.2\|AVD44444.1\|1232376_1233189_+\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350160
CP026613.2\|AVD44451.1\|1241928_1242741_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44461.1\|1249681_1249876_-\|DNA-directed-RNA-polymerase	unknown	unknown	unknown
CP026613.2\|AVD44445.1\|1233376_1234717_+\|pyrimidine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|274244
CP026613.2\|AXL65677.1\|1242780_1244226_+\|cell-wall-binding-repeat-containing-protein	unknown	unknown	gnl\|CDD\|380277
CP026613.2\|AVD44449.1\|1238160_1239825_+\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|223839
CP026613.2\|AVD44456.1\|1246887_1247547_-\|DUF4386-family-protein	unknown	unknown	unknown
CP026613.2\|AVD44458.1\|1248180_1248348_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|372237
CP026613.2\|AVD44455.1\|1246241_1246430_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44454.1\|1245825_1246077_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44450.1\|1240232_1241747_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|238206
CP026613.2\|AVD44457.1\|1247602_1248040_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
CP026613.2\|AVD44453.1\|1245512_1245647_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP026613.2\|AVD44460.1\|1249063_1249573_+\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|377417

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD44446.1\|1234929_1236009_+\|endolytic-transglycosylase-MltG	gnl\|CDD\|376862	pfam02618, YceG, YceG-like family. This family of proteins is found in bacteria. Proteins in this family are typically between 332 and 389 amino acids in length. This family was previously incorrectly annotated and names as aminodeoxychorismate lyase. The structure of YceG was solved by X-ray crystallography.	1.61962e-116
CP026613.2\|AVD44447.1\|1236180_1236855_+\|O-methyltransferase	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	4.81502e-60
CP026613.2\|AVD44448.1\|1236841_1238089_+\|U32-family-peptidase	gnl\|CDD\|223896	COG0826, COG0826, Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones].	4.85095e-146
CP026613.2\|AVD44459.1\|1248363_1248528_-\|hypothetical-protein	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	1.40608e-06
CP026613.2\|AVD44444.1\|1232376_1233189_+\|purine-nucleoside-phosphorylase	gnl\|CDD\|350160	cd09009, PNP-EcPNPII_like, purine nucleoside phosphorylases similar to human PNP and Escherichia coli PNP-II (XapA). Human PNP catalyzes the reversible phosphorolysis of the purine nucleosides and deoxynucleosides inosine, guanosine, deoxyinosine, and deoxyguanosine. Patients with PNP deficiency typically present with severe immunodeficiency, neurological dysfunction, and autoimmunity. Escherichia coli PNPII, product of the xapA/pndA gene, catalyzes the phosphorolysis of xanthosine, inosine and guanosine with equal efficiency and has been referred to as xanthosine phosphorylase and inosine-guanosine phosphorylase. E. coli PNPII is also capable of converting nicotinamide to nicotinamide riboside, and may be involved in the NAD+ salvage pathway. It is one of two purine nucleoside phosphorylases found in E. coli, which also contains PNPI, which displays a different substrate specificity and belongs to a different subgroup of the nucleoside phosphorylase-I (NP-I) family than PNPII. NP-I family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	2.44708e-173
CP026613.2\|AVD44462.1\|1250368_1250785_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|180266	PRK05803, PRK05803, RNA polymerase sporulation sigma factor SigK.	1.7187e-70
CP026613.2\|AVD44445.1\|1233376_1234717_+\|pyrimidine-nucleoside-phosphorylase	gnl\|CDD\|274244	TIGR02644, Thymidine_phosphorylase, pyrimidine-nucleoside phosphorylase. In general, members of this protein family are designated pyrimidine-nucleoside phosphorylase, enzyme family EC 2.4.2.2, as in Bacillus subtilis, and more narrowly as the enzyme family EC 2.4.2.4, thymidine phosphorylase (alternate name: pyrimidine phosphorylase), as in Escherichia coli. The set of proteins encompassed by this model is designated subfamily rather than equivalog for this reason; the protein name from this model should be used when TIGR02643 does not score above trusted cutoff. [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
CP026613.2\|AXL65677.1\|1242780_1244226_+\|cell-wall-binding-repeat-containing-protein	gnl\|CDD\|380277	NF033435, S-layer_Clost, S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.	6.77802e-19
CP026613.2\|AVD44449.1\|1238160_1239825_+\|penicillin-binding-protein-2	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	5.95773e-97
CP026613.2\|AVD44458.1\|1248180_1248348_-\|conjugal-transfer-protein	gnl\|CDD\|372237	pfam12642, TpcC, Conjugative transposon protein TcpC. This family of proteins are annotated as conjugative transposon protein TcpC. The transfer clostridial plasmid (tcp) locus is part of some conjugative antibiotic resistance and virulence plasmids. TcpC was one of five genes whose products had low-level sequence identity to Tn916 proteins, having similarity to ORF13 homologs from Tn916, Tn5397, and CW459tet. This family of proteins is found in bacteria. Proteins in this family are typically between 302 and 351 amino acids in length.	0.00147936
CP026613.2\|AVD44450.1\|1240232_1241747_-\|recombinase-family-protein	gnl\|CDD\|238206	cd00338, Ser_Recombinase, Serine Recombinase family, catalytic domain; a DNA binding domain may be present either N- or C-terminal to the catalytic domain. These enzymes perform site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and serine recombinase. Serine recombinases demonstrate functional versatility and include resolvases, invertases, integrases, and transposases. Resolvases and invertases (i.e. Tn3, gamma-delta, Tn5044 resolvases, Gin and Hin invertases) in this family contain a C-terminal DNA binding domain and comprise a major phylogenic group. Also included are phage- and bacterial-encoded recombinases such as phiC31 integrase, SpoIVCA excisionase, and Tn4451 TnpX transposase. These integrases and transposases have larger C-terminal domains compared to resolvases/invertases and are referred to as large serine recombinases. Also belonging to this family are proteins with N-terminal DNA binding domains similar to IS607- and IS1535-transposases from Helicobacter and Mycobacterium.	7.13593e-29
CP026613.2\|AVD44457.1\|1247602_1248040_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	8.13782e-10
CP026613.2\|AVD44453.1\|1245512_1245647_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00050055
CP026613.2\|AVD44460.1\|1249063_1249573_+\|VanZ-family-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	1.07615e-16

>CP026613.2|AVD44452.1|1244363_1244522_+|hypothetical-protein
MDNFLLSILASILASYIVYLISKLFRKRKKPLKAGTKSGWELDFKIKFHKFK
>CP026613.2|AXL65677.1|1242780_1244226_+|cell-wall-binding-repeat-containing-protein
MKIKKLLTIGLSLSMFIASCHISANALDKIESIKGADKYETTGIIADKQNYTTAILINADSTMADGLSASGLAGATNAPILLTKKNNIPNATLKRLEKAKKVYIIGGENSIDKYTETVLKGKGIEIKRLQGSDRIKTSYNVAKEINSINKVNKVILTNAFKGEPDAMSAAPVAVREKAAIVLTDGKSVPFNTTGVESYVIGGTSSMNDKLVNDTNSTRLGGTDRYDTNKKIINKFYGGVKEFYIASGTDLVYALVGSTVAKNNAIVLVNNDSNKSVLKSTTKLTAIGNLSDSILQQCLNVTKNIGDSNTGRQYTVEDAANAVKKLLGVKKFYYNENYPEDEDVIFLLDENFEFSGKQFYAFGYVTENSEGDVRYCVEKNDMSKVYTYNVSGVMQVCNPDDYKKKEMISEEKAKQLALEECARKHKVGVDLLKVNIAYIDDFDDIKVYAVRIDSKPHPNQTYGWYFIDVYSGYAYKDVWNNI
>CP026613.2|AVD44451.1|1241928_1242741_+|hypothetical-protein
MCNFKKILGLFMIIMLSVSMVACSSGGDSKDESKGKDKQFIEDLGKGLKKRWDLASKEEAGTLNLEQNEAYEKFVEVEMDAVSKYKDAEFDSPELGKLAKDYIKALEDSKEAIKYYSNDQLKFSELWEKPYNERSTILLTLVDKFGLKVDEKEFKVLKDNAQIVNEENDLKEKVNAMAKGIKFEKVKDEYDWKTYQATVENTSDLDLQDFYLDINLIDKDGVIIETQTSTSVNGTWKKGQKVRLEFSTDKDFEKIEWTPHYSANNYSITE
>CP026613.2|AVD44450.1|1240232_1241747_-|recombinase-family-protein
MSVAIYLRKSRADEEAEKQGEFETLSRHKSTLLKLAKEQSLDVIEIKEELVSGESIIHRPKMLELLKEVEENKYDAVLVMDLDRLGRGDMKDQGIILETFKESKTKIITPRKTYDLTDEFDEEYSEFEAFMARKELKLISRRMQRGRIKSVEEGNFIGTSAPFGYDAVTTGRKERILVPNKDADIVRTIFDLYINEDMGCSKISKYLNNLGIKTATGANWYNSAITNIIKNKVYCGYIQWQKKDYKKSKNPNKIKTVKLRPKDEWIEAKGKHEPLISEITWKKAQNILKKNGHVSYGNQIKNPLAGIVICKNCGRPLVYRPYADHNYIICYHPGCNKSSRFEFIEAAILKSLEDTVKKYQLKTSDIDLDKNNKDSNIEFQKRVLKGLETELKELSKQKNKLYDLLERGIYDEDTFIERSNNISSRTEEIKDSIKTVKNRLSTVKKDNAKIIEDIKTVLSLYHDSDSLGKNKLLKSVIDKAVYYKSKEQKLDSFELMVHLKLHED
>CP026613.2|AVD44449.1|1238160_1239825_+|penicillin-binding-protein-2
MSKKKTPFLKKVGKRSWCVFTIILIIYSALIYRLVDIQVLKGDKYKQSVESQSVEKVELNSGRGIIYDRNNKKLTDTSKYQVLVVEKEKLNNNYKILELIKKATKMNDLDIYKAVQEQLTRPIIQIQAKNIDKNMKKELEKNGIMIEEKTMRYSKDGLLSHTIGYIKEDDKSGQSGIEKSMDSVLRNSNEKYISAFKAGDAGNEKSLNILKGSVKTIDNKDKDRHLKTTIDYNIQRKLEQILNKEENPTAAIISEVSTGEILAMCSRPNFDQNDISKSLKGKNGEFENRVIKATYPPGSVFKMVVLFSALENGVIDENYTYNCTGKTKVGNTNEILRCNKRDGHGFQNLRQAFSNSCNPAFLDIAMKLGKEKILKSAEKLHLFEKVDIGLDEEKIREAPKNISIRNLAIGQENIEFTPLQINQMTQIMANNGTFKPLYLYKSLVDNDMNTIKTYKSSKKEELISPYVCTQVKEYMKSVSRTGTAKDLKDIEGGCGVKTGTAQSSLNKKAIDHGWITGFYPEERPKYVITVLVEGTQKGNKSATPIFKEICESIQ
>CP026613.2|AVD44448.1|1236841_1238089_+|U32-family-peptidase
MELNKVELLAPAGDLERLKIAITYGADAVYIGGEIFGMRSAAKNFSKEDMAEGVAFAHERGKKVFVTVNIIPHNEDFLQLEDYLLELEEIGIDAVIIADPGVLSVIKKVIPNMEIHLSTQANTTNYLSANFWYEHGIKRVVVARELSFDEISEIRAKTPLDMDIEAFMHGAMCISYSGRCLISNYMTGRDANKGSCAQSCRWQYHLVEEKRPGEYFPIYEDERGTFFFNSKDLCMIEYIPELIKSGITSLKIEGRMKTAYYVATVVRAYRMAIDEFYKDPENWKFNPMWMEELKKGSHRHFTSGFYLNKPTTEDQNYQSASYVRNYDFIGIVRETEDEDGLIVVEQRNKMCVGDEIEVMGPYKETMFTKIEAMYNEEGEAIESAPHPRQIVKLKLSVKVGKDYMLRKVIEEKVEE
>CP026613.2|AVD44447.1|1236180_1236855_+|O-methyltransferase
MSNIVNDLVEDYIRVTLKEKEGFLKDLEIYAEENSVPIIHKEVSDLLKVLLKIQKPKRVLEVGCAIGYSSIFFATIIGKDADIITVERNEKMIEKAKENIKLAGFENNITILEGDAEEKLSQVQGEFDLIFIDAAKGQYKLFFDLVIDKLKDGGLLVSDNILYKGMVAHDDFVVRRKKTIVKRMRNYLDYICNCDYLSTSLIPIGDGVALSYKESKRGDVDGIK
>CP026613.2|AVD44446.1|1234929_1236009_+|endolytic-transglycosylase-MltG
MNFKENRLKIAALIIVILIILAGIFVSMQIGPYNKNNKKDVIIDIPNGASIGKISDILYENKLIKNELLFKLLVKVSNKAPSIKSGTYLLNQSYSNNDIISLLVSGKIYQDGIKVTIPEGATSKEIIAMLVSKNLGDKATFENLIKKPQEFYDKFPYLKEDGITSLEGFLYPETYYFNSKKQSEEDILSEMLKVFDSKYTDKFKKKQKKLNMTLQEVMEMASIIEKEAVLDKDRPIIASVFYNRLKVGMPLQSDATIQYIFEERKKIVTYDDLKIDSPYNSYKNKGLPPTPISNPGIKSIEAALYPDKTDYLYFVAKIDGGNNYSTNYQDHLKYVKEYKEARDKQSKDTKATNKENTKK
>CP026613.2|AVD44445.1|1233376_1234717_+|pyrimidine-nucleoside-phosphorylase
MEISIMRMYDIIRKKRDNLELSKKEINYFIENYSKGDIPDYQASALLMSIYLNKMNKQETVHLTEAMMNSGDMINLSEIDGIKVDKHSTGGVGDKTTIALIPLVASCGAPVAKMSGRGLGHTGGTIDKLESIPGFSTEMEISKFINSVNKSKIAVCGQSAKVAIADKKIYALRDVTATVDNISLIASSVMSKKLASGADAIVLDVKTGDGAFMKTLEESFDLAKSMVDIGTGMNRDTIGIVTDMDEPLGFAVGNSLEVIEAIETLKGNGPKDLVELCEVLGAYMLVLSKVAYDFDDGVEKIRESIKSGDAIHKLKEFIENQGGNKDVVDDYSLFKKSKYKYPVKSTKSGYINKIKAEDVGVSAMILGAGRETKDDVLDLSVGIILEKKVGDYINEGEVLAYMYYNDEQKLSLAKDRFIDSYSIVDSKVEKNKLIYGIVTKEGIKKF
>CP026613.2|AVD44444.1|1232376_1233189_+|purine-nucleoside-phosphorylase
MFEKIAQSSKFINAKINIKPKIGLILGSGLGDLANDIEDSVTIKYSEIPNFPISTVAGHAGQLVIGKLEGKEVIAMQGRFHYYEGYSQKEATFPVRVMKELGVEVLIVTNAAGGVNKEFKAGDLMLIRDHINFSGSNPLVGKNDDRLGDRFPDMSDAYSSRYVDVVKNCAKECNIDVKEGVYMFFSGPNYETPAEVRMAQILGADAVGMSTVPEVIVASHSNIGVIGISCITNMAAGILNQSLSHEEVIETTQKVKSEFMNLVKTTVKNL
>CP026613.2|AVD44453.1|1245512_1245647_-|XRE-family-transcriptional-regulator
MFEKTNINTSVMNIIESDERPIRDDELIIFAKIFGVSINYILGL
>CP026613.2|AVD44454.1|1245825_1246077_+|hypothetical-protein
MSSYFITRGDVMKILQQFKPYKYDKEKNIEYDEKIIANQNTEVYIVYPRISDEENRRRWEEFNEVAKEVAINIAMKKVETVES
>CP026613.2|AVD44455.1|1246241_1246430_-|hypothetical-protein
MIGFKKRDTKYLLKIVARAHGISVAEAIVEMQTTINNARNNPDPEKQAEFIISLNTIFTKNL
>CP026613.2|AVD44456.1|1246887_1247547_-|DUF4386-family-protein
MNIVVGVLSILSAFCIAGSMIGLMFSFGYPKIIRENPIIILKRMQNKKTMISLLFYLFGIGGFMVVQASIALRFIEQSKGEFIWSNFAYINGIIYGVLLFVGILRYTKTFPMLSNQMINKQITEKEAGQLYKVLNTYIGETMTEHVAFVFLSFMIFCNSMSLLSINYVANWIGLLGIIIAIGLFIGNLEFLGIKKLFIVNRVFSSLSAFWLLLLGICII
>CP026613.2|AVD44457.1|1247602_1248040_-|MarR-family-transcriptional-regulator
MEEHEIFNTFVQILNWASERNKNSKSYGTDDKLYIAEIHTLVMIGKMPGILQKELCKEVGVTKGRMSVIIAHLQEKNLIEMRREQGNGCTIPIYLTTLGEQIYHNHNEQEMNMKIQIYQVLSKCSQEEIEKFNGILRDILEILRQ
>CP026613.2|AVD44458.1|1248180_1248348_-|conjugal-transfer-protein
MFKKKENEKKVIKQKNSRTMKIGLSVKFIDNQTKVTQISQFELRIHKDSNWKMLK
>CP026613.2|AVD44459.1|1248363_1248528_-|hypothetical-protein
MFFHSTYNNGSYISHIGIYIGNNHMYHVNNPIGYADLTSAYLQQHLIGAGRIKQ
>CP026613.2|AVD44460.1|1249063_1249573_+|VanZ-family-protein
MKSKKYNITKGLFIVYIIILTWIILFKLQFDVSSIETMNLRSINLVPFAGSLIINNKVDISEIILNVAIFIPFGIYICMLKEEWSFIKKVIPIFITSLAFETLQYIFALGASDITDLIGNTLGGIIGIAVFMLLSKIFKNNTIKIINILAFIVTIIVVLFLGLVIFANL
>CP026613.2|AVD44461.1|1249681_1249876_-|DNA-directed-RNA-polymerase
MSVIVMCSRCGKEIDKYRNKYITYYEKNTNAEIKVCINCALDLLEKTRENQELNIQEFQDTIIL
>CP026613.2|AVD44462.1|1250368_1250785_-|sigma-70-family-RNA-polymerase-sigma-factor
MAALKSFEKPLTPEEEIEYLTKFKIENDKSAKDTLIERNMRLVAYIAKKYNNSTEDQDDLISIGTIGLIKAIETYNIDKGTRLATYASRCIENEILMNIRSNKKNKTQVSLQDPIGTDKEGNEIHTTFYMLFSTIIYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_7

1581083-1581180

Orphan

Consensus_repeat	Method
TTATATTAACATAACTATATTTTACTTGATAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026613_7

>merge|CP026613|7|1581083-1581180|CRISPRCasFinder
TTATATTAACATAACTATATTTTACTTGATAAACTAAAATATTTCTACCTTATTATCTAAAATAATTATATTAATATAACTATATTTTACTTGATAAA

>CP026613|7|7|1581083-1581180|CRISPRCasFinder
TTATATTAACATAACTATATTTTACTTGATAAA	CTAAAATATTTCTACCTTATTATCTAAAATAA
TTATATTAATATAACTATATTTTACTTGATAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD44746.1\|1579356_1580361_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|340424
CP026613.2\|AVD44750.1\|1584253_1584373_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44742.1\|1573345_1574494_+\|DUF362-domain-containing-protein	unknown	unknown	gnl\|CDD\|224917
CP026613.2\|AVD44747.1\|1580384_1581059_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|223816
CP026613.2\|AVD44740.1\|1570275_1571157_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
CP026613.2\|AVD44751.1\|1584395_1584710_+\|DUF961-domain-containing-protein	unknown	unknown	gnl\|CDD\|368761
CP026613.2\|AVD44748.1\|1581346_1582114_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
CP026613.2\|AVD44741.1\|1572709_1573255_+\|NADH-peroxidase	unknown	unknown	gnl\|CDD\|153105
CP026613.2\|AVD44753.1\|1585140_1586526_+\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
CP026613.2\|AVD44754.1\|1586528_1586681_+\|conjugal-transfer-protein	unknown	unknown	unknown
CP026613.2\|AVD44743.1\|1574546_1575812_+\|dihydroorotase	unknown	unknown	gnl\|CDD\|236479
CP026613.2\|AVD44756.1\|1587951_1588173_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44873.1\|1571572_1572487_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
CP026613.2\|AVD44757.1\|1588289_1588787_+\|antirestriction-protein-ArdA	unknown	unknown	gnl\|CDD\|377800
CP026613.2\|AVD44749.1\|1582100_1584038_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
CP026613.2\|AVD44745.1\|1578013_1579246_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|223914
CP026613.2\|AVD44755.1\|1586703_1587909_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367101
CP026613.2\|AVD44752.1\|1584725_1585112_+\|DUF961-domain-containing-protein	unknown	unknown	gnl\|CDD\|368761
CP026613.2\|AVD44744.1\|1577331_1578006_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
CP026613.2\|AXL65684.1\|1576096_1577329_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD44746.1\|1579356_1580361_-\|sensor-histidine-kinase	gnl\|CDD\|340424	cd16948, HATPase_BceS-YxdK-YvcQ-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Bacillus subtilis BceS, YxdK, and Bacillus thuringiensis YvcQ. This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) such as Bacillus subtilis BceS and Bacillus thuringiensis YvcQ, the HKs of the two-component regulatory system (TCSs) BceS-BceR and YvcQ-YvcP, repsectively, which are both involved in regulating bacitracin resistance. It also includes the HATPase domain of YxdK, the HK of YxdK-YxdJ TCS involved in sensing antimicrobial compounds.	3.55793e-54
CP026613.2\|AVD44751.1\|1584395_1584710_+\|DUF961-domain-containing-protein	gnl\|CDD\|368761	pfam06125, DUF961, Bacterial protein of unknown function (DUF961). This family consists of several hypothetical bacterial proteins of unknown function.	7.00664e-46
CP026613.2\|AVD44742.1\|1573345_1574494_+\|DUF362-domain-containing-protein	gnl\|CDD\|224917	COG2006, COG2006, Uncharacterized conserved protein [Function unknown].	3.03391e-76
CP026613.2\|AVD44747.1\|1580384_1581059_-\|DNA-binding-response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	6.598e-73
CP026613.2\|AVD44740.1\|1570275_1571157_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.82771e-75
CP026613.2\|AVD44755.1\|1586703_1587909_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|367101	pfam02486, Rep_trans, Replication initiation factor. Plasmid replication is initiated by the replication initiation factor (REP). This family represents a probable topoisomerase that makes a sequence-specific single-stranded nick in the plasmid DNA at the origin of replication. Human proteins also belong to this family, including myelin transcription factor 2 and cerebrin-50.	3.89405e-86
CP026613.2\|AVD44748.1\|1581346_1582114_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	3.19794e-102
CP026613.2\|AVD44741.1\|1572709_1573255_+\|NADH-peroxidase	gnl\|CDD\|153105	cd01046, Rubrerythrin_like, rubrerythrin-like, diiron-binding domain. Rubrerythrin-like domain, similar to rubrerythrin, a nonheme iron binding domain found in many air-sensitive bacteria and archaea, and member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Rubrerythrin is thought to reduce hydrogen peroxide as part of an oxidative stress protection system. The rubrerythrin protein has two domains, a binuclear metal center located within a four-helix bundle of the rubrerythrin domain, and a rubredoxin domain. The Rubrerythrin-like domains in this CD are singular domains (no C-terminus rubredoxin domain) and are phylogenetically distinct from rubrerythrin domains of rubrerythrin-rubredoxin proteins.	9.79702e-55
CP026613.2\|AVD44753.1\|1585140_1586526_+\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	4.90599e-31
CP026613.2\|AVD44757.1\|1588289_1588787_+\|antirestriction-protein-ArdA	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	2.59639e-45
CP026613.2\|AVD44743.1\|1574546_1575812_+\|dihydroorotase	gnl\|CDD\|236479	PRK09357, pyrC, dihydroorotase; Validated.	0
CP026613.2\|AVD44873.1\|1571572_1572487_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	9.64018e-11
CP026613.2\|AVD44749.1\|1582100_1584038_+\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	1.73546e-05
CP026613.2\|AVD44745.1\|1578013_1579246_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|223914	COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane].	7.07051e-21
CP026613.2\|AVD44752.1\|1584725_1585112_+\|DUF961-domain-containing-protein	gnl\|CDD\|368761	pfam06125, DUF961, Bacterial protein of unknown function (DUF961). This family consists of several hypothetical bacterial proteins of unknown function.	9.54557e-44
CP026613.2\|AVD44744.1\|1577331_1578006_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.19086e-109
CP026613.2\|AXL65684.1\|1576096_1577329_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	6.78715e-36

>CP026613.2|AVD44747.1|1580384_1581059_-|DNA-binding-response-regulator
MFKIMVVEDDVSLKNIIAECLTKWGHNVHQIENLENIIEEFKNYKPQLVLLDINLPFYDGFYWCNEIRKISKVPIIFISSRNSNMDVIMGVNLGADDYIQKPFSIDVLVAKVNALLRRTYNFVDNNSNQIIHNGVTLDLSTATINYEDNTIELTKNEIKILHELMKYKGQIVSRNKLMKKLWDNDWFVDDNTLTVNVNRIRSKLNEIGLEDFIETKRGLGYIIN
>CP026613.2|AVD44746.1|1579356_1580361_-|sensor-histidine-kinase
MSFKDFLKDKLGFLVYNFTFLIFTIAVIIFSPVDVFLIDTILYILVINVVFLFLYLFISYIKKNKFLDKIKNDTFKININTTELAKCKNEEKIYLNIIKNHQYQCNNIINKNIKKFEENKEILNMWVHDVKIPIAIIKLTLEQNENLIDEKISDDIDSEIFRIENSVEKILYLSRLEDFHKDFLIQEVNIEKIIRNIIKKYSKYFISKKIILNLNNLNFKVLSDEKWLYFIFEQLLSNSLKYSSLGDNISIYCKRSKNYLQLRVEDTGCGIKKEDLNRIFNKGFTGNNGRNNSKSTGLGLYLVKELCDKLGHKIAVDSEYNQYTKFTITFKCDL
>CP026613.2|AVD44745.1|1578013_1579246_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MSFLKKFKNKRFRNNSFKSNNFRSSSFGSSGFNSKNKGFKNNPFKNKRFKIYAGIAVIILLILGVLAYVDSKNTKLQANENFIETYTIPENEKIFINGMVVPKQTKDFNISGDYELSDVNVTNGQKVNQGDLLFTAKNPTIIAEIDSLKSQLSQYKKQKISLSDIAENRDAIASINAQITTLNSQIASLDKKAYDRVTAPFDGTVYLNDQTGNPDQPVSFMTIQGLEFYMKGQASEQDLPKMKIDQMVNILVFSTDQKLTGRISFISDKPSTPNTEMGAQQNTLSYYDINIAFDNQEGLVNGFHLQASLEVSNSSFKIPASCVLKDKKHSYVFKDLDGILKKQIVDVASQNDDFAVVRGGLEQGDIIIKHPTKEMKEGDPVQGDGVTAGSNNNGDTTPNKKVEEVNMDVN
>CP026613.2|AVD44744.1|1577331_1578006_-|ABC-transporter-ATP-binding-protein
MLIKLENIQKYYKVGKDELHVLKSLNLEIESGEFVMIMGKSGSGKTTLLNILGFLDVFDEGRYIFDGTDVTNLSENERSVFRNINIGFVFQQFNLIETLNVYQNVELPLIYNKSLKKSNREEIVKDKLSSVGLLDKLKQKPLQLSGGQQQRVAIARCLANDPQIIFADEPTGALDSETSREIMELLTRLNKQGKTIIMVTHDQDLTKYATKVIRLKDGVFTSEV
>CP026613.2|AXL65684.1|1576096_1577329_-|ABC-transporter-permease
MSLLKNSLANLKGHKLRVFVALLWIIIGITSVILVSSIGNGFQKEIKKSVNNVNPNKTTISFESADNTGLTDDMSIFLKPFNAKDLEELSFVEGVERIAPSRDGFNLDSVYSSQASFDKKTTYVDVGPVKKDSKINLICGRDFSLDDEKRKVILLTLQSTSEIFENPEDALGHGININGTIFEIIGVLDDSQQNQAGGFFGGYQDMQFTTSLIPKKAFDTLMSQNSYSNEIYQLDLVSSKGYNVNEVANNVISKLYEMHPGINGSYTTPDPTEQTAYLESINSNVNKYVSIITVVAMFVGGIGVMNIMYVSVMERQREIGIRRAIGAKPRSILFQFLVEAVFITVCGGILGTIVGFAATNYVSKYIGFEAIPSLNSLFYAIIATILTGVVFGLIPAFKASKLDPIKAIYK
>CP026613.2|AVD44743.1|1574546_1575812_+|dihydroorotase
MILIKNGRVIDPKSQRDENIDLIIKENKIYKIGKFDESDEYEKIIDASGNVVAPGLVDVHVHFRDPGFTYKEDIESGAKSAARGGFTTVICMANTNPIVDNEDTFNYVKEKSKNACINVLQAAAITKGFEGKELVDMEALKKAGVPGFTDDGLPLMDSNLIMEAMVKAKELDVPLSFHEEDPSLVGNPGVNAGKIASELGLKGASSVAEDVMVARDCMLALKTGAKVDIQHISSGVSVDMVRFAKYLGANVVAEASPHHFTLTEEDVLEFGTNAKMNPPLRSKWDRDKIIEGLNDGTIEIIATDHAPHSREEKDREFIKAPSGIIGLETSLALGITNLVHKNHLSMMQLIEKMSTNPAKLYNLNTGFIEEGAVADIVIFNPEEEWTVESFVSKADNSPFKGKSLYGKINYTICNGKIVYNA
>CP026613.2|AVD44742.1|1573345_1574494_+|DUF362-domain-containing-protein
MKSVSVRSCKTYNYEEVRLSIEKNLEDIGGIDKFVKKGSKVLIKPNLLMKKKPEEATTTHPMVVKVVCEKLLELNCDITIADSPGGPYNQSSLKSIYKASGIEEVANELGIKLNYDVSDVKVHSEKAHVLKYMDIIKPVVDSDYIINLCKLKTHIMATFTGGTKNLYGCIAGLKKAEIHYRFPTEELFCENVLLDICDYIKPTLTIMDGIVGMEGDGPSAGTTREIGVLLASQNPYAIDVVACKIISLIPNRVATIRGAIKRGYIREDFSDIEILGEDINDLIIKNYKVPNVSKDLRLFSVKLPKFLNEPISKLITPKPVVRFQDCIKCGKCKEACPAATIEIGTKGAIIDLSKCIRCYCCHELCPKKAIDVKRNFVFKYVK
>CP026613.2|AVD44741.1|1572709_1573255_+|NADH-peroxidase
MKKFVCTVCGYIHEGDAAPAQCPVCKVGADKFEEMKGEMVWADEHRIGVAQGVDAEIIEGLRANFTGECTEVGMYLAMSRQADREGYPEVAEAYKRIAFEEAEHAAKFAELLGEVVVADTKENLRVRVDAEYGATDGKLKLAKRAKELGLDAIHDTVHEMCKDEARHGKAFLGLLNRYFGK
>CP026613.2|AVD44873.1|1571572_1572487_+|DMT-family-transporter
MKKYFGEIGLIFIAIIWGSGFVATQFALDGGLTPLQIITLRFFLAAIIMNLLFFKQIRANMGKKLLKAGGILGIFLFLAFTVQTIGLMYTTPSKNAFITAANVVIVPFIGFILYRRKLDKIGIISSLVALIGIGILSLEADFSINFGDFLTLICSFGFAFHIFFTSEFAKDNNPMALTAIQFTVAFLMSVIVQAFAGQLKMEAELSGYMGTMYLAVFSTTIGFLFQTICQKRVDGTRTAIILSTEAVFGTIFSIIILKELITAKLVIGSILIFVAIITAETKLSFLKSKKVKLKDSEESSLESI
>CP026613.2|AVD44740.1|1570275_1571157_-|polysaccharide-deacetylase
MVKKRKKKTVALTIIVVIVIGIFSMAWADMSRKKEMKETQERLKAERLEKERIEKEKNEPIIGAKKEAIKEYGYDAKIVWDKLNKYDYSNNGEKIVFLTFDDGPSTTNTPQVLDILKRHGVRGTFFIKGDSLERKGANEILKRTFDEGNAIAHHSYTHDYKKLYPGRSLNLDTFVNELNKTDEAMKKVLGKNFSSNVVRCPGGYMSWKNMEPLGNYLKEKNMASIDWNALNADAEGKKKNAQELFEHAKKSSEGKEMVVLLMHDTYGKQETVNALDQIITYFKDNGYQFKILI
>CP026613.2|AVD44748.1|1581346_1582114_+|ABC-transporter-ATP-binding-protein
MEEILSVENIKKEYGRKGSKHEALRGITFKVYKGEFVGIMGSSGAGKSTLLNIISTIDLPSSGDIYINGKNTIKMKQNELADFRRDNLGFVFQDSNLLDTLTIKENIMLPLSLKNERVSVIENRINEISRELNIESILDKYPSEVSGGQKQRGAVCRAIATKPSLVLADEPTGALDSKSARDLLNCLLKLNKDSNKTILMVTHDAISASFCNRILFIKDGIIFTEIVKGESNREFYNKIVNTVSLIGGVNKNDFI
>CP026613.2|AVD44749.1|1582100_1584038_+|ABC-transporter-permease
MTLFRIAMKNVKNSFFNYLMYFISIVFSVFIFFSFKSIEYNKALSSLGEKTRMSINTSSILIVAFVFLFIYYSNSFFFNRRSREVGTYSLLGMRKNQIGKIFLYETFLMGIVAILIGIFLGLLFSKLMTMMLVKLMNEMIVVNMNLSIKALVQTLAVFLTIFIVIGIRNTIVIRNKRIIELFNKPPEKCRFKKFIKLKGALGVLLITISYLMSISYFIAENIMFSVFILVTIIPGTFLFFSSVMYMIIDAVKKRKGFYYKGQNLIAFSELGFKLKSNSSVLAIIAILIATSVTILGFTISLYYDIDRNISENYKYSYTINLGNSHVNNKIDKLLDKYKKDNKIIFDKTIELIDKDINLEMYYKNGNSYIEDRTSVDIIRESDFKKLRQYQNNNYEELISKESVYYVSDSYKKILFKDFEIEKINLHFKDTSECDINLFTVQKTILEPEINSQATFDLIVVKDKVFNQLKLHGDSRLIRLIDIKNEKKELNLTLKLKNIVSENMEFTYPFNFTSSIESYDNLIKLSGLMLFIGIFLSVVFLLCTGSIILFKQLSNIYDDRERYIMLTKLGANNKDIEKIISKQLKVIFLMPLVVGTVHNLFAMSIVQKFIPRSLLVPIIITLVIYFIGYFIYYFLTLKYALNMITE
>CP026613.2|AVD44750.1|1584253_1584373_+|hypothetical-protein
MRCLFFYPILKGSELMKTKNQESKGRSPLFKTIKHSFSQ
>CP026613.2|AVD44751.1|1584395_1584710_+|DUF961-domain-containing-protein
MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLYSDVQRADDIVVVLPAEAGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMIKE
>CP026613.2|AVD44752.1|1584725_1585112_+|DUF961-domain-containing-protein
MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK
>CP026613.2|AVD44753.1|1585140_1586526_+|DNA-translocase-FtsK
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSVISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
>CP026613.2|AVD44754.1|1586528_1586681_+|conjugal-transfer-protein
MLAGVAIATPALNPPYLTGGYKSTGNSQKNIRKSFGYKGFTKFQRMSNGL
>CP026613.2|AVD44755.1|1586703_1587909_+|XRE-family-transcriptional-regulator
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAPLEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAPTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK
>CP026613.2|AVD44756.1|1587951_1588173_+|hypothetical-protein
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRIIGA
>CP026613.2|AVD44757.1|1588289_1588787_+|antirestriction-protein-ArdA
MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_8

1745884-1747032

TypeV

I-A

Consensus_repeat	Method
GTTTTATATTAACTATGTGGTATGTAAAT	PILER-CR
GTTTTATATTAACTATGTGGTATGTAAAT	CRISPRCasFinder
GTTTTATATTAACTATGTGGTATGTAAAT	CRT

17 spacers

cas14j

The CRISPR arrays of CP026613_8

>merge|CP026613|8|1745884-1747032|PILER-CR,CRISPRCasFinder,CRT
GTTTTATATTAACTATGTGGTATGTAAATCTTGTAGATAATGCAGAAGAAGAAGAAAAACAGATTGTTTTATATTAACTATGTGGTATGTAAATGATGCTACCTTATTTTTATCTAATCCCCAAATAAACTGTTTTATATTAACTATGTGGTATGTAAATTTATTTCTTAACCAGTCAAATAATCTATTTTGTCCTGGTTTTATATTAACTATGTGGTATGTAAATATCATAGTTTATTAACACAGGAAACGAGGTTAGTTCGTTTTATATTAACTATGTGGTATGTAAATAACTCTTTTAAAAAAGAATATACGATTTTCAGAGAAGGTTTTATATTAACTATGTGGTATGTAAATTATTAATTGCTTATCTATTAATTCTTTTAATTTTTCAGTTTTATATTAACTATGTGGTATGTAAATTGAAGGGTTATAAAAAAAATAATAGCGAAAAGGGCGGTTTTATATTAACTATGTGGTATGTAAATCACGAAAAAATCAGAAGGGGAGGGGGGTTATTTAAAAGTTTTATATTAACTATGTGGTATGTAAATTTAAAACTTGAATTATTTCAAAAAGCTAAACATCAAGGTTTTATATTAACTATGTGGTATGTAAATTTTAATTGCCCTTCATAGAATATTATTTCACCTTCTTGTTTTATATTAACTATGTGGTATGTAAATTATGAGAAAGTTGAATTTAAAGGCGAAATGAACATGGGTTTTATATTAACTATGTGGTATGTAAATTCTTTATATTGATATCCAAGAATAAGCGCACGTTCTTGTTTTATATTAACTATGTGGTATGTAAATTTGCTTAGCGCAATAACTTTTGAAAATACTACAGGAGTGTTTTATATTAACTATGTGGTATGTAAATTAAGATGTCCAAATGCTAAGAGAGAATTCTTAGGATAGTTTTATATTAACTATGTGGTATGTAAATAAAAGAAGTTTTGAAAGTAAATGTGTAAATAATAATAGTTTTATATTAACTATGTGGTATGTAAATGAAGTCAACAATTTGGCTATTGGTTAAGTACAACTAGCGTTTTATATTAACTATGTGGTATGTAAATAAAGAAAATTGGGTTTTTGATTAAGAACTTGCGAATGTTTTATATTAACTATGTGGTATGTAAAT

>CP026613|8|3|1745884-1747032|PILER-CR
GTTTTATATTAACTATGTGGTATGTAAAT	CTTGTAGATAATGCAGAAGAAGAAGAAAAACAGATT
GTTTTATATTAACTATGTGGTATGTAAAT	GATGCTACCTTATTTTTATCTAATCCCCAAATAAACT
GTTTTATATTAACTATGTGGTATGTAAAT	TTATTTCTTAACCAGTCAAATAATCTATTTTGTCCTG
GTTTTATATTAACTATGTGGTATGTAAAT	ATCATAGTTTATTAACACAGGAAACGAGGTTAGTTC
GTTTTATATTAACTATGTGGTATGTAAAT	AACTCTTTTAAAAAAGAATATACGATTTTCAGAGAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TATTAATTGCTTATCTATTAATTCTTTTAATTTTTCA
GTTTTATATTAACTATGTGGTATGTAAAT	TGAAGGGTTATAAAAAAAATAATAGCGAAAAGGGCG
GTTTTATATTAACTATGTGGTATGTAAAT	CACGAAAAAATCAGAAGGGGAGGGGGGTTATTTAAAA
GTTTTATATTAACTATGTGGTATGTAAAT	TTAAAACTTGAATTATTTCAAAAAGCTAAACATCAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TTTAATTGCCCTTCATAGAATATTATTTCACCTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TATGAGAAAGTTGAATTTAAAGGCGAAATGAACATGG
GTTTTATATTAACTATGTGGTATGTAAAT	TCTTTATATTGATATCCAAGAATAAGCGCACGTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TTGCTTAGCGCAATAACTTTTGAAAATACTACAGGAGT
GTTTTATATTAACTATGTGGTATGTAAAT	TAAGATGTCCAAATGCTAAGAGAGAATTCTTAGGATA
GTTTTATATTAACTATGTGGTATGTAAAT	AAAAGAAGTTTTGAAAGTAAATGTGTAAATAATAATA
GTTTTATATTAACTATGTGGTATGTAAAT	GAAGTCAACAATTTGGCTATTGGTTAAGTACAACTAGC
GTTTTATATTAACTATGTGGTATGTAAAT	AAAGAAAATTGGGTTTTTGATTAAGAACTTGCGAAT
GTTTTATATTAACTATGTGGTATGTAAAT

>CP026613|8|8|1745884-1747032|CRISPRCasFinder
GTTTTATATTAACTATGTGGTATGTAAAT	CTTGTAGATAATGCAGAAGAAGAAGAAAAACAGATT
GTTTTATATTAACTATGTGGTATGTAAAT	GATGCTACCTTATTTTTATCTAATCCCCAAATAAACT
GTTTTATATTAACTATGTGGTATGTAAAT	TTATTTCTTAACCAGTCAAATAATCTATTTTGTCCTG
GTTTTATATTAACTATGTGGTATGTAAAT	ATCATAGTTTATTAACACAGGAAACGAGGTTAGTTC
GTTTTATATTAACTATGTGGTATGTAAAT	AACTCTTTTAAAAAAGAATATACGATTTTCAGAGAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TATTAATTGCTTATCTATTAATTCTTTTAATTTTTCA
GTTTTATATTAACTATGTGGTATGTAAAT	TGAAGGGTTATAAAAAAAATAATAGCGAAAAGGGCG
GTTTTATATTAACTATGTGGTATGTAAAT	CACGAAAAAATCAGAAGGGGAGGGGGGTTATTTAAAA
GTTTTATATTAACTATGTGGTATGTAAAT	TTAAAACTTGAATTATTTCAAAAAGCTAAACATCAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TTTAATTGCCCTTCATAGAATATTATTTCACCTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TATGAGAAAGTTGAATTTAAAGGCGAAATGAACATGG
GTTTTATATTAACTATGTGGTATGTAAAT	TCTTTATATTGATATCCAAGAATAAGCGCACGTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TTGCTTAGCGCAATAACTTTTGAAAATACTACAGGAGT
GTTTTATATTAACTATGTGGTATGTAAAT	TAAGATGTCCAAATGCTAAGAGAGAATTCTTAGGATA
GTTTTATATTAACTATGTGGTATGTAAAT	AAAAGAAGTTTTGAAAGTAAATGTGTAAATAATAATA
GTTTTATATTAACTATGTGGTATGTAAAT	GAAGTCAACAATTTGGCTATTGGTTAAGTACAACTAGC
GTTTTATATTAACTATGTGGTATGTAAAT	AAAGAAAATTGGGTTTTTGATTAAGAACTTGCGAAT
GTTTTATATTAACTATGTGGTATGTAAAT

>CP026613|8|2|1745884-1747032|CRT
GTTTTATATTAACTATGTGGTATGTAAAT	CTTGTAGATAATGCAGAAGAAGAAGAAAAACAGATT
GTTTTATATTAACTATGTGGTATGTAAAT	GATGCTACCTTATTTTTATCTAATCCCCAAATAAACT
GTTTTATATTAACTATGTGGTATGTAAAT	TTATTTCTTAACCAGTCAAATAATCTATTTTGTCCTG
GTTTTATATTAACTATGTGGTATGTAAAT	ATCATAGTTTATTAACACAGGAAACGAGGTTAGTTC
GTTTTATATTAACTATGTGGTATGTAAAT	AACTCTTTTAAAAAAGAATATACGATTTTCAGAGAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TATTAATTGCTTATCTATTAATTCTTTTAATTTTTCA
GTTTTATATTAACTATGTGGTATGTAAAT	TGAAGGGTTATAAAAAAAATAATAGCGAAAAGGGCG
GTTTTATATTAACTATGTGGTATGTAAAT	CACGAAAAAATCAGAAGGGGAGGGGGGTTATTTAAAA
GTTTTATATTAACTATGTGGTATGTAAAT	TTAAAACTTGAATTATTTCAAAAAGCTAAACATCAAG
GTTTTATATTAACTATGTGGTATGTAAAT	TTTAATTGCCCTTCATAGAATATTATTTCACCTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TATGAGAAAGTTGAATTTAAAGGCGAAATGAACATGG
GTTTTATATTAACTATGTGGTATGTAAAT	TCTTTATATTGATATCCAAGAATAAGCGCACGTTCTT
GTTTTATATTAACTATGTGGTATGTAAAT	TTGCTTAGCGCAATAACTTTTGAAAATACTACAGGAGT
GTTTTATATTAACTATGTGGTATGTAAAT	TAAGATGTCCAAATGCTAAGAGAGAATTCTTAGGATA
GTTTTATATTAACTATGTGGTATGTAAAT	AAAAGAAGTTTTGAAAGTAAATGTGTAAATAATAATA
GTTTTATATTAACTATGTGGTATGTAAAT	GAAGTCAACAATTTGGCTATTGGTTAAGTACAACTAGC
GTTTTATATTAACTATGTGGTATGTAAAT	AAAGAAAATTGGGTTTTTGATTAAGAACTTGCGAAT
GTTTTATATTAACTATGTGGTATGTAAAT

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD41492.1\|1738699_1741057_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319795
CP026613.2\|AVD41491.1\|1736824_1738282_+\|glycine-dehydrogenase-subunit-2	unknown	unknown	gnl\|CDD\|235292
CP026613.2\|AVD41503.1\|1757446_1758172_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|223816
CP026613.2\|AVD41486.1\|1728058_1728658_-\|Tellurium-resistance	unknown	unknown	gnl\|CDD\|226595
CP026613.2\|AVD41488.1\|1729867_1730854_-\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
CP026613.2\|AVD41495.1\|1745485_1745641_-\|integrase	unknown	unknown	gnl\|CDD\|271189
CP026613.2\|AVD41496.1\|1747602_1747890_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41490.1\|1734350_1736825_+\|aminomethyl-transferring-glycine-dehydrogenase-subunit-GcvPA	unknown	unknown	gnl\|CDD\|234769
CP026613.2\|AVD41493.1\|1741141_1741459_-\|pyrimidine/purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|377724
CP026613.2\|AXL65689.1\|1750409_1752257_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176521
CP026613.2\|AVD41487.1\|1728760_1729558_-\|lipoprotein	unknown	unknown	gnl\|CDD\|224381
CP026613.2\|AVD41504.1\|1758175_1759579_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
CP026613.2\|AVD41501.1\|1755668_1756556_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213231
CP026613.2\|AVD41497.1\|1748424_1748976_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
CP026613.2\|AVD41502.1\|1756561_1757335_+\|ABC-transporter-permease	unknown	unknown	unknown
CP026613.2\|AVD41499.1\|1753408_1753585_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41498.1\|1749166_1750129_+\|cysteine-synthase-family-protein	unknown	unknown	gnl\|CDD\|107204
CP026613.2\|AVD41489.2\|1731337_1733068_+\|Na+/H+-antiporter-NhaC-family-protein	unknown	unknown	gnl\|CDD\|224671
CP026613.2\|AVD41494.1\|1742561_1743680_-\|transposase	cas14j	-	gnl\|CDD\|223747
CP026613.2\|AVD41500.1\|1754633_1755656_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD41492.1\|1738699_1741057_+\|HAD-family-hydrolase	gnl\|CDD\|319795	cd02609, P-type_ATPase, uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7. This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.	0
CP026613.2\|AVD41491.1\|1736824_1738282_+\|glycine-dehydrogenase-subunit-2	gnl\|CDD\|235292	PRK04366, PRK04366, aminomethyl-transferring glycine dehydrogenase subunit GcvPB.	0
CP026613.2\|AVD41503.1\|1757446_1758172_+\|DNA-binding-response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	4.41058e-80
CP026613.2\|AVD41486.1\|1728058_1728658_-\|Tellurium-resistance	gnl\|CDD\|226595	COG4110, COG4110, Uncharacterized protein involved in stress response [General function prediction only].	7.68444e-79
CP026613.2\|AVD41488.1\|1729867_1730854_-\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	8.21907e-95
CP026613.2\|AVD41495.1\|1745485_1745641_-\|integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	0.00025848
CP026613.2\|AVD41490.1\|1734350_1736825_+\|aminomethyl-transferring-glycine-dehydrogenase-subunit-GcvPA	gnl\|CDD\|234769	PRK00451, PRK00451, aminomethyl-transferring glycine dehydrogenase subunit GcvPA.	0
CP026613.2\|AVD41493.1\|1741141_1741459_-\|pyrimidine/purine-nucleoside-phosphorylase	gnl\|CDD\|377724	pfam06865, DUF1255, Protein of unknown function (DUF1255). This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown.	3.7867e-54
CP026613.2\|AXL65689.1\|1750409_1752257_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176521	cd08579, GDPD_memb_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor.	1.2911e-88
CP026613.2\|AVD41487.1\|1728760_1729558_-\|lipoprotein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	3.07907e-94
CP026613.2\|AVD41504.1\|1758175_1759579_+\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.30987e-43
CP026613.2\|AVD41501.1\|1755668_1756556_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213231	cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	6.28598e-107
CP026613.2\|AVD41497.1\|1748424_1748976_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.67456e-17
CP026613.2\|AVD41498.1\|1749166_1750129_+\|cysteine-synthase-family-protein	gnl\|CDD\|107204	cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.	1.60519e-105
CP026613.2\|AVD41489.2\|1731337_1733068_+\|Na+/H+-antiporter-NhaC-family-protein	gnl\|CDD\|224671	COG1757, NhaC, Na+/H+ antiporter [Energy production and conversion].	2.5665e-58
CP026613.2\|AVD41494.1\|1742561_1743680_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.00854e-54

>CP026613.2|AVD41495.1|1745485_1745641_-|integrase
MLTTLDILISLLLTGFNIKILSKKLGHTDIKITMNRYSHILDNMHKKLLKI
>CP026613.2|AVD41494.1|1742561_1743680_-|transposase
MVVVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIDVYKNDKETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALKDLENAYEKFFKEKAGFPKFKSKKTNRFSYKTNFTNGNIMYCGQHIKLPKLGMVKIRDKQVPQGRILNATISKEPSGRYYVSLCCTDVDIEAFENTNNQIGLDLGIKEFCISSCGEFIENPKYLKKSLNKLAKLQRELSIKTIGSLNRNKARLKVARLQEHIANQRKDFLQKLSTKLIKENDIICIEDLQVKNMIRNRKLSRLISDVSWSEFIRQLEYKANWHGRKIVRVGKFFASSQICNKCGYKNEEVKNLNIREWICPSCNETHDRDINASMNILKEGLRLITIQNK
>CP026613.2|AVD41493.1|1741141_1741459_-|pyrimidine/purine-nucleoside-phosphorylase
MNEFKNVTAVKKANVYFDGKVSSRVIILPNGERKTLGLMLPGEYTFSTREEEIMEILAGSMDVKLPGSNEFVTYKEGQKFNVPSDSSFDLKVNEVVDYCCSYIAD
>CP026613.2|AVD41492.1|1738699_1741057_+|HAD-family-hydrolase
MGNLNLKRYNCDIKMGLSSEQIQSRIDNNLVNVFDNGKTKTYKQIFKDNVFTLFNLINIILVCLLVSVGSFKNTLFIFIAVINTIIGVIQEIRAKRLLDNLSVIVSNKVSVIRDKEKKEIDVQELVLDDIMILKTGNQICADSKVLDGRLEVNESLITGESDIVIKNKGDFLYSGSFVVSGEAFVRVENIGKDNYANKIANDAKISKKHNSQLRNSLNAILKVVGIIIIPLGLILFAKQHFGNGDSIVTSIVGTVAAVNGMIPEGLTLLTSIALALGTIKLASHKTLVQELYCVETLARVDTLCLDKTGTITEGKMQVDDVVMLEELDIDDIMGNICNALKDDNATLNAIRDKYSILDTHKVKNLIPFSSERKYSGVIFEGEGTYLLGAFEFIFKDKYKELKTEVEKYSKKGNRVIVLAHSNSYMEDNNIPEDIKPLAFILILDKIRDEAKETLEFFYNEGVDIKIISGDNPMTVSEVARKAGLKTAGNFIDATTLKNDEDIYEAVDKYNVFGRVSPQQKKQMILALKKQNHTVAMTGDGVNDVLALKEADCSIAMASGSDVTKNVSNLVLLDSNFASMPKVVMEGRKVINNIQRTASLFLVKTIFSFFLSILTLFFFSRQYPFVPIQLALIGAVTVGIPSFFLALEANRGRISGNFLLNILKNALPGALCVTINVIIVYNIVEYLGYNSSVFSTMCAILTGVCGLLILRQQCLPFNKERIFLIVSMTIAFIVGILFLGGLFSFVALSKQLILITVVLAVLMPIMIKVMRFVLDEILGAIVPNLN
>CP026613.2|AVD41491.1|1736824_1738282_+|glycine-dehydrogenase-subunit-2
MKEYNSLLIDISKKGRKAYSLPKLDIDDIKIEDMIDQNMIRKSELNLPEVGELELVRHYTLLSNKNFGVDTGFYPLGSCTMKYNPKINEDMAALPNFTGMHPYQSSDTAQGSLSLMYDLSRRLSEITGMDEVTLQPSAGSHGEFTGLMIIKAYHENRGDHKRTKVIIPDSAHGTNPASAAMANFDVIQIASDKNGAVDINALKEVLNDEVAALMLTNPSTLGLFEKNIKEIATLVHEAGGLLYYDGANMNAIMGITRPGNMGFDVVHLNLHKTFSTPHGGGGPGAGPVGVKKELVSFLPIPVIEKREDKYILNYDREKSIGKIKNFYGNFGVLVRAYTYILTMGRDGLKEASEMAVLNANYIKESIKDDYILPIDTLCKHEFVLGGLPRGEANIKTIDIAKRLLDYGYHPPTMYFPLIINEALMIEPTESESIETLDSFIDAMKSVAKEAKEEPELLKTAPHNTLVKRVDDARAVKKPILTWSQR
>CP026613.2|AVD41490.1|1734350_1736825_+|aminomethyl-transferring-glycine-dehydrogenase-subunit-GcvPA
MNELKRVSLYNIHKELGAKLVEFAGWEMPLEYEGINKEHDMVRKSAGIFDVSHMGEVQIKGVESEKFIQNLVTNDISTLNINDIIYTPMCYENGGVVDDLLIYKFGEEDYLLVINAGNIDKDVAWIIKQSERYNVDIKNISSEVSQLAIQGPKAEEILQKITDIDLNSIKFYKSIPSVKVCGCPCLVSRTGYTGEDGFEIYCENKYAEIIWNEVLKVGGEDICPAGLGCRDTLRFEAALPLYGHEINEHISPVEGGLSIFVKTNKESFIGKSILSKEKENGAKRKLVGFEMQGKGMPRNGYDIRIGDKIVGFVTTGCASPTTGKILGMGIIDSEYAKVGNEIGIAIRKKVVPAVIAKKPFYKKQYKKDNIILNKENKFSYIPATSEDKSKMLKVVGLNSVDELFSDIPEEVKLKRDLNLEIGKSELEVSKIVKRLSEENLSLEDLTCFLGAGAYDHYIPSIIKHITSRSEFYTAYTPYQAEISQGTLQVVFEFQSMIAEITGMEIANASMYDGATSAIEACIMAMNQTRKNKIVVSKTTHPETLSVLRTYLQYKDCEIVEIDFCNEYGTTDIEKLKASVDKDTACVLIQTPNFFGIIEEMEEIEKITHENKAMLIMSVDPISLGVLKTPGEIGADIVVGEAQSLGNPLNFGGPYVGFLASKSKYTRKMPGRIVGQSLDTEGKIAYVLTLQTREQHVRREKATSNICSNQALNALVASIYMATMGKEGFKEVGMQSMKKAHYTYNKLVQTGKYKPIFKGKFFKEFAIQGNLNIETINDKLLEENILGGYNLEYNYPELKNSTLLCVTEKRSKEEIDKLVGIMEGL
>CP026613.2|AVD41489.2|1731337_1733068_+|Na+/H+-antiporter-NhaC-family-protein
MRNKKINIIFLTTIMFIMSTVMVFAEEDIDTIALANAEKFGILTLIPPLVAIILAFITKNVIISLLIGILSGSFIIKASGINVFATFIQAFLDLVDRALVSLADPWNAGIILQVLAIGGVINLVAKMGGAKAIAEALAKRAKSAKGTQLITWFLGLLVFFDDYANSLIVGPMMRPVADKMKISREKLAFIIDATAAPVAGLAIISTWIGLEVGLIHDAFESISIDVDAFGIFLNTIPFRFYNILILAFIIISALLLKEFGPMRKAEIKSRSRKIDIDLDEGVEELDDLAPKNGVKLSVWNAIIPIGTLIIVALASFYYSGYTSIMGGEDKALIQLFTNSPYSFEAIKEAFSASDASRALFQSALVASLVAIIMAVIKKIFTISEAIDVWIDGMKSLVITGVILILAWSLSSVIKELGTAKFLIHLLSGSLPPFLLPSLIFGLGAIISFATGTAYGTMGILMPLAIPLAYSLNPDMSYVIVSTSAVLTGAIFGDHCSPISDTTILSSMGAGCNHIDHVNTQMPYAIFTAVITIVFGYIPAGLGLPIYIVLPVAIAAIFVGIQIIGKRVDEAEIELVE
>CP026613.2|AVD41488.1|1729867_1730854_-|lipoate--protein-ligase
MLLIYNEKTNPYFNLAMEEYLLKNFDEDLFILWRNEPSIIVGKNQNTLSEINLEYIKEYSIPVVRRQSGGGAVFHDLGNINFTFIACNNNNFSDFRRFTQPIIDLLKTLDVNAEFSGRNDLLIDGKKFSGNAQYNYKNKVMHHGTLLFSSEINDLSKALKVKPIKFEGKGIKSVKSRVTNISEHLHSKMDILEFKDAIMNYLSKTNTDNTNYCLSELDIEQIEKLTKSKYETWDWNFGNSPKYTLSNELKYSGGNVEFNLNVDKGIITSIKFFGDFFGKCDVSFVENKLIGIRHEENALRNTLNSIEINDYFLGADTDILVSGILGVK
>CP026613.2|AVD41487.1|1728760_1729558_-|lipoprotein
MKFKKLLCLLLCLVLTLAVVGCSKAKDDKKIVVGATLVPGGELLEELKPLIKEKGYTLEVKNFDDYILPNEALNNGEIDANLFQHEPYLKEAVKAKGYKIMAGKKLYVCPAILYSYKIKSVDEFKKGDTIAISNNPSSCSKNLRYLESIGLLTLPKGDGLVSPKDIIENPKGIQFKELDIAQIPSSLPDVTAAFIDTTYAVPAGLDAKKNGIYTAPINDEYANLLAFRTEDKDSEKIKVLQDVLTSDKARSLIEEKYKGIVIPTF
>CP026613.2|AVD41486.1|1728058_1728658_-|Tellurium-resistance
MAIELKKGQKINLTKKENSDLGEILVNLNWNQKVQKKGFFGSLRSSNIDLDLGCLFEMKNGVKGAVQALGNAFGSLDNPPFAQLDGDDRTGSNAQGENLRINGNKIKEIKRILIYAFIYEGVANWSEADGIVTIKQKQDSDLVVKLDEHKNGYNMCSIALIENVNDETFSVEKVVKYFKGHREMDTEFHWGLKWVAGRK
>CP026613.2|AVD41496.1|1747602_1747890_+|hypothetical-protein
MKKFLYALYSFIVIIANFRLKEKNYNFILLAIFFILLLIQNGVLKTGYQNRATFYQDNYFNGEDKNDKIKFMTIKIFIFLSLPLCFNILFDYLTS
>CP026613.2|AVD41497.1|1748424_1748976_-|XRE-family-transcriptional-regulator
MSINTIIAKNLNRLRNERNLSLGQLAELSGVSKVMLSQIEKGDSNPTVNTIWKIASGLNVPYTAILEQPQNETFIVSKTDIDVQVSENKDYRLYCYYPNTPTRNFELFQMELEEGHSYTSVGHSEKSQEYIMIIEGQLKLEVNDSIYQLRENDSICFSAESMHTYHNQGEKTLKAVIINYYPV
>CP026613.2|AVD41498.1|1749166_1750129_+|cysteine-synthase-family-protein
MRVLNNVTEAIGNTHMLHLSKIVDEFGVQGNIYAKMEYLNPGFSKKDRVALQMITEAENAGLLVPGQAVVELTSGNTGTGLAIACACKGYKFIACMSKGNSMERARMMKALGAEVVLVDQMPNSVHGQVSGEDLALVEIEAQRITKERNAFRADQFNLEACNHAHENYTAEEMWEQLDGNIDVFVDFLGSGSTFAGCSKALKGHKSSIKCYVVEPKTAAIYSGKEITDQGHKIQGGGYSMDLPLVDKKLIDGYIQITDEEATDVARKLAKLEGVFAGFSSGANVCAAIKLLKSTERGKNIVLTLNDSGLKYLSTDLYEEL
>CP026613.2|AXL65689.1|1750409_1752257_+|glycerophosphodiester-phosphodiesterase
MTKRVLSNFTLTGKNILSKFIFMIRYNFSTLILFELFYKGLALLLILPSIKYIFDNLLKSLNIFYLNMDNIIKILSNPISIVLIILSVIILAFYAFFEFTSVIICFNRSIKCEKIGLFELIKMSFKKSINLLYPKNILLFIFVLLIIPLVNTVLISGFIGKIQIPDYILDYIKSNNILNIVYMISLFIIYILVIRWIFSVHEITLNTENFKIARKESVNLIKGRIIRTVIYSLILSLVMAIIGYVIYHIGIISIGIWTKYYTNIGSLKELFINRCISFEDYFSLILSIFIFIVDIAFISATYYEYKGVNISRNNIIKEKKSIPKTIFKLSLIILIFCVESNAYSSHVNGLFNTSFSFNTTTIAHRAGAERAPENTLIALKEALNAKADYAEIDVQETKDGELIILHDSNFKRTTRVDKNVWDVNYDEVRTYDAGSFYYDGKGYYDERFVGEKIPTLDEMIKYSKGRIKLLIEIKLTGHEKGDVTKKVVQLIKENNFENQCIIASMDKTVLQKVKKLDKNLMTCYFMAVAYGDFSKLNYIDVYGIESTFVNTTVVEKIHKMNKKIFVWTVNSYSLIEKMLDLNVDSIITDNPYLVDGAIVWKKNGFINKVSDYLFS
>CP026613.2|AVD41499.1|1753408_1753585_-|hypothetical-protein
MFIGEIDKCTHILTAYISSSYDYCNFLDTQLDDFISEYGETVVEICLYQVLLLVSRYN
>CP026613.2|AVD41500.1|1754633_1755656_+|hypothetical-protein
MVNWEIKKLIKSKSMFISLGILILILSINIFVKPVLETENYYIDKERGRIEDTRNSEEIGNYKFQNKINVLKQLSSQKDMDVFSKKIKSISTNKLYNLIINEYKDVSFWKVFNYRATNSLINVGMLIIIVIIISNIYVDELVFSVRDIILSSKEKKKALNSKIVIAFLVPLTIYSVYLIGIFITTCMQQGMPINGDLEAFRIVDNIATLKCNSSIINYVISNIGIEFLMFEGLAMIALLGSFISKSSITSISFFIFTIVITKIISVIHILPKNLLLAISTVNYYDLIFGFNKIIGNYLGEIIIFKIHIDIVNLLIGVLVAIFIGAMSFCFIIIKSDYISK
>CP026613.2|AVD41501.1|1755668_1756556_+|ABC-transporter-ATP-binding-protein
MNKLEIKNLSKIYGKKVANDKITVTLENGVYGLLGPNGAGKSTLMKQITTLIKPDEGQIFYNGEDIFKMDDDYRNILGYLPQEFGVYKNFTAKEFLQYIGALKGLKGKYLSSKIEELLDLVGLYDVRDKSIGKFSGGMKRRVGIAQVLLNDPKIIVLDEPTAGLDPQERARFRNLIAKISRNKIIVLSTHIISDIESVAKETIMIKDGKLLMKGTHKEILSHMENKVYNVQVKNECEVDDIQSKYKVVSIQSDIDSIVLRIVSEDIPIGDNIQPVQAKFEDVYMFYFDLEDAREA
>CP026613.2|AVD41502.1|1756561_1757335_+|ABC-transporter-permease
MMYLVKIEMIKILKSKSVWIIWLFLLFFGFVLIRKFDVLDTYADIFYKIEGSIPLIGLIMFIITSGNYIKEYDSNMTGLINTTKNGKKSVVLSKLVANGLILSIINISFILLVGIRGFSFFDFKNLNEPIHNLWYFGNSSLNLTVIQMYIIVILTTIFASFVFAQIGLTLSSIFKSAVIPFILGGLIMAIPYFSVGFIPDKAIKFMSVTPNWIMMSQQIVRYNVPSILIGFSIVISIILMIVLTKITYKNFTSSKRF
>CP026613.2|AVD41503.1|1757446_1758172_+|DNA-binding-response-regulator
MENRVLIIDDEVEILKLLETVLKKEGLSNIYTAKTRKEGLEVFKNINPDLIILDIMLPDGEGYDICKEIRKTSNSPIIFLSAKTEELDKLLGLAIGGDDYVTKPFSPKEVAFRVKAHLRRLSYFSDSQNENTDSDNNEEKTISFGPYILNESRAELIKDGKSIGLSAKELKILSLFANNQNQIISKEKLWDKVWGEDYVGFDNTIMVHIRKIREKLEDNPSKPEYILTIKGLGYKLSVKED
>CP026613.2|AVD41504.1|1758175_1759579_+|sensor-histidine-kinase
MKWKITRNFIFTIVFVVISVVIINIISILYVISTDNFLKVVDSRNNPEEFARSFEKDLYEKDGELKLSKIGADKLEKSNSWIQVLNDLGEEVFGVNVPKDTPQKYTPFQMVNNYKYIETEYVNFVLEKYLNKKHLNIIVGIPSRDVSRIILTYSQNNTKKTLNKIIIIILVIDGMVALGVGYLFSRKLTKPISSVLWSIETMANGNYSLYLKDRGIYEEVFKNINMLADTLRVNEVERKENEELREEWLANITHDIKTPLASIQGYAEIINDKDYEFSEDEIREYAEIIYNKSKYIKDLVDDLNLSTRLKNNTIVLDKKKVNLVGLVRNIIIDILNDNRYKNRNIEFESNEDLIEVYVDSILFRRAITNLIFNSIVHNSEGTLISVKIVKKDNIEIIIKDSGVGISKNDLKHIFKKYYRGTNTGEMHKGSGLGMAISKEIIEIHKGKIYLNSEIGIGTEIIIEINQN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_9

2198296-2201226

Orphan

I-A

Consensus_repeat	Method
CTTTACATACCACATAGTTAATATAAAAC	CRISPRCasFinder
CTTTACATACCACATAGTTAATATAAAAC	CRT
GTTTTATATTAACTATGTGGTATGTAAAG	PILER-CR

44 spacers

csa3

The CRISPR arrays of CP026613_9

>merge|CP026613|9|2198296-2201226|CRISPRCasFinder,CRT,PILER-CR
TTAAATTCACCACTTAGTTAATATAAAGCGTAATTTTGGAAAAAATAATTACAGAGGTAATACAACCTTTACATACCACATAGTTAATATAAAATGAGGCGTTTTTTTCTGTTCCGACTCCTGTTCCTGTATCTTTACATACCACATAGTTAATATAAAACAAGGCTATACAGGATGATAATTTAAAAGAAAACTTCACTTTACATACCACATAGTTAATATAAAACAGTTCAGTTGGAAATATAATTGTAGAACAATACTCTACTTTACATACCACATAGTTAATATAAAACTCATTGATGCTAACTTAAGTATTCCTTGTTTTTGTGACTTTACATACCACATAGTTAATATAAAACAAATAACTTAGTATGTCTAAATACAAATTTTAGACCTCTTTACATACCACATAGTTAATATAAAACTTAATGATGAAGGAAAAGAATATGTAGTATATGAATATCTTTACATACCACATAGTTAATATAAAACAAGTTCTATATACAACTGTGCAAGTTCTGAATTAATCTTTACATACCACATAGTTAATATAAAACTTAACCCTCTTGATAAAACAAGGAGGTATTAGATGAAACTTTACATACCACATAGTTAATATAAAACGATACCGAAGGTAATTTACTTGCAATATCTAAATACCTTTACATACCACATAGTTAATATAAAACGCGGTAAAATGTTAGATAAAACTGTTACATTTACAAACTTTACATACCACATAGTTAATATAAAACTAAGTTTGAACACACTTATTTTCGACCCCTCAATACACTTTACATACCACATAGTTAATATAAAACTTTTTGAGTATGGAGATAAAGTAAAAATTATACTTCCCTTTACATACCACATAGTTAATATAAAACTTAGCGTTGATAAAGATTCTATAGTAGTGAGAGGTGCTTTACATACCACATAGTTAATATAAAACTAAAAATTGGGATATAATTCATCAACAAATTTAACATACTTTACATACCACATAGTTAATATAAAACATTATCCTTCATGTGCTTAGCTCTTTTATATTTTTTCTTTACATACCACATAGTTAATATAAAACTCTAGCTATCCAGAAACTTATAAACCTGCTCCAGATTCCTTTACATACCACATAGTTAATATAAAACGGATATGTTGAAGGAACACATATGTTGCAACAAACCACTTTACATACCACATAGTTAATATAAAACTAGCAGGAGATGATAGAGGGGTATATCACCAGGTGATCTTTACATACCACATAGTTAATATAAAACGTTTTTCTTTATTAGATAAAAGTTCTCCGTCGAATCTCTTTACATACCACATAGTTAATATAAAACAATCATTCCTTTTGTTTCATCTTTAAGTTTTACGACCTTTACATACCACATAGTTAATATAAAACTTAGTAAGCATAATAATTGCTTGTGTGATGATTTGTTTCTTTACATACCACATAGTTAATATAAAACAAAAAGAAACTACTTTGTATCTTTATGTTGGAATAGACTTTACATACCACATAGTTAATATAAAACTACTTCGTCTTTTTTGATTTGAACGTCTTATTTTCTTCTTTACATACCACATAGTTAATATAAAACGAGATTTTCATATAGCCATAGACTGTTTTAGTTTTTCTTTACATACCACATAGTTAATATAAAACTGCTTGTGCTGTAGGTGTTCCTTGTGCTGTCATATCTTTACATACCACATAGTTAATATAAAACTTTAAATAATACCTTAGTAGAATTATCAGAGAAAATAACTTTACATACCACATAGTTAATATAAAACTCCTAAACCTTCTATCTTCTAAACTCTCATTACTTTTCTTTACATACCACATAGTTAATATAAAACATGATAATAATGTAGTGAAACGAATAGCAAAAGAGTTCTTTACATACCACATAGTTAATATAAAACGAGGCAGAAATAATTAAATCCACAATAGATTTAGCTATACTTTACATACCACATAGTTAATATAAAACAAATCCCTGCAACTGTAGTTGGTTGGGGTTATAATGACTTTACATACCACATAGTTAATATAAAACTAATGAAGGTAGCGTTAGTACCAGGACATACACTAACCTTTACATACCACATAGTTAATATAAAACCAGTAGCTAATTTACTTAATCTATAAGCATCAACCTCCTTTACATACCACATAGTTAATATAAAACTATTTAAATCTGATGAATATACTGCTCTTATTTGCCGCTTTACATACCACATAGTTAATATAAAACTGTTTGAACATGACTTTGAACATGTTTGTCTTTCTTCTTTACATACCACATAGTTAATATAAAACACTAATTTAAAAAACCACCCACTTGTAGATAATGCAGCTTTACATACCACATAGTTAATATAAAACCAAAGTATAGGTCAGCATATAAACCTAAAGTGGAAGACTTTACATACCACATAGTTAATATAAAACGAGAGTAAAGATTGTGATATAGCATACAAAAATTGGTCTTTACATACCACATAGTTAATATAAAACTTAATTGATTGTTGAGTAAATCCTAATTCTTTTATTTCTTTACATACCACATAGTTAATATAAAACTAGTTTATTGTGTGTAAATTCTGCTTCAAAACTTATTTCTTTACATACCACATAGTTAATATAAAACTCCACTCCAAGAATTAGGAATAGCCTTGCTTTCACTCTTTACATACCACATAGTTAATATAAAACTCTATGACCTATTGGTGCTAATCCAAGACCTTCTCCACTTTACATACCACATAGTTAATATAAAACGCTCCTCACCTCTTAATACGCCAGAACTCAACCCTCTTTACATACCACATAGTTAATATAAAACTTCTTTAGGAATCATCAGTATGGATGAATATCAGTCTACTTTACATACCACATAGTTAATATAAAAC

>CP026613|9|9|2198296-2201226|CRISPRCasFinder
TTAAATTCACCACTTAGTTAATATAAAGC	GTAATTTTGGAAAAAATAATTACAGAGGTAATACAAC
CTTTACATACCACATAGTTAATATAAAAT	GAGGCGTTTTTTTCTGTTCCGACTCCTGTTCCTGTAT
CTTTACATACCACATAGTTAATATAAAAC	AAGGCTATACAGGATGATAATTTAAAAGAAAACTTCA
CTTTACATACCACATAGTTAATATAAAAC	AGTTCAGTTGGAAATATAATTGTAGAACAATACTCTA
CTTTACATACCACATAGTTAATATAAAAC	TCATTGATGCTAACTTAAGTATTCCTTGTTTTTGTGA
CTTTACATACCACATAGTTAATATAAAAC	AAATAACTTAGTATGTCTAAATACAAATTTTAGACCT
CTTTACATACCACATAGTTAATATAAAAC	TTAATGATGAAGGAAAAGAATATGTAGTATATGAATAT
CTTTACATACCACATAGTTAATATAAAAC	AAGTTCTATATACAACTGTGCAAGTTCTGAATTAAT
CTTTACATACCACATAGTTAATATAAAAC	TTAACCCTCTTGATAAAACAAGGAGGTATTAGATGAAA
CTTTACATACCACATAGTTAATATAAAAC	GATACCGAAGGTAATTTACTTGCAATATCTAAATAC
CTTTACATACCACATAGTTAATATAAAAC	GCGGTAAAATGTTAGATAAAACTGTTACATTTACAAA
CTTTACATACCACATAGTTAATATAAAAC	TAAGTTTGAACACACTTATTTTCGACCCCTCAATACA
CTTTACATACCACATAGTTAATATAAAAC	TTTTTGAGTATGGAGATAAAGTAAAAATTATACTTCC
CTTTACATACCACATAGTTAATATAAAAC	TTAGCGTTGATAAAGATTCTATAGTAGTGAGAGGTG
CTTTACATACCACATAGTTAATATAAAAC	TAAAAATTGGGATATAATTCATCAACAAATTTAACATA
CTTTACATACCACATAGTTAATATAAAAC	ATTATCCTTCATGTGCTTAGCTCTTTTATATTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TCTAGCTATCCAGAAACTTATAAACCTGCTCCAGATTC
CTTTACATACCACATAGTTAATATAAAAC	GGATATGTTGAAGGAACACATATGTTGCAACAAACCA
CTTTACATACCACATAGTTAATATAAAAC	TAGCAGGAGATGATAGAGGGGTATATCACCAGGTGAT
CTTTACATACCACATAGTTAATATAAAAC	GTTTTTCTTTATTAGATAAAAGTTCTCCGTCGAATCT
CTTTACATACCACATAGTTAATATAAAAC	AATCATTCCTTTTGTTTCATCTTTAAGTTTTACGAC
CTTTACATACCACATAGTTAATATAAAAC	TTAGTAAGCATAATAATTGCTTGTGTGATGATTTGTTT
CTTTACATACCACATAGTTAATATAAAAC	AAAAAGAAACTACTTTGTATCTTTATGTTGGAATAGA
CTTTACATACCACATAGTTAATATAAAAC	TACTTCGTCTTTTTTGATTTGAACGTCTTATTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	GAGATTTTCATATAGCCATAGACTGTTTTAGTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TGCTTGTGCTGTAGGTGTTCCTTGTGCTGTCATAT
CTTTACATACCACATAGTTAATATAAAAC	TTTAAATAATACCTTAGTAGAATTATCAGAGAAAATAA
CTTTACATACCACATAGTTAATATAAAAC	TCCTAAACCTTCTATCTTCTAAACTCTCATTACTTTT
CTTTACATACCACATAGTTAATATAAAAC	ATGATAATAATGTAGTGAAACGAATAGCAAAAGAGTT
CTTTACATACCACATAGTTAATATAAAAC	GAGGCAGAAATAATTAAATCCACAATAGATTTAGCTATA
CTTTACATACCACATAGTTAATATAAAAC	AAATCCCTGCAACTGTAGTTGGTTGGGGTTATAATGA
CTTTACATACCACATAGTTAATATAAAAC	TAATGAAGGTAGCGTTAGTACCAGGACATACACTAAC
CTTTACATACCACATAGTTAATATAAAAC	CAGTAGCTAATTTACTTAATCTATAAGCATCAACCTC
CTTTACATACCACATAGTTAATATAAAAC	TATTTAAATCTGATGAATATACTGCTCTTATTTGCCG
CTTTACATACCACATAGTTAATATAAAAC	TGTTTGAACATGACTTTGAACATGTTTGTCTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	ACTAATTTAAAAAACCACCCACTTGTAGATAATGCAG
CTTTACATACCACATAGTTAATATAAAAC	CAAAGTATAGGTCAGCATATAAACCTAAAGTGGAAGA
CTTTACATACCACATAGTTAATATAAAAC	GAGAGTAAAGATTGTGATATAGCATACAAAAATTGGT
CTTTACATACCACATAGTTAATATAAAAC	TTAATTGATTGTTGAGTAAATCCTAATTCTTTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TAGTTTATTGTGTGTAAATTCTGCTTCAAAACTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TCCACTCCAAGAATTAGGAATAGCCTTGCTTTCACT
CTTTACATACCACATAGTTAATATAAAAC	TCTATGACCTATTGGTGCTAATCCAAGACCTTCTCCA
CTTTACATACCACATAGTTAATATAAAAC	GCTCCTCACCTCTTAATACGCCAGAACTCAACCCT
CTTTACATACCACATAGTTAATATAAAAC	TTCTTTAGGAATCATCAGTATGGATGAATATCAGTCTA
CTTTACATACCACATAGTTAATATAAAAC

>CP026613|9|3|2198296-2201226|CRT
TTAAATTCACCACTTAGTTAATATAAAGC	GTAATTTTGGAAAAAATAATTACAGAGGTAATACAAC
CTTTACATACCACATAGTTAATATAAAAT	GAGGCGTTTTTTTCTGTTCCGACTCCTGTTCCTGTAT
CTTTACATACCACATAGTTAATATAAAAC	AAGGCTATACAGGATGATAATTTAAAAGAAAACTTCA
CTTTACATACCACATAGTTAATATAAAAC	AGTTCAGTTGGAAATATAATTGTAGAACAATACTCTA
CTTTACATACCACATAGTTAATATAAAAC	TCATTGATGCTAACTTAAGTATTCCTTGTTTTTGTGA
CTTTACATACCACATAGTTAATATAAAAC	AAATAACTTAGTATGTCTAAATACAAATTTTAGACCT
CTTTACATACCACATAGTTAATATAAAAC	TTAATGATGAAGGAAAAGAATATGTAGTATATGAATAT
CTTTACATACCACATAGTTAATATAAAAC	AAGTTCTATATACAACTGTGCAAGTTCTGAATTAAT
CTTTACATACCACATAGTTAATATAAAAC	TTAACCCTCTTGATAAAACAAGGAGGTATTAGATGAAA
CTTTACATACCACATAGTTAATATAAAAC	GATACCGAAGGTAATTTACTTGCAATATCTAAATAC
CTTTACATACCACATAGTTAATATAAAAC	GCGGTAAAATGTTAGATAAAACTGTTACATTTACAAA
CTTTACATACCACATAGTTAATATAAAAC	TAAGTTTGAACACACTTATTTTCGACCCCTCAATACA
CTTTACATACCACATAGTTAATATAAAAC	TTTTTGAGTATGGAGATAAAGTAAAAATTATACTTCC
CTTTACATACCACATAGTTAATATAAAAC	TTAGCGTTGATAAAGATTCTATAGTAGTGAGAGGTG
CTTTACATACCACATAGTTAATATAAAAC	TAAAAATTGGGATATAATTCATCAACAAATTTAACATA
CTTTACATACCACATAGTTAATATAAAAC	ATTATCCTTCATGTGCTTAGCTCTTTTATATTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TCTAGCTATCCAGAAACTTATAAACCTGCTCCAGATTC
CTTTACATACCACATAGTTAATATAAAAC	GGATATGTTGAAGGAACACATATGTTGCAACAAACCA
CTTTACATACCACATAGTTAATATAAAAC	TAGCAGGAGATGATAGAGGGGTATATCACCAGGTGAT
CTTTACATACCACATAGTTAATATAAAAC	GTTTTTCTTTATTAGATAAAAGTTCTCCGTCGAATCT
CTTTACATACCACATAGTTAATATAAAAC	AATCATTCCTTTTGTTTCATCTTTAAGTTTTACGAC
CTTTACATACCACATAGTTAATATAAAAC	TTAGTAAGCATAATAATTGCTTGTGTGATGATTTGTTT
CTTTACATACCACATAGTTAATATAAAAC	AAAAAGAAACTACTTTGTATCTTTATGTTGGAATAGA
CTTTACATACCACATAGTTAATATAAAAC	TACTTCGTCTTTTTTGATTTGAACGTCTTATTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	GAGATTTTCATATAGCCATAGACTGTTTTAGTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TGCTTGTGCTGTAGGTGTTCCTTGTGCTGTCATAT
CTTTACATACCACATAGTTAATATAAAAC	TTTAAATAATACCTTAGTAGAATTATCAGAGAAAATAA
CTTTACATACCACATAGTTAATATAAAAC	TCCTAAACCTTCTATCTTCTAAACTCTCATTACTTTT
CTTTACATACCACATAGTTAATATAAAAC	ATGATAATAATGTAGTGAAACGAATAGCAAAAGAGTT
CTTTACATACCACATAGTTAATATAAAAC	GAGGCAGAAATAATTAAATCCACAATAGATTTAGCTATA
CTTTACATACCACATAGTTAATATAAAAC	AAATCCCTGCAACTGTAGTTGGTTGGGGTTATAATGA
CTTTACATACCACATAGTTAATATAAAAC	TAATGAAGGTAGCGTTAGTACCAGGACATACACTAAC
CTTTACATACCACATAGTTAATATAAAAC	CAGTAGCTAATTTACTTAATCTATAAGCATCAACCTC
CTTTACATACCACATAGTTAATATAAAAC	TATTTAAATCTGATGAATATACTGCTCTTATTTGCCG
CTTTACATACCACATAGTTAATATAAAAC	TGTTTGAACATGACTTTGAACATGTTTGTCTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	ACTAATTTAAAAAACCACCCACTTGTAGATAATGCAG
CTTTACATACCACATAGTTAATATAAAAC	CAAAGTATAGGTCAGCATATAAACCTAAAGTGGAAGA
CTTTACATACCACATAGTTAATATAAAAC	GAGAGTAAAGATTGTGATATAGCATACAAAAATTGGT
CTTTACATACCACATAGTTAATATAAAAC	TTAATTGATTGTTGAGTAAATCCTAATTCTTTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TAGTTTATTGTGTGTAAATTCTGCTTCAAAACTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TCCACTCCAAGAATTAGGAATAGCCTTGCTTTCACT
CTTTACATACCACATAGTTAATATAAAAC	TCTATGACCTATTGGTGCTAATCCAAGACCTTCTCCA
CTTTACATACCACATAGTTAATATAAAAC	GCTCCTCACCTCTTAATACGCCAGAACTCAACCCT
CTTTACATACCACATAGTTAATATAAAAC	TTCTTTAGGAATCATCAGTATGGATGAATATCAGTCTA
CTTTACATACCACATAGTTAATATAAAAC

>CP026613|9|4|2198362-2201226|PILER-CR
CTTTACATACCACATAGTTAATATAAAAT	GAGGCGTTTTTTTCTGTTCCGACTCCTGTTCCTGTAT
CTTTACATACCACATAGTTAATATAAAAC	AAGGCTATACAGGATGATAATTTAAAAGAAAACTTCA
CTTTACATACCACATAGTTAATATAAAAC	AGTTCAGTTGGAAATATAATTGTAGAACAATACTCTA
CTTTACATACCACATAGTTAATATAAAAC	TCATTGATGCTAACTTAAGTATTCCTTGTTTTTGTGA
CTTTACATACCACATAGTTAATATAAAAC	AAATAACTTAGTATGTCTAAATACAAATTTTAGACCT
CTTTACATACCACATAGTTAATATAAAAC	TTAATGATGAAGGAAAAGAATATGTAGTATATGAATAT
CTTTACATACCACATAGTTAATATAAAAC	AAGTTCTATATACAACTGTGCAAGTTCTGAATTAAT
CTTTACATACCACATAGTTAATATAAAAC	TTAACCCTCTTGATAAAACAAGGAGGTATTAGATGAAA
CTTTACATACCACATAGTTAATATAAAAC	GATACCGAAGGTAATTTACTTGCAATATCTAAATAC
CTTTACATACCACATAGTTAATATAAAAC	GCGGTAAAATGTTAGATAAAACTGTTACATTTACAAA
CTTTACATACCACATAGTTAATATAAAAC	TAAGTTTGAACACACTTATTTTCGACCCCTCAATACA
CTTTACATACCACATAGTTAATATAAAAC	TTTTTGAGTATGGAGATAAAGTAAAAATTATACTTCC
CTTTACATACCACATAGTTAATATAAAAC	TTAGCGTTGATAAAGATTCTATAGTAGTGAGAGGTG
CTTTACATACCACATAGTTAATATAAAAC	TAAAAATTGGGATATAATTCATCAACAAATTTAACATA
CTTTACATACCACATAGTTAATATAAAAC	ATTATCCTTCATGTGCTTAGCTCTTTTATATTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TCTAGCTATCCAGAAACTTATAAACCTGCTCCAGATTC
CTTTACATACCACATAGTTAATATAAAAC	GGATATGTTGAAGGAACACATATGTTGCAACAAACCA
CTTTACATACCACATAGTTAATATAAAAC	TAGCAGGAGATGATAGAGGGGTATATCACCAGGTGAT
CTTTACATACCACATAGTTAATATAAAAC	GTTTTTCTTTATTAGATAAAAGTTCTCCGTCGAATCT
CTTTACATACCACATAGTTAATATAAAAC	AATCATTCCTTTTGTTTCATCTTTAAGTTTTACGAC
CTTTACATACCACATAGTTAATATAAAAC	TTAGTAAGCATAATAATTGCTTGTGTGATGATTTGTTT
CTTTACATACCACATAGTTAATATAAAAC	AAAAAGAAACTACTTTGTATCTTTATGTTGGAATAGA
CTTTACATACCACATAGTTAATATAAAAC	TACTTCGTCTTTTTTGATTTGAACGTCTTATTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	GAGATTTTCATATAGCCATAGACTGTTTTAGTTTTT
CTTTACATACCACATAGTTAATATAAAAC	TGCTTGTGCTGTAGGTGTTCCTTGTGCTGTCATAT
CTTTACATACCACATAGTTAATATAAAAC	TTTAAATAATACCTTAGTAGAATTATCAGAGAAAATAA
CTTTACATACCACATAGTTAATATAAAAC	TCCTAAACCTTCTATCTTCTAAACTCTCATTACTTTT
CTTTACATACCACATAGTTAATATAAAAC	ATGATAATAATGTAGTGAAACGAATAGCAAAAGAGTT
CTTTACATACCACATAGTTAATATAAAAC	GAGGCAGAAATAATTAAATCCACAATAGATTTAGCTATA
CTTTACATACCACATAGTTAATATAAAAC	AAATCCCTGCAACTGTAGTTGGTTGGGGTTATAATGA
CTTTACATACCACATAGTTAATATAAAAC	TAATGAAGGTAGCGTTAGTACCAGGACATACACTAAC
CTTTACATACCACATAGTTAATATAAAAC	CAGTAGCTAATTTACTTAATCTATAAGCATCAACCTC
CTTTACATACCACATAGTTAATATAAAAC	TATTTAAATCTGATGAATATACTGCTCTTATTTGCCG
CTTTACATACCACATAGTTAATATAAAAC	TGTTTGAACATGACTTTGAACATGTTTGTCTTTCTT
CTTTACATACCACATAGTTAATATAAAAC	ACTAATTTAAAAAACCACCCACTTGTAGATAATGCAG
CTTTACATACCACATAGTTAATATAAAAC	CAAAGTATAGGTCAGCATATAAACCTAAAGTGGAAGA
CTTTACATACCACATAGTTAATATAAAAC	GAGAGTAAAGATTGTGATATAGCATACAAAAATTGGT
CTTTACATACCACATAGTTAATATAAAAC	TTAATTGATTGTTGAGTAAATCCTAATTCTTTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TAGTTTATTGTGTGTAAATTCTGCTTCAAAACTTATTT
CTTTACATACCACATAGTTAATATAAAAC	TCCACTCCAAGAATTAGGAATAGCCTTGCTTTCACT
CTTTACATACCACATAGTTAATATAAAAC	TCTATGACCTATTGGTGCTAATCCAAGACCTTCTCCA
CTTTACATACCACATAGTTAATATAAAAC	GCTCCTCACCTCTTAATACGCCAGAACTCAACCCT
CTTTACATACCACATAGTTAATATAAAAC	TTCTTTAGGAATCATCAGTATGGATGAATATCAGTCTA
CTTTACATACCACATAGTTAATATAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD41902.1\|2202176_2202419_+\|integrase	unknown	unknown	unknown
CP026613.2\|AVD41899.1\|2196971_2197205_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41897.1\|2196354_2196735_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41894.1\|2194065_2194638_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378443
CP026613.2\|AVD41900.1\|2197392_2197581_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
CP026613.2\|AXL65697.1\|2203574_2204420_+\|DUF4878-domain-containing-protein	unknown	unknown	gnl\|CDD\|379023
CP026613.2\|AVD41908.1\|2207814_2208567_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182593
CP026613.2\|AVD41896.1\|2195438_2195561_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41898.1\|2196727_2196985_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD44784.1\|2207239_2207299_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41904.1\|2204643_2204808_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41906.1\|2206552_2206849_-\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP026613.2\|AVD41893.1\|2193251_2193623_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41903.1\|2202484_2203030_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
CP026613.2\|AVD41895.1\|2194981_2195356_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41907.1\|2207469_2207604_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41892.1\|2192855_2193113_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41905.1\|2205930_2206572_-\|DUF1648-domain-containing-protein	unknown	unknown	gnl\|CDD\|227945
CP026613.2\|AVD41891.1\|2192248_2192533_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41901.1\|2201504_2201657_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD41906.1\|2206552_2206849_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	8.20037e-22
CP026613.2\|AVD41903.1\|2202484_2203030_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.0141e-35
CP026613.2\|AVD41894.1\|2194065_2194638_-\|hypothetical-protein	gnl\|CDD\|378443	pfam10543, ORF6N, ORF6N domain. This domain was identified by Iyer and colleagues.	1.73523e-06
CP026613.2\|AVD41900.1\|2197392_2197581_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	5.68544e-09
CP026613.2\|AXL65697.1\|2203574_2204420_+\|DUF4878-domain-containing-protein	gnl\|CDD\|379023	pfam13026, DUF3887, Protein of unknown function (DUF3887). This domain family is found in bacteria and archaea, and is approximately 90 amino acids in length.	0.000618735
CP026613.2\|AVD41905.1\|2205930_2206572_-\|DUF1648-domain-containing-protein	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	6.53198e-19
CP026613.2\|AVD41908.1\|2207814_2208567_-\|hypothetical-protein	gnl\|CDD\|182593	PRK10621, PRK10621, hypothetical protein; Provisional.	3.81929e-48

>CP026613.2|AVD41900.1|2197392_2197581_+|XRE-family-transcriptional-regulator
MTLQDRIKEERLKLGLNQVELSKKFNMTKQTVSNWESENRIQDTLMLTKLADFLCISRFSLG
>CP026613.2|AVD41899.1|2196971_2197205_-|hypothetical-protein
MNTKKTKGIYKNGGLKVSRTAICSVCGELLVDGYGDEFTNTKIIDLHGREFVIIIYKNCLEELLRKCANGGISNDNN
>CP026613.2|AVD41898.1|2196727_2196985_-|hypothetical-protein
MIIIRSQDRLDLMRVNRVEIDSKYVYAVFGEESNVREIGRYKSEERAIEVLSRIQDAIIAGTKFDIIKKDGVRYYKEKVFEMPVE
>CP026613.2|AVD41897.1|2196354_2196735_-|hypothetical-protein
MNKEGSEMLKVEKYFSGSLGINIIEDDPTCRNYLALYCCLVGIERKGKKVIPRIDSMLSEFGVKSRCKRPHNNKLIRLINVKTGEVKEFKSIDSTACFLGLKQPAVSHILKRKTPSRSGWRAEYIK
>CP026613.2|AVD41896.1|2195438_2195561_-|hypothetical-protein
MKRRRCSWCGKLFYLKEKSKEVYCYKECKKKANRVKSFND
>CP026613.2|AVD41895.1|2194981_2195356_+|hypothetical-protein
MTIFSYLQASNTFIILSIILGVLMAINDNKKQLLKFKILNYCFFICMSISYIFSFLVFFQDFNSNILEIIANILSIILLIACNRVSTKNALNSSLYTLLAFWFSPLFAIILLFWIHNPHKYLNS
>CP026613.2|AVD41894.1|2194065_2194638_-|hypothetical-protein
MNENLSKEIKILGTIEVEEMKFHDIEGGFGVGKKSMSVKDIDEIHNGKLKDINKNINNNRKRFKDMINTLDLKVSDLKSLSLEMGYSNQSYANANNIYLLPERDYSKRLKILEGKQYEKIVDGYFSMRKELNNPLLSASKELQAIFMLDKKQEFLETKIESVNEKLENFMDDAPLFNIEFESIVKIVLWK
>CP026613.2|AVD41893.1|2193251_2193623_-|hypothetical-protein
MKKQIMALGLTGLIGLGGLGLLANKSFADTPNKLKGDTTVAQGLNKNATAKDVTEQVDTTIGKGLDKNAIVKDVVENNGEKSDTTVAPGLDKNATVKDTAEKGNTTIAPGLDKNTIVKDIVVK
>CP026613.2|AVD41892.1|2192855_2193113_-|hypothetical-protein
MVKCTKLIGGVITMKKNILGVLLPLLTMIIIFVLSFENIITNSLGLSDMDIKGILISGVVLYIPVSFLVNGIICAKKQIKWKISK
>CP026613.2|AVD41891.1|2192248_2192533_-|hypothetical-protein
MTFEVEFYTFEGINMEAEMYVQVAMMASKVVKITGVDEVIKKLVKKFLNNKVEEALGKQRSKKELKLIENNFNEYMERSYKNYIYMNTIVFRNQ
>CP026613.2|AVD41901.1|2201504_2201657_-|hypothetical-protein
MDNFLQGILASLVASLIVYLTSKLFKKVKSHSGRSDFSFELEIKFKKNKH
>CP026613.2|AVD41902.1|2202176_2202419_+|integrase
MRNRQGIIKNQTFFEDVKLIDITPNLLKIYVNKIYKKYSLNSAKNSIGFLNPLLHEAYILREIQEDVSKFVITSSKKIHL
>CP026613.2|AVD41903.1|2202484_2203030_+|site-specific-integrase
MPIYLMLTLGLHFGEAVSLRWCDVELDEGIINIKQTMIYVREKVTFKSPKTEKSKRILTTPIELINLLKEEKIRQNKLKLQDILKNELDLICLNKYFRPWKQQMFFRLFNRLLEKNNLRYIKLHELRHTNATLMLLSGTNIKTISERLCHADIKITMNRYSLVLEDIDREASDNLSKILFK
>CP026613.2|AXL65697.1|2203574_2204420_+|DUF4878-domain-containing-protein
MNITKRMTLLLTLLIVILITGCSPKESASEVAKKYIDKMNSGDYETAYSLLSKDSKKKISLENLEDFQNILVSTKRIISYKIGKEKIIKKYKHDGKEYKNVVKLEETFNIKNLLYKKDDSLKVNRYFVVENNKYKLLLYESFKKEFGINSMDLAQLKLNDFGLKYFKEVDLILKKAIAINPTDSTLYYAQACNYMNFDGFPDYPDATYNALDSINKSLKYLDKNDSDYKKNASNIYNLKGVILMFHKRFDEAQQDLNKSLYFNKDNEDPKSNLNTIKKHLK
>CP026613.2|AVD41904.1|2204643_2204808_-|hypothetical-protein
MFGKPKESVRFLDFNDVAEKFGEKKAVAIFDAIAGKKSKEHIIKDIEKLVKNEV
>CP026613.2|AVD41905.1|2205930_2206572_-|DUF1648-domain-containing-protein
MKKAINKQFILSTLICFIPFIVSIYFYNRLPNEVAIHFDNYGNPDNYAPKVIAAFGVPLLMLCIHLYTWFRLENEPKKANFSNVIQNLSKWGVAILSVILQIMMVLYSTGVSLESNFYTGLILGIIVILFGNYLPKCKQNYSVGIILPWTLNDEDNWNKTHHLAGWIWLIGGILLIINAFINIPFYNIFVIFVIVILPFIYSYLMYKISGKNN
>CP026613.2|AVD41906.1|2206552_2206849_-|ArsR-family-transcriptional-regulator
MLGFPETFKALSDPIRREILVMLRENKMSAGEISEKFNMTNATISYHLSQLKKAGLIFETKYKNFIFYEINISVFEEVMLWFSQFMEKGEKDNEKSDK
>CP026613.2|AVD44784.1|2207239_2207299_+|hypothetical-protein
MVEYIYYYNNKRIKKIKLE
>CP026613.2|AVD41907.1|2207469_2207604_-|hypothetical-protein
MNISRRAMKIIELAQKIANKRGVTVQDAWNDAMKEYKEKYEYVA
>CP026613.2|AVD41908.1|2207814_2208567_-|hypothetical-protein
MFAIIFLCIGGFLAAFVDSIAGGGGLISMPVLMAIGVPVHLAIGTNKFAASAGCISSAYRYAKSGKVNNDLLKKLVPFTIVGSILGVRCVLSISEDILNVLVVVMILIVAIYTFTSKNLGQEDNFESINNKNLRLGMLMAFIMGFYDGFFGPGTGTFLTFGFIKIYGYDFLHASANTKILNLTSNITSLLLFMINGQVDYKIAIVFALVMIMGAYIGAKVAIKKGSKMIKPIFLVMALFMVVKLVYQTLV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_10

2248100-2248988

Orphan

I-A

Consensus_repeat	Method
ATTTACATACCACTTAGTTAATATAAAAC	CRISPRCasFinder
ATTTACATACCACTTAGTTAATATAAAAC	CRT
GTTTTATATTAACTAAGTGGTATGTAAAT	PILER-CR

13 spacers

The CRISPR arrays of CP026613_10

>merge|CP026613|10|2248100-2248988|CRISPRCasFinder,CRT,PILER-CR
ATTTAAATTCAATATAGCTAATATAAAACTATATAAAACGAAAGTTATCTCTTAATAAATGTTCAATAGACTATGCTTTATATACCACTTAGTTAATATAAAACGCAACTGCAAGAGTAGAAATAACATTAATAATTTCACTTACATACCACTTAGTTAATATAAAACAATACAAATAAGATTTTGTTTTCATATGATTCAGAAATTTACATACCACTTAGTTAATATAAAACTGTGGATTACCAGTTCCTAAAAAACTAAAAGAAAAAATATTTACATACCACTTAGTTAATATAAAACCTATCATTAGATTGTGAACCTATCTCTATTTTCCTATATTTACATACCACTTAGTTAATATAAAACTAAATTTTGTATTCTTGACATTGACATCCAATATATAATTTACATACCACTTAGTTAATATAAAACTGATAGAGAAACTTGAAAGCGAAGATGTGCTATTAAATTTACATACCACTTAGTTAATATAAAACGGAAACTTGTATAATCACAATAACTAGCTTCGTTTCATTTACATACCACTTAGTTAATATAAAACTTCACTTTGATTTAACTCATCTCTTTTCACACCTTTATTTACATACCACTTAGTTAATATAAAACAATGCTGATAATAGTAAAATTAGCTCAATTTCTCGATTTACATACCACTTAGTTAATATAAAACCTGTATATTTACAAGTTTTATATAAATATTAGTTTCCAATTTACATACCACTTAGTTAATATAAAACCCAGTTGAAAGGTATCCTATTATCTGCATTTCTTAAATTTACATACCACTTAGTTAATATAAAACTTAACTAAAACTTGAAAACCATAATCTTTAAGCTTAAATTTACATACCACTTAGTTAATATAAAAC

>CP026613|10|10|2248100-2248988|CRISPRCasFinder
ATTTAAATTCAATATAGCTAATATAAAAC	TATATAAAACGAAAGTTATCTCTTAATAAATGTTCAATAGACTATG
CTTTATATACCACTTAGTTAATATAAAAC	GCAACTGCAAGAGTAGAAATAACATTAATAATTTC
ACTTACATACCACTTAGTTAATATAAAAC	AATACAAATAAGATTTTGTTTTCATATGATTCAGAA
ATTTACATACCACTTAGTTAATATAAAAC	TGTGGATTACCAGTTCCTAAAAAACTAAAAGAAAAAAT
ATTTACATACCACTTAGTTAATATAAAAC	CTATCATTAGATTGTGAACCTATCTCTATTTTCCTAT
ATTTACATACCACTTAGTTAATATAAAAC	TAAATTTTGTATTCTTGACATTGACATCCAATATATA
ATTTACATACCACTTAGTTAATATAAAAC	TGATAGAGAAACTTGAAAGCGAAGATGTGCTATTAA
ATTTACATACCACTTAGTTAATATAAAAC	GGAAACTTGTATAATCACAATAACTAGCTTCGTTTC
ATTTACATACCACTTAGTTAATATAAAAC	TTCACTTTGATTTAACTCATCTCTTTTCACACCTTT
ATTTACATACCACTTAGTTAATATAAAAC	AATGCTGATAATAGTAAAATTAGCTCAATTTCTCG
ATTTACATACCACTTAGTTAATATAAAAC	CTGTATATTTACAAGTTTTATATAAATATTAGTTTCCA
ATTTACATACCACTTAGTTAATATAAAAC	CCAGTTGAAAGGTATCCTATTATCTGCATTTCTTAA
ATTTACATACCACTTAGTTAATATAAAAC	TTAACTAAAACTTGAAAACCATAATCTTTAAGCTTAA
ATTTACATACCACTTAGTTAATATAAAAC

>CP026613|10|4|2248100-2248988|CRT
ATTTAAATTCAATATAGCTAATATAAAAC	TATATAAAACGAAAGTTATCTCTTAATAAATGTTCAATAGACTATG
CTTTATATACCACTTAGTTAATATAAAAC	GCAACTGCAAGAGTAGAAATAACATTAATAATTTC
ACTTACATACCACTTAGTTAATATAAAAC	AATACAAATAAGATTTTGTTTTCATATGATTCAGAA
ATTTACATACCACTTAGTTAATATAAAAC	TGTGGATTACCAGTTCCTAAAAAACTAAAAGAAAAAAT
ATTTACATACCACTTAGTTAATATAAAAC	CTATCATTAGATTGTGAACCTATCTCTATTTTCCTAT
ATTTACATACCACTTAGTTAATATAAAAC	TAAATTTTGTATTCTTGACATTGACATCCAATATATA
ATTTACATACCACTTAGTTAATATAAAAC	TGATAGAGAAACTTGAAAGCGAAGATGTGCTATTAA
ATTTACATACCACTTAGTTAATATAAAAC	GGAAACTTGTATAATCACAATAACTAGCTTCGTTTC
ATTTACATACCACTTAGTTAATATAAAAC	TTCACTTTGATTTAACTCATCTCTTTTCACACCTTT
ATTTACATACCACTTAGTTAATATAAAAC	AATGCTGATAATAGTAAAATTAGCTCAATTTCTCG
ATTTACATACCACTTAGTTAATATAAAAC	CTGTATATTTACAAGTTTTATATAAATATTAGTTTCCA
ATTTACATACCACTTAGTTAATATAAAAC	CCAGTTGAAAGGTATCCTATTATCTGCATTTCTTAA
ATTTACATACCACTTAGTTAATATAAAAC	TTAACTAAAACTTGAAAACCATAATCTTTAAGCTTAA
ATTTACATACCACTTAGTTAATATAAAAC

>CP026613|10|5|2248176-2248988|PILER-CR
TTTATATACCACTTAGTTAATATAAAACG	CAACTGCAAGAGTAGAAATAACATTAATAATTTCA
CTTACATACCACTTAGTTAATATAAAACA	ATACAAATAAGATTTTGTTTTCATATGATTCAGAAA
TTTACATACCACTTAGTTAATATAAAACT	GTGGATTACCAGTTCCTAAAAAACTAAAAGAAAAAATA
TTTACATACCACTTAGTTAATATAAAACC	TATCATTAGATTGTGAACCTATCTCTATTTTCCTATA
TTTACATACCACTTAGTTAATATAAAACT	AAATTTTGTATTCTTGACATTGACATCCAATATATAA
TTTACATACCACTTAGTTAATATAAAACT	GATAGAGAAACTTGAAAGCGAAGATGTGCTATTAAA
TTTACATACCACTTAGTTAATATAAAACG	GAAACTTGTATAATCACAATAACTAGCTTCGTTTCA
TTTACATACCACTTAGTTAATATAAAACT	TCACTTTGATTTAACTCATCTCTTTTCACACCTTTA
TTTACATACCACTTAGTTAATATAAAACA	ATGCTGATAATAGTAAAATTAGCTCAATTTCTCGA
TTTACATACCACTTAGTTAATATAAAACC	TGTATATTTACAAGTTTTATATAAATATTAGTTTCCAA
TTTACATACCACTTAGTTAATATAAAACC	CAGTTGAAAGGTATCCTATTATCTGCATTTCTTAAA
TTTACATACCACTTAGTTAATATAAAACT	TAACTAAAACTTGAAAACCATAATCTTTAAGCTTAAA
TTTACATACCACTTAGTTAATATAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD41944.1\|2245181_2245649_+\|DUF2975-domain-containing-protein	unknown	unknown	gnl\|CDD\|378586
CP026613.2\|AVD41953.1\|2253670_2254327_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367360
CP026613.2\|AVD44785.1\|2244915_2245074_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41956.1\|2256995_2257235_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41952.1\|2252431_2253517_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
CP026613.2\|AVD41948.1\|2249285_2249471_+\|integrase	unknown	unknown	gnl\|CDD\|271189
CP026613.2\|AVD41943.1\|2243497_2244196_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|274612
CP026613.2\|AVD41947.1\|2247099_2247393_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41946.1\|2246017_2246191_+\|succinate-dehydrogenase	unknown	unknown	unknown
CP026613.2\|AVD41941.1\|2241828_2242302_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
CP026613.2\|AVD41939.1\|2239056_2240091_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	unknown	unknown	gnl\|CDD\|234761
CP026613.2\|AVD41949.1\|2249623_2250496_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP026613.2\|AVD41954.1\|2254541_2255834_-\|diaminopimelate-decarboxylase	unknown	unknown	gnl\|CDD\|143501
CP026613.2\|AVD41957.1\|2257405_2258053_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD41940.1\|2240768_2241536_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379530
CP026613.2\|AVD41942.1\|2242682_2243240_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP026613.2\|AVD41955.1\|2255851_2257045_-\|aspartate-kinase	unknown	unknown	gnl\|CDD\|235843
CP026613.2\|AVD41950.1\|2250889_2251468_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
CP026613.2\|AVD41945.1\|2245659_2245875_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226181
CP026613.2\|AVD41951.1\|2251524_2252241_-\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD41944.1\|2245181_2245649_+\|DUF2975-domain-containing-protein	gnl\|CDD\|378586	pfam11188, DUF2975, Protein of unknown function (DUF2975). This family of bacterial proteins have no known function. These proteins are likely to be integral membrane proteins. The proteins contain a highly conserved glutamic acid close to their C-terminus.	0.000275657
CP026613.2\|AVD41953.1\|2253670_2254327_-\|hypothetical-protein	gnl\|CDD\|367360	pfam03154, Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.	2.38545e-06
CP026613.2\|AVD41952.1\|2252431_2253517_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	4.292e-37
CP026613.2\|AVD41949.1\|2249623_2250496_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.10432e-65
CP026613.2\|AVD41943.1\|2243497_2244196_+\|alpha/beta-hydrolase	gnl\|CDD\|274612	TIGR03502, lipase_Pla1_cef, extracellular lipase, Pla-1/cef family. Members of this protein family are bacterial lipoproteins largely from the Gammaproteobacteria. Characterized members are expressed extracellularly and have esterase activity. Members include the lipase Pla-1 from Aeromonas hydrophila (AF092033) and CHO cell elongation factor (cef) from Vibrio hollisae.	0.000240752
CP026613.2\|AVD41941.1\|2241828_2242302_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.50449e-48
CP026613.2\|AVD41939.1\|2239056_2240091_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	gnl\|CDD\|234761	PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated.	5.49771e-179
CP026613.2\|AVD41954.1\|2254541_2255834_-\|diaminopimelate-decarboxylase	gnl\|CDD\|143501	cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase. Diaminopimelate decarboxylase (DapDC, EC 4.1.1.20) participates in the last step of lysine biosynthesis. It converts meso-2,6-diaminoheptanedioate to L-lysine. It is a fold type III PLP-dependent enzyme that contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. DapDC exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	5.1589e-169
CP026613.2\|AVD41940.1\|2240768_2241536_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379530	pfam14268, YoaP, YoaP-like. The YoaP-like domain is found at the C-terminus of the B. subtilis YoaP protein. It is found in bacteria and archaea, and is approximately 40 amino acids in length. The family is found in association with pfam00583. There is a single completely conserved residue A that may be functionally important.	5.60315e-14
CP026613.2\|AVD41942.1\|2242682_2243240_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.82601e-09
CP026613.2\|AVD41955.1\|2255851_2257045_-\|aspartate-kinase	gnl\|CDD\|235843	PRK06635, PRK06635, aspartate kinase; Reviewed.	8.79458e-175
CP026613.2\|AVD41950.1\|2250889_2251468_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	7.51313e-74
CP026613.2\|AVD41945.1\|2245659_2245875_+\|transcriptional-regulator	gnl\|CDD\|226181	COG3655, COG3655, Predicted transcriptional regulator [Transcription].	6.30851e-28
CP026613.2\|AVD41951.1\|2251524_2252241_-\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	4.04358e-99
CP026613.2\|AVD41948.1\|2249285_2249471_+\|integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.23694e-06

>CP026613.2|AVD41947.1|2247099_2247393_-|hypothetical-protein
MDEMIVYNKNFYPNDIFSRLDFSKIKRQLKLIDNELSDFGNICIIEKEHYTISVNSIGEINVYYDLEYENKVYGIVEEIEKLFKSQVGKFSISTYRN
>CP026613.2|AVD41946.1|2246017_2246191_+|succinate-dehydrogenase
MKRKLSTYFKGYVLGLCIAFLLFSFILKKLMISNIIGIVIGTGIAFLLICLFNKKRK
>CP026613.2|AVD41945.1|2245659_2245875_+|transcriptional-regulator
MAIVVNLDVMMAKRKISLKDLAEKIDITNANLSILKTGKAKAIRFTTLNEICKALDCQPGDILEYVEDENE
>CP026613.2|AVD41944.1|2245181_2245649_+|DUF2975-domain-containing-protein
MITKFFSNILSVFLYFLLSLLGVAGIIFLCMIPMFLYDFSSDKVIALITRILYFSDYFVVILFLIFIINSTKYSPFILENVKRFKMMGCCLLVNTIIECVVGYKSNTSLIMIFGDNSGGISPLMVISFIFALMCFVIAETFDKAIKIKKDNDLTI
>CP026613.2|AVD44785.1|2244915_2245074_+|hypothetical-protein
MLIPLLKYIISTNGIKIIYNKVKIIPISIISFNILQLIFFFIQIYHLIHSYL
>CP026613.2|AVD41943.1|2243497_2244196_+|alpha/beta-hydrolase
MEKKYFKIHGVPSILWGNPSSKLYIYIHGQCGNKEEAEAFANIAVPQECQVLSVDLPEHGERKGEKNSFDPWHVVPELVSIMEYAKCHWNQISLYANSIGAWFSMLSFEKENLRECIFVSPILDMQQLISNMMLWANVSEEQLKHELIIPTSFGHTLSWEYLQYVKQHPIIQWNVPTKILYGKHDELTEIGVVEKFVEKFNCNLTIMEDGKHWFNTPQELNSLYEWLNTLVK
>CP026613.2|AVD41942.1|2242682_2243240_-|TetR/AcrR-family-transcriptional-regulator
MRVSREIVIQATSDIVNKDGLNKVSLKVIAENLGIRTPSLYNHIESLDDLLLEVAHKGMREMNNQMTKAVIGNFGDTAIKCISIAYFNFIISNPGVYETIQWATWHGNNETLEIFDEYKSLLEKLILSCNLNTKNTGEVLNLIMSVLHGYSTLQLGKSLMSKEEAIKGLTDSIDTVLLGIHKKYD
>CP026613.2|AVD41941.1|2241828_2242302_+|GNAT-family-N-acetyltransferase
MFNEHLIRELKEDDIKDALELIWNVFEEFESPDYCDEGIMTFHQFIEYNSIIEKVKEKTLFFWGCFDCEKLIGVLAIRDLNHICMLFVDKNYHKRGVAKKLMTIGIEYCICNKFSLTEITVNSSPYAVEVYHKLGFKDTAVEQISDGIRFTPMKLLI
>CP026613.2|AVD41940.1|2240768_2241536_-|GNAT-family-N-acetyltransferase
MQIIDININNIDNEHICCSISEKKGENCVFSKKLWMKNNFDKGLVFKRFDVRGKAFIEYIPAENAWCPIIADNYMFINCFWISGKFKGKGYSNLLLQECVDDAKLKGKYGLVVLSSSKKMPFLSDAKYLKYKRFRLADTSVPNYELLYFPFTDNTPIPCFKNCVKQRKLNENGIVLYYSNQCPHTEKYALILKKIANSRGIDANLIKFETANEAQNAPAPFTAYSLFFNGEFVTNEVLSEKKIEKFLENEVKKFN
>CP026613.2|AVD41939.1|2239056_2240091_-|N-acetyl-gamma-glutamyl-phosphate-reductase
MSKIKVGIIGATGYVGAELIRLLINHDKAELTAIGSNSYVGKDIVDIYPSIGYKNNMICIENEKVIDVCDVVFTALPHGVSEKFVIKAIKSKKKVIDLGADFRIKDEEVYSKWYGVSFIDKILHKKAVYGLSEIYKDDIKDADIIANPGCYPTSISLPLMPLLSSKLIKSNNIIIDSKSGLTGAGRELSISSHFTEVNENITAYKIGKHRHTPEIEQNLSESCQEKVSVVFTPNLIPVNRGILSTIYCTKADNISINDIHRKLTDYYEFKEFIEVLPLDKVASLKNVRFSNKCVISLHENVDTLIICSAIDNMIKGAAGQAIQNMNIMFGIEENTGLKNIVPSF
>CP026613.2|AVD41948.1|2249285_2249471_+|integrase
MKIHNLRYTGASLLHLVGTNMKIVSERFCHTDLKLTMNIYSYVLEEMYKKTSNNLSKILFR
>CP026613.2|AVD41949.1|2249623_2250496_-|MurR/RpiR-family-transcriptional-regulator
MEETNEMKDSKHLISNIQSQYTRLSKGQKLIAQYILNNYDKVAFMTACKLGETVGVSESTVVRFANALGYSGYPKLQAALQELIKNKLTTVQRVEMAHDYSDDFAILNKVLKSDIDNIRSTLEEIDERAFKEASNKLLRARKIYILGMRSSFVVAQYLGFYLDIILDNVHIIRMDMGDAFEQIVRINEEDVIVAISFPRYSKKSYQIVNYAKEKGAHVISLTDSLFAPVASLADNTLLVKSNMASFVDSLVPALSISNALAISVGMKEKEDIKQHFDDLEQIWKRYSVYE
>CP026613.2|AVD41950.1|2250889_2251468_-|methyltransferase-domain-containing-protein
MAYAKYLTKITDINKFYLENIINEGDIVIDATMGNGYDTRYLAEKVGEKGFVYAFDIQEEAIKSTRKKLEKEGYTDRVKLIFDGHEKMNQYIKEEVSCVLFNLGYLPRAKHSIITKPDTTLKAIKLSLEMLKENGVISIAIYTGHDGGQEEKDCIYNLVNNLNQDEFNVLESKFLNQVNNPPQLILIEKKKA
>CP026613.2|AVD41951.1|2251524_2252241_-|rRNA-pseudouridine-synthase
MRINKYIASCGIASRRKAEEIILEGRIKVNGSIVKELFFNVDEEKDIVEFDNKKVKPSENYIYIVLNKPEGYITTVKDQFNRPSVIDILKDVKERVYPIGRLDYETSGLLILTNDGDLTYKLTHPKHEIDKTYVASVKGIISGDEIRKFETGLKIEDYTTAPAKIKVTKENKEKNYSVCEITIHEGRNRQVRKMCKAINHPVLNLRRISVGKIVLKDTKVGEYRYLTEDEIKYLKSIK
>CP026613.2|AVD41952.1|2252431_2253517_+|AI-2E-family-transporter
MIIISKENIKYYLIVVFIGILFFKFINTPSDFISSIEGFLKFFSPFLLAILLALLLNPLVMLFEVKFKAHRLLAIFLSYIFIGFILAFAIRLLIPSIANTLNRLINEMPMYTDYINSFIEKNMSNIDFLKTLIPHIQHSLDNVLKEASNFIGKISKNFLIYTLSISSMLFNMTMGFILSIYIIYDKEKIALGFKRFLYSSTTRNKADSIIEFFRTTHDIFYDYLLGRILDSLIIGIIAFLGFQFVIRIENALFLASIIFLGNIIPYFGPFIGAIPPIAMTILYSPQKTIWVIAFLFILQQLDGNFIEPKVMGNQVGIGAIWVISAILVGQSLFGFIGVFLSVPIAAVVKTYVDKYIDNRLQ
>CP026613.2|AVD41953.1|2253670_2254327_-|hypothetical-protein
MRGRVILLISILSIFLVGCSFNKKDEINLVEQGKTYLEKHNYKKAMESLSSALEEDSTNENARAMYMQAMRMSNMTEFEELKNYEGAIKELKLIEKIKNGSSVIKEEATKKKEELTKLEKEQNEAEEQRKKKAKDTAGEDRYRVESDARKSSYSGSSKNNKSSSKNNKKSDSDKSDNNNNSSQNQEKPNSSNPTPAPTPQDTSGGSDSSGNSQNSNNQ
>CP026613.2|AVD41954.1|2254541_2255834_-|diaminopimelate-decarboxylase
MKLHGTMTVNNDELYIGGVSCLELSKKYQTPLYVFDEALVRQNCREYIKYFRAREGKNKVAYAGKAFLPLYMCNLINEEQMCLDVVSGGELYTAYKSNFPMEKVFFHGNNKTKEEINMGLDLGVGKFVVDNFYELDLLEALCEDKGKTQEIYFRITPGIEAHTHDYIKTGQIDSKFGFALVNGDLFRAIEKLSDYKNIKLVGLHAHIGSQIFDVEPYIDTVDIMMNLVKEIKEKFNIHLTEIDLGGGVGVYYSEGDKPKTIKEFCETIITKAETSCKELGIEVPTLVIEPGRSIVANAGSTLYTVGSIKDIKDVRVYVSVDGGMTDNVRPSLYQASYECSIVNKINHKAMNHVTIAGKCCESGDILIGDINIMDIKSGDILITTSTGAYGYSMSSNYNKIPRAAVVSVFDGNDKIICKRQSYEDLLALEV
>CP026613.2|AVD41955.1|2255851_2257045_-|aspartate-kinase
MSIIVQKYGGSSVADTEKIKSIAENIIERRKENPQMVIVVSAMGKSTDEYITLAKELSNEPSKRELDALMSTGEMISASLLSIALNALGCKAISYNAYQLNIKTSGLHGKSQIDDINVNRIKNSLDEGNVVIVTGFQGINEDGDVTTLGRGGSDTSAVALAVKLNGKCEIYTDVDGIYFTDPRKYSKASKLDEIEYEEMLELASLGAQVMHSRSIELAQKYGVEIYVGRTCGTEKGTYIRGGKDMKLEDKVITGLATSDDDSSITIKDFKAENISSLFEDIATIGISVDMISQTAPILDKISVSFTVPKEELGECKKIVSKYTDEEHVVIDNNITKFSLVGLGMKNTSGVAAKVFKIFNENGIMIKLITTSEIRITCAINSDDKQVAIEKIAEVFNI
>CP026613.2|AVD41956.1|2256995_2257235_-|hypothetical-protein
MMKGYIAEEILLTDKFSGLMQNMHKAVTFKVVSYKVTWSMKFTRPKYTFGRFYLSKFSLRGRKHEYNCPKIWRKFSSRY
>CP026613.2|AVD41957.1|2257405_2258053_-|hypothetical-protein
MQIILQGECTMTNMEKEILLLISRVRCVTESQFRKIYGDQKRYNKKNFKKTLRKMCSEYTLKKYPCDVDYYNYKDLSYVYYLNGSKLFKGDDLIKALVGSELVVRINTAGCDVKRFYRNVSVDDVKYDLFIEYTDQFGNIKQVLVDVDLNNEIDISKYENLSKKIDKSTIPFFKVPNVLVVTPDNLSELNDLERYDNEYSINFIDLGLNKLFNCI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_11

2359090-2361688

TypeI-B

III-B

Consensus_repeat	Method
ATTTAAATACATCTCATGTTACTGTTTAAC	CRISPRCasFinder
ATTTAAATACATCTCATGTTACTGTTTAAC	CRT
ATTTAAATACATCTCATGTTACTGTTTAAC	PILER-CR

39 spacers

cas4,cas1,cas2,cas3,cas5,cas7b,cas8b1,cas6

The CRISPR arrays of CP026613_11

>merge|CP026613|11|2359090-2361688|CRISPRCasFinder,CRT,PILER-CR
ATTTAGATACATCTTATGTTACTGTTTAACCAAAGTAGCTTTTACTGGAATAACAAGTACTAATGAATTTAAATACATCTCATGTTACTGTTTAACAATGGAAAGTGTATTTAAAAACTATATTGAATATTTATTTAAATACATCTCATGTTACTGTTTAACGGTATTAGCAAATGTGGAACAAGTAATTAAGTTAGCATTTAAATACATCTCATGTTACTGTTTAACTTTTTTCCCCCTTTAAATTTTAAAACTAATAATTTAATTTAAATACATCTCATGTTACTGTTTAACATCTACTAGAGAAATTGATATACAAAGAGACTCTTAATTTAAATACATCTCATGTTACTGTTTAACCTACTCAAACAAGGTAATCATGTACATAACATAGAATTTAAATACATCTCATGTTACTGTTTAACATGCTTTTTGTGTGATGGAAATGGAAGGACTACAAATTTAAATACATCTCATGTTACTGTTTAACCCGTTTCCGAAAAAGTCAATATCACGACTCAACACAATTTAAATACATCTCATGTTACTGTTTAACTAGATACCCAAAAACCAGCTAGAGGGGCATCTTTGAATTTAAATACATCTCATGTTACTGTTTAACTATGCCACAAGCAGAAGAAATTGGAATAGCTACTGTATTTAAATACATCTCATGTTACTGTTTAACGAAGAGCAATCTCTTAACACTTCACAAAAAGAAATATTTAAATACATCTCATGTTACTGTTTAACGTTTACACCTATTCTAAATAGCAAATCACTTGCCTTATTTAAATACATCTCATGTTACTGTTTAACGACCAAGAACCTATCACTAAACTCATGTATAAACATATTTAAATACATCTCATGTTACTGTTTAACTGGTAAAATGGCTAAGAAAAAAGAGCTAGAAGAAAAATTTAAATACATCTCATGTTACTGTTTAACGGAGCTTAAAAATGGGGGTTCAATTAACTCAAGAAAATTTAAATACATCTCATGTTACTGTTTAACTAAGTTATTTTTGTACATTACGATTTATTATATTTAAATTTAAATACATCTCATGTTACTGTTTAACTATTACAGATATAGCACATTCGCTCATCTTCAGACTATTTAAATACATCTCATGTTACTGTTTAACACTAAAGAAAAAGCTAAAAGTAAAAAAGTAGATGGAATTTAAATACATCTCATGTTACTGTTTAACATAAAAAATTAAAATAAATAAAATCAAAATAAGTGTATTTAAATACATCTCATGTTACTGTTTAACAGGGGATATTCAGTTGTCAATGTACACTTTTTTCTAATTTAAATACATCTCATGTTACTGTTTAACGAAGACATTTTTTATTCTGCAAGTAATTTTTATTCTAATTTAAATACATCTCATGTTACTGTTTAACCTACTAAAAATACTAAATTAGATGCTAAGTTCAATAATTTAAATACATCTCATGTTACTGTTTAACCAACTATTGTTGAATTAGATAGTGCTTTAAGAGATAATTTAAATACATCTCATGTTACTGTTTAACAATGGTATGGTAATAAGATTAAAGATTGGATAATCCATTTAAATACATCTCATGTTACTGTTTAACAGTAGAGATAATTGCTGAAATAGAAAAAGCTAAAGAATTTAAATACATCTCATGTTACTGTTTAACCTTTTGATAATAAAAGAACATCAGTTAGATTTGAATTTAAATACATCTCATGTTACTGTTTAACTGATGGAGATGTTCTAGGAAGTGCTGCAAAAGAAAAATTTAAATACATCTCATGTTACTGTTTAACTCCAGAATTAACTTCATTTACTAAATTGAATTTTAAATTTAAATACATCTCATGTTACTGTTTAACTTCAGAGGAAGCAAGAAGAGAAGGTTTAGATGCTGATTTAAATACATCTCATGTTACTGTTTAACACAGACTGGTGACCCAGATATAACTAAACTTCAAAAATTTAAATACATCTCATGTTACTGTTTAACCAGCTATGTAAAACTCTTTTTTACCATTATAAAATATTTAAATACATCTCATGTTACTGTTTAACAGATGGAGTTAGATATAATAATCCATTTAGATATATATTTAAATACATCTCATGTTACTGTTTAACAAATGCAGATGAACTTGAAAGAGCTACAAAACTATAATTTAAATACATCTCATGTTACTGTTTAACTCTTGAAGACGATATTTTCCAATAGAAGGATTAATAATTTAAATACATCTCATGTTACTGTTTAACGTTACAAAATGAATTAATACTTTATAAAGCATTTAAATTTAAATACATCTCATGTTACTGTTTAACAGAAATTGAACTTGGTCTACTAAATTTAGAGCAATAATTTAAATACATCTCATGTTACTGTTTAACTTAATATTTAATTCTCTATTTTCCTCTAATAAATCAATTTAAATACATCTCATGTTACTGTTTAACTAATACAAATAAAGAAGTTATAACAGCTACAATAAAATTTAAATACATCTCATGTTACTGTTTAACAAACATTTGATTTGGTGAGCCATCTGACTTAAACATATTTAAATACATCTCATGTTACTGTTTAAC

>CP026613|11|11|2359090-2361688|CRISPRCasFinder
ATTTAGATACATCTTATGTTACTGTTTAAC	CAAAGTAGCTTTTACTGGAATAACAAGTACTAATGA
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGAAAGTGTATTTAAAAACTATATTGAATATTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GGTATTAGCAAATGTGGAACAAGTAATTAAGTTAGC
ATTTAAATACATCTCATGTTACTGTTTAAC	TTTTTTCCCCCTTTAAATTTTAAAACTAATAATTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATCTACTAGAGAAATTGATATACAAAGAGACTCTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTCAAACAAGGTAATCATGTACATAACATAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATGCTTTTTGTGTGATGGAAATGGAAGGACTACAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CCGTTTCCGAAAAAGTCAATATCACGACTCAACACA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAGATACCCAAAAACCAGCTAGAGGGGCATCTTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATGCCACAAGCAGAAGAAATTGGAATAGCTACTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGAGCAATCTCTTAACACTTCACAAAAAGAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTTACACCTATTCTAAATAGCAAATCACTTGCCTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GACCAAGAACCTATCACTAAACTCATGTATAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC	TGGTAAAATGGCTAAGAAAAAAGAGCTAGAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	GGAGCTTAAAAATGGGGGTTCAATTAACTCAAGAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAAGTTATTTTTGTACATTACGATTTATTATATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATTACAGATATAGCACATTCGCTCATCTTCAGACT
ATTTAAATACATCTCATGTTACTGTTTAAC	ACTAAAGAAAAAGCTAAAAGTAAAAAAGTAGATGGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATAAAAAATTAAAATAAATAAAATCAAAATAAGTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGGGGATATTCAGTTGTCAATGTACACTTTTTTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGACATTTTTTATTCTGCAAGTAATTTTTATTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTAAAAATACTAAATTAGATGCTAAGTTCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAACTATTGTTGAATTAGATAGTGCTTTAAGAGATA
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGTATGGTAATAAGATTAAAGATTGGATAATCC
ATTTAAATACATCTCATGTTACTGTTTAAC	AGTAGAGATAATTGCTGAAATAGAAAAAGCTAAAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTTTTGATAATAAAAGAACATCAGTTAGATTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TGATGGAGATGTTCTAGGAAGTGCTGCAAAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCCAGAATTAACTTCATTTACTAAATTGAATTTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTCAGAGGAAGCAAGAAGAGAAGGTTTAGATGCTG
ATTTAAATACATCTCATGTTACTGTTTAAC	ACAGACTGGTGACCCAGATATAACTAAACTTCAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAGCTATGTAAAACTCTTTTTTACCATTATAAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGATGGAGTTAGATATAATAATCCATTTAGATATAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AAATGCAGATGAACTTGAAAGAGCTACAAAACTATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCTTGAAGACGATATTTTCCAATAGAAGGATTAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTACAAAATGAATTAATACTTTATAAAGCATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AGAAATTGAACTTGGTCTACTAAATTTAGAGCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTAATATTTAATTCTCTATTTTCCTCTAATAAATCA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAATACAAATAAAGAAGTTATAACAGCTACAATAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AAACATTTGATTTGGTGAGCCATCTGACTTAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC

>CP026613|11|5|2359090-2361688|CRT
ATTTAGATACATCTTATGTTACTGTTTAAC	CAAAGTAGCTTTTACTGGAATAACAAGTACTAATGA
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGAAAGTGTATTTAAAAACTATATTGAATATTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GGTATTAGCAAATGTGGAACAAGTAATTAAGTTAGC
ATTTAAATACATCTCATGTTACTGTTTAAC	TTTTTTCCCCCTTTAAATTTTAAAACTAATAATTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATCTACTAGAGAAATTGATATACAAAGAGACTCTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTCAAACAAGGTAATCATGTACATAACATAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATGCTTTTTGTGTGATGGAAATGGAAGGACTACAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CCGTTTCCGAAAAAGTCAATATCACGACTCAACACA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAGATACCCAAAAACCAGCTAGAGGGGCATCTTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATGCCACAAGCAGAAGAAATTGGAATAGCTACTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGAGCAATCTCTTAACACTTCACAAAAAGAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTTACACCTATTCTAAATAGCAAATCACTTGCCTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GACCAAGAACCTATCACTAAACTCATGTATAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC	TGGTAAAATGGCTAAGAAAAAAGAGCTAGAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	GGAGCTTAAAAATGGGGGTTCAATTAACTCAAGAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAAGTTATTTTTGTACATTACGATTTATTATATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATTACAGATATAGCACATTCGCTCATCTTCAGACT
ATTTAAATACATCTCATGTTACTGTTTAAC	ACTAAAGAAAAAGCTAAAAGTAAAAAAGTAGATGGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATAAAAAATTAAAATAAATAAAATCAAAATAAGTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGGGGATATTCAGTTGTCAATGTACACTTTTTTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGACATTTTTTATTCTGCAAGTAATTTTTATTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTAAAAATACTAAATTAGATGCTAAGTTCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAACTATTGTTGAATTAGATAGTGCTTTAAGAGATA
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGTATGGTAATAAGATTAAAGATTGGATAATCC
ATTTAAATACATCTCATGTTACTGTTTAAC	AGTAGAGATAATTGCTGAAATAGAAAAAGCTAAAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTTTTGATAATAAAAGAACATCAGTTAGATTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TGATGGAGATGTTCTAGGAAGTGCTGCAAAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCCAGAATTAACTTCATTTACTAAATTGAATTTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTCAGAGGAAGCAAGAAGAGAAGGTTTAGATGCTG
ATTTAAATACATCTCATGTTACTGTTTAAC	ACAGACTGGTGACCCAGATATAACTAAACTTCAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAGCTATGTAAAACTCTTTTTTACCATTATAAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGATGGAGTTAGATATAATAATCCATTTAGATATAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AAATGCAGATGAACTTGAAAGAGCTACAAAACTATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCTTGAAGACGATATTTTCCAATAGAAGGATTAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTACAAAATGAATTAATACTTTATAAAGCATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AGAAATTGAACTTGGTCTACTAAATTTAGAGCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTAATATTTAATTCTCTATTTTCCTCTAATAAATCA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAATACAAATAAAGAAGTTATAACAGCTACAATAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AAACATTTGATTTGGTGAGCCATCTGACTTAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC

>CP026613|11|6|2359156-2361688|PILER-CR
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGAAAGTGTATTTAAAAACTATATTGAATATTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GGTATTAGCAAATGTGGAACAAGTAATTAAGTTAGC
ATTTAAATACATCTCATGTTACTGTTTAAC	TTTTTTCCCCCTTTAAATTTTAAAACTAATAATTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATCTACTAGAGAAATTGATATACAAAGAGACTCTTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTCAAACAAGGTAATCATGTACATAACATAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATGCTTTTTGTGTGATGGAAATGGAAGGACTACAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CCGTTTCCGAAAAAGTCAATATCACGACTCAACACA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAGATACCCAAAAACCAGCTAGAGGGGCATCTTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATGCCACAAGCAGAAGAAATTGGAATAGCTACTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGAGCAATCTCTTAACACTTCACAAAAAGAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTTACACCTATTCTAAATAGCAAATCACTTGCCTT
ATTTAAATACATCTCATGTTACTGTTTAAC	GACCAAGAACCTATCACTAAACTCATGTATAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC	TGGTAAAATGGCTAAGAAAAAAGAGCTAGAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	GGAGCTTAAAAATGGGGGTTCAATTAACTCAAGAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAAGTTATTTTTGTACATTACGATTTATTATATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TATTACAGATATAGCACATTCGCTCATCTTCAGACT
ATTTAAATACATCTCATGTTACTGTTTAAC	ACTAAAGAAAAAGCTAAAAGTAAAAAAGTAGATGGA
ATTTAAATACATCTCATGTTACTGTTTAAC	ATAAAAAATTAAAATAAATAAAATCAAAATAAGTGT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGGGGATATTCAGTTGTCAATGTACACTTTTTTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	GAAGACATTTTTTATTCTGCAAGTAATTTTTATTCTA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTACTAAAAATACTAAATTAGATGCTAAGTTCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAACTATTGTTGAATTAGATAGTGCTTTAAGAGATA
ATTTAAATACATCTCATGTTACTGTTTAAC	AATGGTATGGTAATAAGATTAAAGATTGGATAATCC
ATTTAAATACATCTCATGTTACTGTTTAAC	AGTAGAGATAATTGCTGAAATAGAAAAAGCTAAAGA
ATTTAAATACATCTCATGTTACTGTTTAAC	CTTTTGATAATAAAAGAACATCAGTTAGATTTGA
ATTTAAATACATCTCATGTTACTGTTTAAC	TGATGGAGATGTTCTAGGAAGTGCTGCAAAAGAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCCAGAATTAACTTCATTTACTAAATTGAATTTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTCAGAGGAAGCAAGAAGAGAAGGTTTAGATGCTG
ATTTAAATACATCTCATGTTACTGTTTAAC	ACAGACTGGTGACCCAGATATAACTAAACTTCAAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	CAGCTATGTAAAACTCTTTTTTACCATTATAAAAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AGATGGAGTTAGATATAATAATCCATTTAGATATAT
ATTTAAATACATCTCATGTTACTGTTTAAC	AAATGCAGATGAACTTGAAAGAGCTACAAAACTATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TCTTGAAGACGATATTTTCCAATAGAAGGATTAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	GTTACAAAATGAATTAATACTTTATAAAGCATTTAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AGAAATTGAACTTGGTCTACTAAATTTAGAGCAATA
ATTTAAATACATCTCATGTTACTGTTTAAC	TTAATATTTAATTCTCTATTTTCCTCTAATAAATCA
ATTTAAATACATCTCATGTTACTGTTTAAC	TAATACAAATAAAGAAGTTATAACAGCTACAATAAA
ATTTAAATACATCTCATGTTACTGTTTAAC	AAACATTTGATTTGGTGAGCCATCTGACTTAAACAT
ATTTAAATACATCTCATGTTACTGTTTAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD42035.1\|2353748_2354753_-\|RIP-metalloprotease-RseP	unknown	unknown	gnl\|CDD\|308008
CP026613.2\|AVD42046.1\|2369815_2370397_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42042.1\|2365201_2366191_-\|CRISPR-associated-protein	cas7b	pfam05107_cas7b_CAS-I-B:CAS-I-C	gnl\|CDD\|377458
CP026613.2\|AVD42044.1\|2367934_2368630_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	cd09652_cas6_CAS-I:CAS-III	gnl\|CDD\|273848
CP026613.2\|AVD42047.1\|2370481_2372302_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
CP026613.2\|AVD42041.1\|2364459_2365200_-\|type-I-B-CRISPR-associated-protein-Cas5	cas5	cls001430_cas5_CAS-I-B	gnl\|CDD\|131641
CP026613.2\|AVD42039.1\|2358510_2359005_-\|Dna2/Cas4-domain-containing-protein	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|366863
CP026613.2\|AVD42032.1\|2350976_2351081_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42036.1\|2354765_2355920_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|235472
CP026613.2\|AVD42040.1\|2361877_2364436_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|187770
CP026613.2\|AVD42033.1\|2351338_2352163_-\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42034.1\|2352510_2353566_-\|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase	unknown	unknown	gnl\|CDD\|377382
CP026613.2\|AVD44788.1\|2356976_2357267_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP026613.2\|AVD42048.1\|2372687_2372801_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
CP026613.2\|AVD42043.1\|2366183_2367944_-\|CRISPR-associated-protein-Cse4	cas8b1	mkCas0106_cas8b1_CAS-I-B	gnl\|CDD\|188234
CP026613.2\|AXL65725.1\|2372499_2372598_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
CP026613.2\|AVD42037.1\|2356083_2356287_-\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226181
CP026613.2\|AVD42031.1\|2349740_2350865_+\|DUF3810-domain-containing-protein	unknown	unknown	gnl\|CDD\|378933
CP026613.2\|AVD42045.1\|2369173_2369380_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42038.1\|2357477_2358476_-\|type-I-B-CRISPR-associated-endonuclease-Cas1	cas1	cd09722_cas1_CAS-I-B	gnl\|CDD\|187853

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD42035.1\|2353748_2354753_-\|RIP-metalloprotease-RseP	gnl\|CDD\|308008	pfam02163, Peptidase_M50, Peptidase family M50.	1.00896e-72
CP026613.2\|AVD42042.1\|2365201_2366191_-\|CRISPR-associated-protein	gnl\|CDD\|377458	pfam05107, Cas_Cas7, CRISPR-associated protein Cas7. CRISPR-associated protein Cas7 is one of the components of the type I-B cascade-like antiviral defense complex. In Haloferax volcanii, Cas5, Cas6 and Cas7 form a small complex that aids the stability of CRISPR-derived RNA.	1.0311e-49
CP026613.2\|AVD42044.1\|2367934_2368630_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|273848	TIGR01877, CRISPR-associated_endoribonuclease_Cas6_1, CRISPR-associated endoribonuclease Cas6. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This broadly distributed, highly divergent Cas family is now characterized as an endoribonuclease that generates guide RNAs for host defense against phage and other invaders. The family contains a C-terminal motif GXGXXXXXGXG, where the each X between two Gly is hydrophobic and the spacer XXXXX contains (usually) one Arg or Lys. The seed alignment for the current version of this model has gappy columns removed. Members of this protein family are found associated with several different CRISPR/cas system subtypes, and consequently we designate this family Cas6.	3.07743e-18
CP026613.2\|AVD42047.1\|2370481_2372302_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.28674e-84
CP026613.2\|AVD42041.1\|2364459_2365200_-\|type-I-B-CRISPR-associated-protein-Cas5	gnl\|CDD\|131641	TIGR02592, hypothetical_protein_CTC_01466, CRISPR-associated protein Cas5, subtype I-B/HMARI. This is a CRISPR-associated protein unique to the hmari subtype of cas genes and CRISPR repeat, which is the only subtype present in Haloarcula marismortui ATCC 43049. The hmari type, though uncommon, is also found in the Aquificae, Thermotogae, Firmicutes, and Dictyoglomi.	8.69345e-53
CP026613.2\|AVD42039.1\|2358510_2359005_-\|Dna2/Cas4-domain-containing-protein	gnl\|CDD\|366863	pfam01930, Cas_Cas4, Domain of unknown function DUF83. This domain has no known function. The domain contains three conserved cysteines at its C-terminus.	9.71529e-51
CP026613.2\|AVD42036.1\|2354765_2355920_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|235472	PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
CP026613.2\|AVD42040.1\|2361877_2364436_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|187770	cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; DEAD/DEAH box helicase DNA helicase cas3'; Often but not always is fused to HD nuclease domain; signature gene for Type I.	1.91612e-33
CP026613.2\|AVD42034.1\|2352510_2353566_-\|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase	gnl\|CDD\|377382	pfam04551, GcpE, GcpE protein. In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway.	0
CP026613.2\|AVD44788.1\|2356976_2357267_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	1.32926e-26
CP026613.2\|AVD42048.1\|2372687_2372801_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.26855e-11
CP026613.2\|AVD42043.1\|2366183_2367944_-\|CRISPR-associated-protein-Cse4	gnl\|CDD\|188234	TIGR02591, cas_Csh1, CRISPR-associated protein Cas8b/Csh1, subtype I-B/HMARI. This domain is found in the C-terminal 2/3 of a family of CRISPR associated proteins of the Hmari subtype. Except for the two sequences from halophilic archaea this domain contains a pair of CXXC motifs.	9.50984e-15
CP026613.2\|AXL65725.1\|2372499_2372598_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.47328e-07
CP026613.2\|AVD42037.1\|2356083_2356287_-\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|226181	COG3655, COG3655, Predicted transcriptional regulator [Transcription].	5.3259e-13
CP026613.2\|AVD42031.1\|2349740_2350865_+\|DUF3810-domain-containing-protein	gnl\|CDD\|378933	pfam12725, DUF3810, Protein of unknown function (DUF3810). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 333 and 377 amino acids in length. There is a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterized family of peptidase enzymes.	4.41063e-125
CP026613.2\|AVD42038.1\|2357477_2358476_-\|type-I-B-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187853	cd09722, Cas1_I-B, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.60063e-138

>CP026613.2|AVD42039.1|2358510_2359005_-|Dna2/Cas4-domain-containing-protein
MKITGTLINYYFHCKRQCWLLGNRINLEENSEDVKIGRLLHELKEEKSKYKEIAIENIKIDKLTREYLVEVKKSDADIEAVKWQVLLYLKKLKEKGIVRKGKIEFIEKNKTNKKIVFVDLSEVSEEQLISIEREIVNLINSDKAPCPDLKKGCKKCAYYEYCYI
>CP026613.2|AVD42038.1|2357477_2358476_-|type-I-B-CRISPR-associated-endonuclease-Cas1
MGKTKYITSMGELTRKDNSICFRKNGRNVYIPVENTSEIFCLNEVSLNSKLLDFLSRANIVVHFFNYYGGYSGTFYPKEYLISGKVTVAQVKTFEDRREEIAKSIVNGIRINAINTLSHYYKHGNSEIQPLLSHLKKDSINKLEKSNNIKEILSVEGDIWQTFYTSFKYILREEFIFNKRVKRPPDNPLNAMISFGNSILYSKTVTAIYNTHLNQSVSFLHEPSESRFSLSLDLSENFKHVITFKTIFDLVNNRKINIEKHFDKNLNYCVLNDEGKQIFINSLEERLESVKEHPKLKRKVSLKTCIKLDAYKMLKCIMEEKSFIPYNIKDGL
>CP026613.2|AVD44788.1|2356976_2357267_-|CRISPR-associated-endonuclease-Cas2
MKKKNNLNYNYVFVVYDVGEKRVSKVFKVCKKYLSHFQKSVFRGEITPSKIMSLKRDLENIIDKDNDFVCIIKLMNSNTFEEEILGNNSNCENMIL
>CP026613.2|AVD42037.1|2356083_2356287_-|Cro/Cl-family-transcriptional-regulator
MISYAPLWKLLIDRKIKKMEFVNISGISISVLGRLGNDKSVSMDTMEKICLALDCKIEDVVEIKKGI
>CP026613.2|AVD42036.1|2354765_2355920_-|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MKKISILGSTGSIGKQTLDVVREHRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEENKALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIALANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFRGKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFGVEQENIDVVVHPQSIIHSMVQYADSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPDLETFPCLKLAYECLKMGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSISEPTLEEILETDRWSRAYVANLIKK
>CP026613.2|AVD42035.1|2353748_2354753_-|RIP-metalloprotease-RseP
MTIIAALILFSIIVLIHELGHFIFAKRSGIKVNEFSIGMGPKIYSVKKDTEYSIRALPIGGYVSMEGEDEEQISPNSFGNKSILQRFSTIVAGPIFNIILAAILLVPVFLYIGSPTTKLGKIMPDTPAQAVGLQVGDKINKINGNSVKTWDEVANIINTSSGGELKLSITRDGSDKVVNVTPKNNNGKYEIGIQPQREKDFWGSIVNACKTTVDMTKQMLTFLGQMITGRVPGGIGNAVAGPVGVIGMVSDAARTGIINVVYLAAVISLNLGIVNLLPIPALDGWRILMLLLEAVRGGKKLDPNKEGMINVVGFGALMLFMLFITYKDILRLFQ
>CP026613.2|AVD42034.1|2352510_2353566_-|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase
MSYERRKTREVSVGTVKIGGENPISIQSMTNTDTRDADATIAQIKRLEEAGCDIVRVAVPDIKAAKNIAKIKSSVNIPIIADIHFDYKLALEAIEQGVDGIRINPGNIGSIERVKMVVEKCKERNLKIRIGVNGGSLEKELLKKYGSATAEALVESAMGHIKILEDLDFHNIVISLKSSDIYKTVDAYELISKKVDYPLHIGITESGSVHKGTIKSSIGVGALLLKGIGDTVRISLTGDPVEEVIVGKQILRSLGLLNDKIKVISCPTCGRCNIDLISVVNEVEEKIGSMEKNITVAIMGCAVNGPGEAREADIGIAGGKGEGLLFKKGEIVRMIDGNKLVDELLEEIEKL
>CP026613.2|AVD42033.1|2351338_2352163_-|hypothetical-protein
MRYKKISSLPILVVALLITGTTTTFSLSTTNSEKTSVYLASTVSTITKKVSDIQSSKGLVYNENIPLFINNSKIQYDDTPYHWPSNVISLTNSSEKAIMDYEITCLAYDKNGKPLELYWDAQNVAADGEVGSVGFSPAGVDYGIVTGISPVSPKSYSHTYRKMQQSPPQDIISMFEKQQGKAWVENWLKEWKQMEKEYAKQNAIAPGKNQNDAFLLFDKWKQSTGEHGVKYIISCVKQVTFNDGSVWKNSAYENWLKSFQGKEVSNSVLENYYK
>CP026613.2|AVD42032.1|2350976_2351081_-|hypothetical-protein
MWKFYVLKILVKIFIKKDNRNVLTKIVRIEMLYR
>CP026613.2|AVD42031.1|2349740_2350865_+|DUF3810-domain-containing-protein
MSKKTKYFSLILFPIALLLNFIASKVPNIVEKYYSQFIDKIIVQVLSKVSGIFPFSLYEITMYIIVISIFLFLCCTLSTIFNKKKKLNIFLKNSILNILSIVSIVYFLFVVLWGINYNRIPLETTLINNYNLENNTSIQSKQHSVKELTKLYKFLIIKANETRKLTLQDKNGIVKSNTDYNGVINRAQLGYDNILDILPSVSGSYSKPKYIISSNLMCYTGITGIYFPFTGEANVNIAIPDLYIPCTVEHEMAHQRGFASEDEANFIAYLTSIKHPNIDFNYSGYILALNYTASALSKVDYNAYVDISAGISDSVRRDLKNESKFWQKYEGKIDEISNEFNNSYLKANGVTEGTQSYGKMVDLLLTYYELYPYN
>CP026613.2|AVD42040.1|2361877_2364436_-|CRISPR-associated-helicase/endonuclease-Cas3
MYFKKVELFDISNNINNCKNIYAHINKDRKPETLKEHSDLSYSYLMKLCVKKDLSSCLERIENKFFKKDSFLSKNFYREIILNMVYMHDIGKINSSFQFVKMQNKNFKKISLRYTKHSFISSMLYFDYYFEKLKKYDFEEKKILSLFLMINTYTISKHHGVLKSFKEFLFLFKDEFINIKENFKDLFKNNYNLELKSVPKTIEKMVRGVEGYLDDSHIKDNLAIDLYIYSKLMFSIVTSCDFYATSEYNSGNSIDGFGTIDNYNKYYDVLKKSEIYKGMKKYREYLNNNSECPYKENDINRLRTEMSIEAEDAITHNTRKRIFYLEAPTGSGKTVTSINLALKSIELNQSLKKIFYIFPFNTLVEQTKDVFINEIFNSVKDIQKDVVVINSITPIQTEDKEEDNKNVEYCVTKQEIDYDKSLLNRQFLHYPIVLTTNIGFFNYLFGVSREECFPLIHMINSVIILDEIQNYKNEIWKEIILFLEKYADILNIKFIIMSATLPRLNKLGCNDDNFAYLVKNREKFFKNHLFKDRVNISFEMLNSEINDIEEISEKVIEEAEIYNKILIEFIKKSSALEFYKNIKEKLKYKLEDVFLLTGDDNKLERKKIINKIKDMNSVILVATQVVEAGVDIDMDLGFKDISTIDSDEQFLGRINRSCKKLNSKVYFFNLDDASKIYKKDVRKERHLTLNEESNRKIILDKDFEKYYDKIIARIEENKHKHNDKNIEVFIKDIVGNLNFTEVKKWMALIPDLKEYTIFLNTIVKDESGNMIVGSDVWYEYISLLKNDNVEYSEKRVKMSEIMEKLDYFTYKVQKFDNSFNDLVGDIFYIDDGSKYFTEGKFDRSKFNQNEFL
>CP026613.2|AVD42041.1|2364459_2365200_-|type-I-B-CRISPR-associated-protein-Cas5
MEVLKFNLSGKTAFFKKPDVNSIIYFTYGNIHKIALMGILGACLGLGGYNQQSKEDEYPEFYSLLKDIKMSIVPKHEFGYINKKVHIFNNSVGYASKEEGGNLIIKEQWLENVSWDIYIQLEDSTTSRELKRRFLSNKFVYIPYLGKNDHIANISEIEIITDFYKTEDINRVDSFFIREDFEFEKSYFDDNDDYEEPFKYQEKLPYRLHRMTNQYILETIIFTNMSVKLINKKEVYQVKGLNLIFI
>CP026613.2|AVD42042.1|2365201_2366191_-|CRISPR-associated-protein
MNRRVYGVLGIKSIMSNWNADFSGYPKTTSTGEVFGSDKALKFPMKKMWENEGEKVLYVKSLKIDESKKGEIKIRPKSLKERYEELFDIEELKLEKNQQKVLENLFKAIDVKNFGATFAEEGNNIGIMGAVQIGQGFNKYEDINVEEQQILSPFRDPRAKDKKKSTNEEEKEDANSTTLGKKIVSDEAHYFYPFSINPKAYEVFVNMGVTDGYTKNDYKKFKEAALVSATAFNTNSKLGCENEFALFVETDEELYLPDLAQYITFEKREKSKDLICINIIHLIAELKDDIKSVEIYYNPYKIEIKPFKDEILPKIDKVKFMNIFTRKEV
>CP026613.2|AVD42043.1|2366183_2367944_-|CRISPR-associated-protein-Cse4
MVIGGENLLKDCLEIFEKEYKSLGNRLITDSYVLSYGTYILVKNFSNIDILEVSKNNVDSTEDIYHKFCELDYLSKLVSIDKSVDSKKIIHSNNYLSFFVKKENLRPDKNNNVKLTEEIIDNYYDALLNPRIKYKSDKRKKEIYDSIENKYGKVDENKLNKIRLWIKTNIFDLVESVKKDKNYLKIFFDEKIELYNDENQKYLYPNIYNKNDFNVIIDGKNYGLPNDNMQLNEKKPFLKLKTRIRNSTPYLISDDEVLLQKAFFDYLMNKAANGEEVVYISSEKGIHRKTDIPNEFSGYILRIKKGKELEIHDFDTVVNLNTKIKRINVECIIPIEYERHNLKPNLEIGYINNLIKLEKTIDTIFFNKFMCNSYFKEIKNINLSDLVLRDILIRHREGLYTWFYKGRDNIVKQTFSNYSMGIIENSIKNNNYIRAKEQYNLRIAIINYFHGGSNMADKIKVISESLFEKINSIKTKCIQSDEEYYFAVGQLASYFISKNKSKNKNHSLINPILNAQNRKKIMLEIEKLFKKYNYDISYDNNRRFKNLYSMIVGYEVEEKKVNRDLLIGGYLYYSLIYTKSEENENE
>CP026613.2|AVD42044.1|2367934_2368630_-|CRISPR-associated-endoribonuclease-Cas6
MIKCLEMSVKVYLLENISLDNTSKEIRKLIDDTLIIEEKYKEFHNKAGFKNYSFNLLYPLEKDKVYKKDCIYTFIIRTVDSELGMYFMNNLKNQYSDKIKVITMSKKVIPKKHIESIYSVTPIIAKFEDGYWRSNKTVEDLEKRIRENLIKKYNEFTNSKIDEDFELFQVIKFINRKPISTKYKNISLLGDKISFKVSENDMAQEIANFALGVGVGEINSRGFGFVNYRWL
>CP026613.2|AVD42045.1|2369173_2369380_+|hypothetical-protein
MNQSQEKDLEFIKNHWDLTIIEKERNVTRIIRYSLIILAIIAFFLPTKIKFSIYIFISLFCWLMYLVL
>CP026613.2|AVD42046.1|2369815_2370397_+|hypothetical-protein
MSYLLKINQFERSYDIGIFKNEQSIHKFIEKIPFVKKDSSNFNYTNYYMEFEDIPEYYEVNFNNYLYIITKFSFIPDGTEIFFTWDEIHCWDEKVATDKTFINGETLVDSYSFPNNEVKNYIQKRESLYRETKKYYKEKGLKIKRHALGSEDGEYVELVDDSILYLLDVHAVEIWEQSKNIEEFLYKYKKYFE
>CP026613.2|AVD42047.1|2370481_2372302_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MKKKYDFLIYAAIWLVAIIIFIFSLYHSIEHIKIINYTGIISSETQKVTKQELNNKRNDKLISQLDSILIELRTGNGKHRLQRCDNKEFQEKLIEMDAMWDSMKKEIRKVRNGGSGDKLYKLSEKYSSLSNQVVFISEKHSDIKLHFFATVLFIYLIISTISLLIWEYYNKRKFDKIFYTDNLTKIKNQVAFENRAIEILSHAYNKEYVLLNIDIDNFKYINDTHGYEYGDKVLVIVANVLAKTFNTKETCARVGSDNFVILAKYRESLLYEISKTLTDAIISELNMNVTQTISFCIGAYLVEIEKSNYKYINSIMDKANIAHKVSKMRGISSTVWYNENLLKQLQMENSIYNHMYKALENEEFQMYLQPKFQISSLNVVSAEALVRWFSPELGFLSPDQFIPLFEKSGFIIELDFYMLKKACSFIKKTFMKKNKYTYPIAVNFSRVTIYQNDFYQRFLDTVREYEIPFKYIEIEVTESAFNEISEPVISILDKLEKLGFLISMDDFGSGYSSLSLLCSLSINGLKLDKSLLKEKFNRAKVYSIIKCIIEMSHSIDMSIVCEGIETKKDLEFLKTVKCDLGQGFYFSKPIEEKEFFNKYVMDKQYN
>CP026613.2|AXL65725.1|2372499_2372598_-|diguanylate-cyclase
MSVSIGISLYSKYGEQFYKLYRHADSALYRVK
>CP026613.2|AVD42048.1|2372687_2372801_-|diguanylate-cyclase
MGYVFGDKILIDLAECLKRYFRETDTVGRVGGDEFII

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026613_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026613_15

3312232-3314353

Unclear

I-A

Consensus_repeat	Method
CTTTACATACCACTTAGTTAATATAAAAC	CRISPRCasFinder
CTTTACATACCACTTAGTTAATATAAAAC	CRT
TTTTATATTAACTAAGTGGTATGTAAAG	PILER-CR

32 spacers

cas2,cas1,cas4,cas3,cas5,cas7,cas8b2,cas6,WYL

The CRISPR arrays of CP026613_15

>merge|CP026613|15|3312232-3314353|CRISPRCasFinder,CRT,PILER-CR
ATTTAGATATGATTTAGTTAATATAAAACTTATCCATTCGCTTTAAAAAATCCCTTGCGAAACGTCTTTACATACCACTTAGTTAATATAAAACACTAACTCCAGTCCACTGTAATTACTATTCCTTAATCTTTACATACCACTTAGTTAATATAAAACCATTGCATATAAGATAAGCTGCATTGATTTTTTAGGTCTTTACATACCACTTAGTTAATATAAAACTTGCATTGTAAACTAAAATGCTTTATTCTATATTTACTTTACATACCACTTAGTTAATATAAAACTCTATTAATAAAATTATCTAATAAAGATGCAAACCCCTTTACATACCACTTAGTTAATATAAAACACACATATTGCCTTCCCTTAAATCTCCAAAATCTATGCTTTACATACCACTTAGTTAATATAAAACTTGCTTATACTTCTTGCAACCTGCTCCTATAACATAACTTTACATACCACTTAGTTAATATAAAATCTTGCTCTGCTTCGCTTTTACTCATTGTGTCAACTGCTTTACATACCACTTAGTTAATATAAAACACTACAATAATAGTGCCTTTTAGCAAAATTTACTAGCTTTACATACCACTTAGTTAATATAAAACACTTTTCACATAACCATGATACATTGCTCTACTTAACTTTACATACCACTTAGTTAATATAAAACAATCGGAGCTAATTTAGAAATTAAAGAGCTTACAATCTTTACATACCACTTAGTTAATATAAAACTAAATTATCTGCGTATCTTCCAGTCGCAAAAGCTACTTTACATACCACTTAGTTAATATAAAACCCGTATATATACCCATCGAAAACAAAACATTATTTCGCTTTACATACCACTTAGTTAATATAAAACTGTCAGTAGAAGCTATTTTTGAAGGTATTTTATGCCTTTACATACCACTTAGTTAATATAAAACTTTCTCTATCATATTGTATATTATCTCTATCACATGCTTTACATACCACTTAGTTAATATAAAACTTATCAATCTTAAGCCAAGTACCAGGTTGTCTACCAACTTTACATACCACTTAGTTAATATAAAACGAGAACATGCCCAACCAGATTTTAAGGGTGCTTTAAACTTTACATACCACTTAGTTAATATAAAACTATAAGACTTTTCTTCTGATTTAGTTTTAAACTGTCTCTCTTTACATACCACTTAGTTAATATAAAACCTATATTGAAATTTATTATGCCTTCATTTTACCATTCTTTACATACCACTTAGTTAATATAAAACCTGCTTTACCTGCCTTTCCCTGGTCTCTTGATACTCCTTTACATACCACTTAGTTAATATAAAACTTGGAGAAATGGCAAGACTTACGGAGTTTGGAGTTACTTTACATACCACTTAGTTAATATAAAACTTGCCACATCCCTCTTATATTCTTCTTTTTCATCAAACTTTACATACCACTTAGTTAATATAAAACTTTTCTCTTAAAAATCCGTTATTTTCTTAGTAAACCACTTTACATACCACTTAGTTAATATAAAACAGAAAATACAATTACAGGAGTTGTGAGGATATTTTAGACTTTACATACCACTTAGTTAATATAAAACTAGAAGATAGAAGAAGCAATATAAAAGCAAAAATGCGCTTTACATACCACTTAGTTAATATAAAACGGAATTACTTGGGACTAAAAAAGTAGAAACAGTTTTCTTTACATACCACTTAGTTAATATAAAACATGCTACAGCAGAAAAAGTTGTAAGTATAAGCAACTTTACATACCACTTAGTTAATATAAAACCTGTTAATCCAAAGAAAGTATCTCCCATTTTACCATCCTTTACATACCACTTAGTTAATATAAAACACTTGATGGTATTAAACTCTCTAATATTATGCAATTCTTTACATACCACTTAGTTAATATAAAACTATATCAAAGCTGGAAAATCAAGAGTACAAAGATATCTTTACATACCACTTAGTTAATATAAAACCTGTAAATAGTATCGTGTTTCTCTGTATAAAGAATCTTTACATACCACTTAGTTAATATAAAACTTGTAAAGCTCCTAAATCTGCTCCTGCTAGAATATATTGCTTTACATACCACTTAGTTAATATAAAAC

>CP026613|15|15|3312232-3314353|CRISPRCasFinder
ATTTAGATATGATTTAGTTAATATAAAAC	TTATCCATTCGCTTTAAAAAATCCCTTGCGAAACGT
CTTTACATACCACTTAGTTAATATAAAAC	ACTAACTCCAGTCCACTGTAATTACTATTCCTTAAT
CTTTACATACCACTTAGTTAATATAAAAC	CATTGCATATAAGATAAGCTGCATTGATTTTTTAGGT
CTTTACATACCACTTAGTTAATATAAAAC	TTGCATTGTAAACTAAAATGCTTTATTCTATATTTA
CTTTACATACCACTTAGTTAATATAAAAC	TCTATTAATAAAATTATCTAATAAAGATGCAAACCC
CTTTACATACCACTTAGTTAATATAAAAC	ACACATATTGCCTTCCCTTAAATCTCCAAAATCTATG
CTTTACATACCACTTAGTTAATATAAAAC	TTGCTTATACTTCTTGCAACCTGCTCCTATAACATAA
CTTTACATACCACTTAGTTAATATAAAAT	CTTGCTCTGCTTCGCTTTTACTCATTGTGTCAACTG
CTTTACATACCACTTAGTTAATATAAAAC	ACTACAATAATAGTGCCTTTTAGCAAAATTTACTAG
CTTTACATACCACTTAGTTAATATAAAAC	ACTTTTCACATAACCATGATACATTGCTCTACTTAA
CTTTACATACCACTTAGTTAATATAAAAC	AATCGGAGCTAATTTAGAAATTAAAGAGCTTACAAT
CTTTACATACCACTTAGTTAATATAAAAC	TAAATTATCTGCGTATCTTCCAGTCGCAAAAGCTA
CTTTACATACCACTTAGTTAATATAAAAC	CCGTATATATACCCATCGAAAACAAAACATTATTTCG
CTTTACATACCACTTAGTTAATATAAAAC	TGTCAGTAGAAGCTATTTTTGAAGGTATTTTATGC
CTTTACATACCACTTAGTTAATATAAAAC	TTTCTCTATCATATTGTATATTATCTCTATCACATG
CTTTACATACCACTTAGTTAATATAAAAC	TTATCAATCTTAAGCCAAGTACCAGGTTGTCTACCAA
CTTTACATACCACTTAGTTAATATAAAAC	GAGAACATGCCCAACCAGATTTTAAGGGTGCTTTAAA
CTTTACATACCACTTAGTTAATATAAAAC	TATAAGACTTTTCTTCTGATTTAGTTTTAAACTGTCTCT
CTTTACATACCACTTAGTTAATATAAAAC	CTATATTGAAATTTATTATGCCTTCATTTTACCATT
CTTTACATACCACTTAGTTAATATAAAAC	CTGCTTTACCTGCCTTTCCCTGGTCTCTTGATACTC
CTTTACATACCACTTAGTTAATATAAAAC	TTGGAGAAATGGCAAGACTTACGGAGTTTGGAGTTA
CTTTACATACCACTTAGTTAATATAAAAC	TTGCCACATCCCTCTTATATTCTTCTTTTTCATCAAA
CTTTACATACCACTTAGTTAATATAAAAC	TTTTCTCTTAAAAATCCGTTATTTTCTTAGTAAACCA
CTTTACATACCACTTAGTTAATATAAAAC	AGAAAATACAATTACAGGAGTTGTGAGGATATTTTAGA
CTTTACATACCACTTAGTTAATATAAAAC	TAGAAGATAGAAGAAGCAATATAAAAGCAAAAATGCG
CTTTACATACCACTTAGTTAATATAAAAC	GGAATTACTTGGGACTAAAAAAGTAGAAACAGTTTT
CTTTACATACCACTTAGTTAATATAAAAC	ATGCTACAGCAGAAAAAGTTGTAAGTATAAGCAA
CTTTACATACCACTTAGTTAATATAAAAC	CTGTTAATCCAAAGAAAGTATCTCCCATTTTACCATC
CTTTACATACCACTTAGTTAATATAAAAC	ACTTGATGGTATTAAACTCTCTAATATTATGCAATT
CTTTACATACCACTTAGTTAATATAAAAC	TATATCAAAGCTGGAAAATCAAGAGTACAAAGATAT
CTTTACATACCACTTAGTTAATATAAAAC	CTGTAAATAGTATCGTGTTTCTCTGTATAAAGAAT
CTTTACATACCACTTAGTTAATATAAAAC	TTGTAAAGCTCCTAAATCTGCTCCTGCTAGAATATATTG
CTTTACATACCACTTAGTTAATATAAAAC

>CP026613|15|6|3312232-3314353|CRT
ATTTAGATATGATTTAGTTAATATAAAAC	TTATCCATTCGCTTTAAAAAATCCCTTGCGAAACGT
CTTTACATACCACTTAGTTAATATAAAAC	ACTAACTCCAGTCCACTGTAATTACTATTCCTTAAT
CTTTACATACCACTTAGTTAATATAAAAC	CATTGCATATAAGATAAGCTGCATTGATTTTTTAGGT
CTTTACATACCACTTAGTTAATATAAAAC	TTGCATTGTAAACTAAAATGCTTTATTCTATATTTA
CTTTACATACCACTTAGTTAATATAAAAC	TCTATTAATAAAATTATCTAATAAAGATGCAAACCC
CTTTACATACCACTTAGTTAATATAAAAC	ACACATATTGCCTTCCCTTAAATCTCCAAAATCTATG
CTTTACATACCACTTAGTTAATATAAAAC	TTGCTTATACTTCTTGCAACCTGCTCCTATAACATAA
CTTTACATACCACTTAGTTAATATAAAAT	CTTGCTCTGCTTCGCTTTTACTCATTGTGTCAACTG
CTTTACATACCACTTAGTTAATATAAAAC	ACTACAATAATAGTGCCTTTTAGCAAAATTTACTAG
CTTTACATACCACTTAGTTAATATAAAAC	ACTTTTCACATAACCATGATACATTGCTCTACTTAA
CTTTACATACCACTTAGTTAATATAAAAC	AATCGGAGCTAATTTAGAAATTAAAGAGCTTACAAT
CTTTACATACCACTTAGTTAATATAAAAC	TAAATTATCTGCGTATCTTCCAGTCGCAAAAGCTA
CTTTACATACCACTTAGTTAATATAAAAC	CCGTATATATACCCATCGAAAACAAAACATTATTTCG
CTTTACATACCACTTAGTTAATATAAAAC	TGTCAGTAGAAGCTATTTTTGAAGGTATTTTATGC
CTTTACATACCACTTAGTTAATATAAAAC	TTTCTCTATCATATTGTATATTATCTCTATCACATG
CTTTACATACCACTTAGTTAATATAAAAC	TTATCAATCTTAAGCCAAGTACCAGGTTGTCTACCAA
CTTTACATACCACTTAGTTAATATAAAAC	GAGAACATGCCCAACCAGATTTTAAGGGTGCTTTAAA
CTTTACATACCACTTAGTTAATATAAAAC	TATAAGACTTTTCTTCTGATTTAGTTTTAAACTGTCTCT
CTTTACATACCACTTAGTTAATATAAAAC	CTATATTGAAATTTATTATGCCTTCATTTTACCATT
CTTTACATACCACTTAGTTAATATAAAAC	CTGCTTTACCTGCCTTTCCCTGGTCTCTTGATACTC
CTTTACATACCACTTAGTTAATATAAAAC	TTGGAGAAATGGCAAGACTTACGGAGTTTGGAGTTA
CTTTACATACCACTTAGTTAATATAAAAC	TTGCCACATCCCTCTTATATTCTTCTTTTTCATCAAA
CTTTACATACCACTTAGTTAATATAAAAC	TTTTCTCTTAAAAATCCGTTATTTTCTTAGTAAACCA
CTTTACATACCACTTAGTTAATATAAAAC	AGAAAATACAATTACAGGAGTTGTGAGGATATTTTAGA
CTTTACATACCACTTAGTTAATATAAAAC	TAGAAGATAGAAGAAGCAATATAAAAGCAAAAATGCG
CTTTACATACCACTTAGTTAATATAAAAC	GGAATTACTTGGGACTAAAAAAGTAGAAACAGTTTT
CTTTACATACCACTTAGTTAATATAAAAC	ATGCTACAGCAGAAAAAGTTGTAAGTATAAGCAA
CTTTACATACCACTTAGTTAATATAAAAC	CTGTTAATCCAAAGAAAGTATCTCCCATTTTACCATC
CTTTACATACCACTTAGTTAATATAAAAC	ACTTGATGGTATTAAACTCTCTAATATTATGCAATT
CTTTACATACCACTTAGTTAATATAAAAC	TATATCAAAGCTGGAAAATCAAGAGTACAAAGATAT
CTTTACATACCACTTAGTTAATATAAAAC	CTGTAAATAGTATCGTGTTTCTCTGTATAAAGAAT
CTTTACATACCACTTAGTTAATATAAAAC	TTGTAAAGCTCCTAAATCTGCTCCTGCTAGAATATATTG
CTTTACATACCACTTAGTTAATATAAAAC

>CP026613|15|7|3312233-3314352|PILER-CR
TTTAGATATGATTTAGTTAATATAAAAC	TTATCCATTCGCTTTAAAAAATCCCTTGCGAAACGTC
TTTACATACCACTTAGTTAATATAAAAC	ACTAACTCCAGTCCACTGTAATTACTATTCCTTAATC
TTTACATACCACTTAGTTAATATAAAAC	CATTGCATATAAGATAAGCTGCATTGATTTTTTAGGTC
TTTACATACCACTTAGTTAATATAAAAC	TTGCATTGTAAACTAAAATGCTTTATTCTATATTTAC
TTTACATACCACTTAGTTAATATAAAAC	TCTATTAATAAAATTATCTAATAAAGATGCAAACCCC
TTTACATACCACTTAGTTAATATAAAAC	ACACATATTGCCTTCCCTTAAATCTCCAAAATCTATGC
TTTACATACCACTTAGTTAATATAAAAC	TTGCTTATACTTCTTGCAACCTGCTCCTATAACATAAC
TTTACATACCACTTAGTTAATATAAAAT	CTTGCTCTGCTTCGCTTTTACTCATTGTGTCAACTGC
TTTACATACCACTTAGTTAATATAAAAC	ACTACAATAATAGTGCCTTTTAGCAAAATTTACTAGC
TTTACATACCACTTAGTTAATATAAAAC	ACTTTTCACATAACCATGATACATTGCTCTACTTAAC
TTTACATACCACTTAGTTAATATAAAAC	AATCGGAGCTAATTTAGAAATTAAAGAGCTTACAATC
TTTACATACCACTTAGTTAATATAAAAC	TAAATTATCTGCGTATCTTCCAGTCGCAAAAGCTAC
TTTACATACCACTTAGTTAATATAAAAC	CCGTATATATACCCATCGAAAACAAAACATTATTTCGC
TTTACATACCACTTAGTTAATATAAAAC	TGTCAGTAGAAGCTATTTTTGAAGGTATTTTATGCC
TTTACATACCACTTAGTTAATATAAAAC	TTTCTCTATCATATTGTATATTATCTCTATCACATGC
TTTACATACCACTTAGTTAATATAAAAC	TTATCAATCTTAAGCCAAGTACCAGGTTGTCTACCAAC
TTTACATACCACTTAGTTAATATAAAAC	GAGAACATGCCCAACCAGATTTTAAGGGTGCTTTAAAC
TTTACATACCACTTAGTTAATATAAAAC	TATAAGACTTTTCTTCTGATTTAGTTTTAAACTGTCTCTC
TTTACATACCACTTAGTTAATATAAAAC	CTATATTGAAATTTATTATGCCTTCATTTTACCATTC
TTTACATACCACTTAGTTAATATAAAAC	CTGCTTTACCTGCCTTTCCCTGGTCTCTTGATACTCC
TTTACATACCACTTAGTTAATATAAAAC	TTGGAGAAATGGCAAGACTTACGGAGTTTGGAGTTAC
TTTACATACCACTTAGTTAATATAAAAC	TTGCCACATCCCTCTTATATTCTTCTTTTTCATCAAAC
TTTACATACCACTTAGTTAATATAAAAC	TTTTCTCTTAAAAATCCGTTATTTTCTTAGTAAACCAC
TTTACATACCACTTAGTTAATATAAAAC	AGAAAATACAATTACAGGAGTTGTGAGGATATTTTAGAC
TTTACATACCACTTAGTTAATATAAAAC	TAGAAGATAGAAGAAGCAATATAAAAGCAAAAATGCGC
TTTACATACCACTTAGTTAATATAAAAC	GGAATTACTTGGGACTAAAAAAGTAGAAACAGTTTTC
TTTACATACCACTTAGTTAATATAAAAC	ATGCTACAGCAGAAAAAGTTGTAAGTATAAGCAAC
TTTACATACCACTTAGTTAATATAAAAC	CTGTTAATCCAAAGAAAGTATCTCCCATTTTACCATCC
TTTACATACCACTTAGTTAATATAAAAC	ACTTGATGGTATTAAACTCTCTAATATTATGCAATTC
TTTACATACCACTTAGTTAATATAAAAC	TATATCAAAGCTGGAAAATCAAGAGTACAAAGATATC
TTTACATACCACTTAGTTAATATAAAAC	CTGTAAATAGTATCGTGTTTCTCTGTATAAAGAATC
TTTACATACCACTTAGTTAATATAAAAC	TTGTAAAGCTCCTAAATCTGCTCCTGCTAGAATATATTGC
TTTACATACCACTTAGTTAATATAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP026613.2\|AVD42795.1\|3299484_3301704_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
CP026613.2\|AVD42813.1\|3324172_3326089_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
CP026613.2\|AVD42807.1\|3316354_3318676_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|273707
CP026613.2\|AVD42810.1\|3320305_3322156_-\|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1	cas8b2	cd09665_cas8b2_CAS-I-B	gnl\|CDD\|313005
CP026613.2\|AVD42802.1\|3309640_3310186_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|376871
CP026613.2\|AVD44816.1\|3315788_3316307_-\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|366863
CP026613.2\|AVD42805.1\|3314536_3314803_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP026613.2\|AVD42801.1\|3308483_3309620_-\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|238383
CP026613.2\|AVD42797.1\|3305137_3305338_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42803.1\|3310509_3311280_+\|hypothetical-protein	unknown	unknown	unknown
CP026613.2\|AVD42809.1\|3319389_3320304_-\|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR	cas7	cd09687_cas7_CAS-I-B	gnl\|CDD\|187818
CP026613.2\|AVD42799.1\|3306137_3307013_-\|dipicolinate-synthase-subunit-DpsA	unknown	unknown	gnl\|CDD\|181371
CP026613.2\|AVD42798.1\|3305544_3306135_-\|dipicolinate-synthase-subunit-B	unknown	unknown	gnl\|CDD\|181370
CP026613.2\|AVD42796.1\|3301979_3304634_-\|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|237515
CP026613.2\|AVD42804.1\|3311742_3312171_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|236715
CP026613.2\|AVD42811.1\|3322161_3322899_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	pfam01881_cas6_CAS-I:CAS-III	gnl\|CDD\|187783
CP026613.2\|AVD42808.1\|3318686_3319388_-\|type-I-B-CRISPR-associated-protein-Cas5	cas5	cd09658_cas5_CAS-I-B	gnl\|CDD\|187789
CP026613.2\|AVD42800.1\|3307088_3308480_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341288
CP026613.2\|AVD42806.1\|3314805_3315786_-\|type-I-B-CRISPR-associated-endonuclease-Cas1	cas1	cd09722_cas1_CAS-I-B	gnl\|CDD\|274695
CP026613.2\|AVD42812.1\|3322976_3323894_-\|transcriptional-regulator	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100

Protein	Function_ID	Function_description	E-value
CP026613.2\|AVD42795.1\|3299484_3301704_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.30455e-107
CP026613.2\|AVD42813.1\|3324172_3326089_-\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	2.4854e-09
CP026613.2\|AVD42807.1\|3316354_3318676_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|273707	TIGR01587, CRISPR-associated_endonuclease/helicase_Cas3, CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.	1.45683e-57
CP026613.2\|AVD42810.1\|3320305_3322156_-\|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1	gnl\|CDD\|313005	pfam09706, Cas_CXXC_CXXC, CRISPR-associated protein (Cas_CXXC_CXXC). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry describes a conserved region of about 65 amino acids from an otherwise highly divergent protein found in a minority of CRISPR-associated protein regions. This region features two motifs of CXXC.	1.22053e-18
CP026613.2\|AVD42802.1\|3309640_3310186_-\|biotin-transporter-BioY	gnl\|CDD\|376871	pfam02632, BioY, BioY family. A number of bacterial genes are involved in bioconversion of pimelate into dethiobiotin. BioY is a component of the BioMNY transport system involved in biotin uptake in prokaryotes.	2.69375e-36
CP026613.2\|AVD44816.1\|3315788_3316307_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|366863	pfam01930, Cas_Cas4, Domain of unknown function DUF83. This domain has no known function. The domain contains three conserved cysteines at its C-terminus.	2.06825e-60
CP026613.2\|AVD42805.1\|3314536_3314803_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.9342e-28
CP026613.2\|AVD42801.1\|3308483_3309620_-\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	6.94409e-113
CP026613.2\|AVD42809.1\|3319389_3320304_-\|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR	gnl\|CDD\|187818	cd09687, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Cst2/DevR family.	3.27427e-54
CP026613.2\|AVD42799.1\|3306137_3307013_-\|dipicolinate-synthase-subunit-DpsA	gnl\|CDD\|181371	PRK08306, PRK08306, dipicolinate synthase subunit DpsA.	4.46497e-131
CP026613.2\|AVD42798.1\|3305544_3306135_-\|dipicolinate-synthase-subunit-B	gnl\|CDD\|181370	PRK08305, spoVFB, dipicolinate synthase subunit B; Reviewed.	1.97666e-125
CP026613.2\|AVD42796.1\|3301979_3304634_-\|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase	gnl\|CDD\|237515	PRK13805, PRK13805, bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional.	0
CP026613.2\|AVD42804.1\|3311742_3312171_-\|N-acetyltransferase	gnl\|CDD\|236715	PRK10562, PRK10562, putative acetyltransferase; Provisional.	7.042e-46
CP026613.2\|AVD42811.1\|3322161_3322899_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|187783	cd09652, Cas6-I-III, CRISPR/Cas system-associated RAMP superfamily protein Cas6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6 is an endoribonuclease that generates crRNAs, predicted subunit of Cascade complex; RAMP superfamily protein; Possesses double RRM/ferredoxin fold.	9.11445e-20
CP026613.2\|AVD42808.1\|3318686_3319388_-\|type-I-B-CRISPR-associated-protein-Cas5	gnl\|CDD\|187789	cd09658, Cas5_I-B, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.81963e-63
CP026613.2\|AVD42800.1\|3307088_3308480_-\|AMP-binding-protein	gnl\|CDD\|341288	cd17633, AFD_YhfT-like, fatty acid-CoA ligase VraA. This family of acyl-CoA ligases includes Bacillus subtilis YhfT, as well as long-chain fatty acid-CoA ligase VraA, all of which are as yet to be characterized. These proteins belong to the adenylate-forming enzymes which catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain	5.1537e-141
CP026613.2\|AVD42806.1\|3314805_3315786_-\|type-I-B-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274695	TIGR03641, cas1_HMARI, CRISPR-associated endonuclease Cas1, subtype I-B/HMARI/TNEAP. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes Cas1 subgroup that includes Cas1 proteins of the related HMARI and TNEAP subtypes of CRISPR/Cas system.	2.35554e-174
CP026613.2\|AVD42812.1\|3322976_3323894_-\|transcriptional-regulator	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	6.43666e-41

>CP026613.2|AVD42804.1|3311742_3312171_-|N-acetyltransferase
MIRKLNNKDINKIMEIWEESTIKAHGFISKEYWQNNHNAVKNEYIPISDTFVYDIGDEIKGFISIIDKSFIGALFIKPKYQNLGIGGKLLDYATEKYKSLSLAVYKDNKKAVIFYNKKGFNVVKGQLNEDSGFKEYIMEYSK
>CP026613.2|AVD42803.1|3310509_3311280_+|hypothetical-protein
MKVNENNIDEELDELSRKVYLESPDFWISISDKIIDKVFDEMLLFFAVKYNYFNIVCFAIENNYLDLNMPSKNKKYTNIMEHLLDTSKQNEDKKIYNYLLNLNKDNNLDERPILDELNYNTSSDTFEKKDIYLPKYLCPSCNSNIFDTGYKVSNDITYKFSSKEAEPIEISNEVSSIRCCNCDELLEDVTLDKLSNLCKIQNCNNCGSNLTKVGIIAKKKMNFDENTEKFKDVSTSYCCGNCDSEINLSQREHFKI
>CP026613.2|AVD42802.1|3309640_3310186_-|biotin-transporter-BioY
MKNTKVNIQDLTKMSICVALLCISSYIYIPLPFTPAGVTAQTIMINLIALILTPRQAFSTVGVYIMIGLIGIPVFGGGTSGIGKLLSPTGGFYFGFLFAALIISLLKGRNNDIKRYILITIFVGMPIIYFMGTVFMCYFNQMTVEAALFAAVVPFLIGDTIKSVIASFLGTKLNNVLRKNL
>CP026613.2|AVD42801.1|3308483_3309620_-|acetyl-CoA-C-acyltransferase
MEEVFILGGLRSHIGLKNGIFQFVQPELLGASVLKHLIKKYEIDKIDEIICGNAVGTGGNIARLMTLTAGVSNEVPAFTVDMQCASAMMSIDIAFSKIKSGQCDLIIAGGFESSSLQPMRTYHKNDKRYNINNPNYTVAQFSPDDNSQNSMLEGAERVAELYQIKKAELDFWVKESHKRAKEAREEKIFDDIIFPINNSTCDEGIRDKMSQRLLDRMPSILGKESITNAANSCLINDGASFIILCSKKYLEHAKNKPIAKIVNTCTIGTDANLSPTSAIKAMDKLLEIESLSYLDVSAVEFNEAFAVIDVLFQRKYPELIDRYNIFGGALAYGHPYGASGAIIALHLLKALEKTKGRYGICSIAAAGGLGSALMIERV
>CP026613.2|AVD42800.1|3307088_3308480_-|AMP-binding-protein
MNYYELLRIKSDRHKNKNFLIIDGEKYTYENILSYSEEIGKQIYLGENIPILIYSKNIMFQLISFFAINYSKNIPIICHYNLSKKVLDDILLKNNISIIISDESMDVIDLYDDNNNEVAKKVNLSIFNPKFNIYMYQYKKLINYLDKSICMGALSSGSTSVPKVLYRTYESWAGFFPIQNAIFNISGESILFINGTLSFTGNLNSIMSVLYEGGSIVISSGLNCKSWIRTIKQYNVTNIYLIPIKLQLLVKHLKESVLKVVSIFTGSQLLFEDTARNLKKYMPKSEIILYYGASELNYITYLCYDELIERPLSVGRPFPGIDVYIREEKIFVNTEYAVYNATKPYSVNDIGYFDNDGYLIFEGRSDDIVNIGGFKVSSTKIENEVKKIPQIEDAVVLPYSDTIRGNQIVLFVITIDKITKKDLLIKMKDNLMKNEIPKKIIFLNSFPYTSSEKIDRLALLKML
>CP026613.2|AVD42799.1|3306137_3307013_-|dipicolinate-synthase-subunit-DpsA
MSNQYDITVIGGDLRQVYMVKKLINKGYSVVTYGISNEIINGIVGKSTSLAEALSKSSIILCPIPFTKNQVNIENTDNCLDATIDNLLINLSPNQILFGGNIPTKVCKFCEQHSIQIYDFMKMNDVAILNAVATAEGAISEAIKRSIINIHQSNCLVLGYGRCAQILAKKLYALDANVCVGARNNDARSTASAFGYSSISLNQLDEKLLQFDYIFNTIPDCILTKERLEKVSQEVTIIDIASSPGGVDYSATKEVGINATLCLGLPGKYSPKTSGEILVNAIENIINERRD
>CP026613.2|AVD42798.1|3305544_3306135_-|dipicolinate-synthase-subunit-B
MRLEGLTIGVGFTGSFCTYDKIFIELENLVKEGANVHTIFSDVSQNIDCRFGNSEEFMKKAYELTGNKPIVTIEDAEPFGPKGIADIIIIAPCTGNTAAKLANGITDSPVLMAAKGHLRNDKPLVISISTNDALSFNFKNIGILLNSKNIYFVPFGQDNCKAKPNSMIAHTELIIPTIELALENKQLQPVIKSPHQ
>CP026613.2|AVD42797.1|3305137_3305338_+|hypothetical-protein
MKKLKIISIFSLIISVILTIGGIGIVTYYVNNLFIRGLSVFVLIMSSSFVSTTVRLIFEESKRYKF
>CP026613.2|AVD42796.1|3301979_3304634_-|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase
MAHKEQVIIENKKENEVMSVGLDTVNNVESLVKKLAKIKEAQKIFATYTQEQVDKIFLAASLAANKQRVPLAIMAQKETGMGIAEDKVIKNHYASEYIYNAYKETKTCGVIEKDEAFGMTKIAEPIGVIAAVVPTTNPTSTAIFKALLALKTRNGIIFSPHPRAKNSTIEAAKVVLEAAVLAGAPEGIIGWIDEPSLELTTTVMKEVDLTLATGGPGMVKSAYSSGKPAIGVGAGNTPAIIDESADIKTAVNSILVSKTFDNGMICASEQSVIVLENIYNEVKKEFKERGAYLLDKDETEKIRNIILVNGGLNSKIVGQTACTIAKLAGFEVPVDTKVLIGEVESVEIEEAFAHEKLSPVLAMYKASDFDDAVRKAEKLVEDGGFGHTSSLYIDDVNQREKLDKFTSAMKTCRILINTPSSQGGIGDLYNFKLAPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRAPEKVYFKKGCLGVALKELKDVMDKKRAFIVTDTFLYNNGYTKAVTDLLDEMNIKHTTFFEVEPDPTLECAKIGAKAMREFNPDVIISIGGGSAMDAGKIMWTLYEHPDVDFQDLAMRFMDIRKRVYTFPKMGEKANFVAIPTSAGTGSEVTPFAVITDQDTGVKYPLADYELMPNMAIVDSDMMMNMPKSLTSASGIDALTHALEAYVSMLATDYTNGLALQAIKSIFEYLPRAYDNGAKDPEAREKMANASTMAGMAFANAFLGVCHSMAHKLGAFHHVPHGVANALLITEVMKFNSSDAPKKMGAFSQYKYPEALKRYAEVASFLGLKGNSEEEKFQSLLSAIEDLKFKVGIPKTIKEFGVEESKFMDSIDEMVIQAFDDQCTGANPRYPLMNEIKDMYLNSYYGR
>CP026613.2|AVD42795.1|3299484_3301704_-|EAL-domain-containing-protein
MTRRSKSFTLIIILFLTSLFLTMGYIYIEDTKNLLMSEAKIHIKEVAIQGSQLAQRQIEKDLDVLNIFSNYYASNPDIPNEEKMKNLLDELENQKFYTMAIVDINGNAENTKGDKFSVKDREFFKNSIKGKKYVSSPYADEVNKSIKKITISVPLLNNDKVVGVLYCTYNINTLMKLINVSFYENNSISYVVKNDGTVILHPQEDSISKNIYKLLKQDNDIREVNSLKKELQENKTGATVLKMLEERRYLGYATMDNGNSENNYIKDWNLIFSIPETVVFSNSEKIINRAIYAVLFIILIFIAIIFYIIYIKKSNEKEILSLAYEDKVTHIGNQNKFYRECSKYLLDKPSLNYIIVYFDINNFKMINDTFGYEFGDNLLITIAKALKEELTEGEVFARLSSDYFAIFCDYKNGRNKIIRKLDSIRNNIESNLSIVFEISLCVGIYFVEEDEVDIQKAVNKANMARSVAKGKNINYAIYNEDVRNKLSEESMILDDIKIALVKNQFEVYYQPKFSLVNGEMIGSEALIRWNHPEHGFISPAVFIPIAEKSKLILKIGRFVFEKVCTDLSEWKKQGKKIVPVSVNLSRVELYQPDIVKFINKTIQMYNLSSDLIEIEITETVAINELNILKNVLNELRKYGFSISMDDFGTGYSSISCLRDMPIDILKLDKSFLDGIEHDERSRNIAKSIVSLAKSLDLVVIIEGVESKEQAELMKQFGCDLVQGFYFARPMPAKNFLDLL
>CP026613.2|AVD42805.1|3314536_3314803_-|CRISPR-associated-endonuclease-Cas2
MFVIVTYDIVEAKSLNRIRKILRKYLTWTQNSVFEGNITDGKLHKCISEIENIIDNREDSIYIYEIKNPNSIKKKCYGIDKYSDEMFI
>CP026613.2|AVD42806.1|3314805_3315786_-|type-I-B-CRISPR-associated-endonuclease-Cas1
MYKDYYIISNGNIKRKENTIYYYNLEGDKKILPVEQVDDIHIYGEVDLNTKLINYISQYGVMLHFYNYYGYYSGTYYPRKKNVSGFSLVCQSACYLDKNERLYLAKSFVESASYHILRNMRYYKVDESLIDAIKDELNDLNDVKEISELMGKEGRIRKTYYKSFNQILKDDFEFYKREKRPPKDPVNALMSFGNSIMYTNVLSEIYKTQLDPTISFLHEPSTKRFSLSLDIAEIFKPIIIDTIIFSLINNKRINKNDFEYQDKICYLSEKGKKKFLQEFENKMQTTIKHRNLNRKVSYRMFIRLECYKLIKHFINDERYKVLKVWW
>CP026613.2|AVD44816.1|3315788_3316307_-|CRISPR-associated-protein-Cas4
MPIDLDLLKVQGVKINYYYVCKRKLWLFSKGITMEQNSSRVLSGKIVHEDSYKRMKNKEMLIDDILKLDIIKDEYVKEVKISSKMKEADEMQLYYYLYYLKNSMGIEKKGTINYVKEKKQEELILTEEKERIIENTLININEINMKLSPPKIEKKPYCTKCAYYEFCFVKEE
>CP026613.2|AVD42807.1|3316354_3318676_-|CRISPR-associated-helicase/endonuclease-Cas3
MLYAKSNPVETLREHTDELLKQMNVLRESYGTNINSLNFLEEEIFWQLLDFVIEFHDIGKAFSPFQELIISRMDTKINEPKIVTHLENNVGHNYLSPAFIDYSYIDKKKNKELRAVLNQVIVYHHERDIFIDKDFKNLIQKILDEDLINKVYELQHEFKVRYPIKTEKLSKVYLQSVEKRIDKNHKYYNLYIMLKGILHRLDHSASAHEVVECNNVMNIGEHTENYLMKEFGSLRETQSFAQSNRNKNIILIASTGMGKTETALIWIDKDKAFFTLPLRVSINALFDRAKNIVGVGESNDTFLGLLHSTAIDYLEESNQENSSEIVDLAKLLSCKLTFSTIDQIFKFPFLYRGYEKVYSTLAYSKVVIDEIQAYSPEIAAVLVKGIEMIHKIGGKFMIMTATMPTIYIDELKKRGVVDSNLANLTCNTEKIRHCVSIVENSIDENLEQIIQSGINKKVLVIVNTVKSAIEKYELIEEIIKSKGIDINVNLLHSMYIQEDRAKLEKYIKEFADSDSNGIWITTQLVEASLDIDFDELHTENSTLDSLFQRFGRCYRSREYEENSPNIFIYTEKATGIGSIYDKDIVEKGLELLKNCMNGKKCFKMKEKHKVQMVKILYSKESLKDTDFEKKFTRALDILDTITPYSLGSNEAQNILRNIEGYTVIPEDIYRKIEKTLIRDYEELGQELTEAYSNDDRQLINEIKSKRKKARREIIKKTVNLPIYKAKQNIVDIQVKGLEDLKILLYKYDIHEDVHTKHIFGKGVIIGKEIDQFI
>CP026613.2|AVD42808.1|3318686_3319388_-|type-I-B-CRISPR-associated-protein-Cas5
MKVLKLDLFQETACYKKPFAMKITETYPLPPYSTINGLIHKILNATEYIPFNISVQGTYESIFNNYQTTYFYKKDSITSMPMNSHMLLNVNLIIHIGGDFDLLKEIYDSLLNYNEHLSLGRKEDLVRITDIRFVEVNKFEIDEDIQLDDYENYKLSECDIRMPIYIPKTSLQDKDIDGISYRLNNYYDNNAVGDKKRVWNKVDSYYVEDGNTISVGDILLDNEGDLLYFNNIN
>CP026613.2|AVD42809.1|3319389_3320304_-|type-I-B-CRISPR-associated-protein-Cas7/Cst2/DevR
MKRGLTFTVIAQAQSLNYGEGIGNISELKKLSRADGNIYTFASRQCLRYDIVRLAAELFNWNLQVVDKEKGTIQFKDNISIRESEEMDLFGYMKTNKKDEKDKKGGSLTREAAVRLSNAISLEPYRSDMDFLNNKGLADRIGEHPNLANIEQHLSYYTYTVTIDLSKIGKDGEIELDNKEKCRRVVEFLEIIKVLNRNIRGRQENLSPLFVVGGVYEIANPFFLGRIKLKGDKNGFKINKQAIEEVVQGTFLGKYLKEFTYVGMVDGVFINKEEFKGLFEDNFLSVDKFFGQLVKEVKEYYGVN
>CP026613.2|AVD42810.1|3320305_3322156_-|type-I-B-CRISPR-associated-protein-Cas8b1/Cst1
MKLRVYRGDWFFNMGIVGFLNIIKKSNKQAEIFIMEDYIEFDSSFLENFHEYYFNYFMDEYDVSKRIKKSIDYSINFIKSKPDKVKDGIKKIKDTVKQQNDKVKKFDEEKFNLIKEKLDSISKIKSYDEFDSLEILVDETIDIFKIKSINDRLTANLYKYVVQDNYFGQVSFFNVAKAKLDLDGLKQVMFNDYLRQIIYFGELEDLLEENDYDKLKNYLNDRLNSIAKDISEKKVSKSSVNTIEKIMKEINKNFIKKNKSIENIKEYMDSLEICEMCGLYKGILDEYSESNFAPLGVSTNNARNMFWKQEYVSSICDVCKLILFCTPAGATYTRKDYLTNEENEFYLFVNMDTSINELFDRNNSLKAQKSESSNSKDENPFNQLIKSIVEENKLKSEWQLRNILFVEFKASIDSKKCKINYFNIPTYLAKFFVKENKKIQSIYDYKLKSNVLDLILKSKDLKHLINNTLRNIVKSNLESNNKSNISGLSCFNVVQLRTILNNYKRGVYKMDYKKLRKIYESGCEIHDYYIDKNAKNKIEGITYKILNLIKVGNKNDFMQTILRIFSPSEKTPPEEILQIFVEEDLDFESVGYAFVTGLISGKYEGKDKLSNEKEEK
>CP026613.2|AVD42811.1|3322161_3322899_-|CRISPR-associated-endoribonuclease-Cas6
MKMKIEFSTSCIPISYNSLFMSIIKEAIKKSNEDYYKNMYYYKEKNNKKTKNFTFSVYVKKYSIEGDNFIIEDKVILNISTPDLELGFHIYNGLMTSKKCLYKDYELTRIRIDLSREKKVTEERVLFNALSPICVKSKEGKFLEITDDRYIEELNYITNEVVKNYRGSGLKRKLEFENIDLKKVVVKESLREFKKITGKEYQYINGYKGKFILKGDIDDLNIIYNLGLGFRRAQGFGDVDILEWR
>CP026613.2|AVD42812.1|3322976_3323894_-|transcriptional-regulator
MMILIQSRGKMKCKELAEELEVSERQIKSYKMYLEQAGIFINSTPGIYGGYEIDKCNSISLIKLLDSEVSILDMINSQLEYNNDIYKTEFNSIVEKIKAVLNTRVKSDTYMDYFTIQPQRNCDYKFEKNKCNEIIRAYTTKRKLWIEYYSLNSGNSERIVHPYGLFNYKSDTYMVAFCEKRFKFIDFKLCRIKNYKVLEEKYNVDKSFSWDEYSKNSIGIYKGEEINVVIKISHPFSTIIKEKVWVNNQQIIEYDDKSIMFKAKMRGYEEIKSWILSMGAYVEVVDPDSLRNDILSEIEKMKKIY
>CP026613.2|AVD42813.1|3324172_3326089_-|ABC-transporter-permease
MNIKQFAINNISRNIKAYLGYLASITISSSLLFSFVMFTSHPDLDLSQFPDYLKEGLKMSKIIAYLFLFFFVFYSVSVFLKSRYKEFGILYITGISNRQVMKLIFIENMIINIVSSVIGIIIGLIFAKIFLVVMSTFLELSPLKFYIPFNAILSTLIYFMILAVLTSLFTSFIVKENQVLKLLKGTKTPKPEPKTSLMLAILSICLFIIAYYNAVTSTDQYTTYLRLVPVTSLTIAATYLFFSQFSVFFIKKLKLNKRFYRKNTNMLWISNLIYKVKDNARIFFLITITSAVAFTAIGTVYSFWKDVKRQINLIYPNTIYYSTMTLHNDPKKPDSKEKDKERMRFIENNLKKEDIDYTRINGEFKTVFPKKSDFNVRIMKESKYLEITEVIGVKPISFEDNESISLLSSSLPGNKKIKENVTVGNRSLKVAKQVEECVMPAYYKNMYVVKDNFYDSIESKFIVDRFTAFEVEDSSKTIEICREFENKFDNESGMQPYLFFSKELMIETGKLMYSTFIFLAIFIGLIFFVTTSSFLYNKFYMDCQVDKKKYEQLNKLGMTYNEIKKASTIEIGIVFLLPYVVAVIHSIFALTALKNSFDLEVASSAVLVMGSLFLVQIVYFLIVRNNYLKEIKLNLVNY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP026613_6	6.4\|1245039\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245039-1245076	38	CP026613.2	42426-42463	0	1.0
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	12512-12549	1	0.974
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	1048653-1048690	1	0.974
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	3066194-3066231	1	0.974
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	3819312-3819349	1	0.974
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	3949793-3949830	1	0.974
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	18052-18089	2	0.947
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	134755-134792	2	0.947
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	141639-141676	2	0.947
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	152200-152237	2	0.947
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	CP026613.2	157614-157651	2	0.947

1. spacer 6.4|1245039|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to position: 42426-42463, mismatch: 0, identity: 1.0

tatgtcaggacttcttaaaccatattcagcatacactc	CRISPR spacer
tatgtcaggacttcttaaaccatattcagcatacactc	Protospacer
**************************************

2. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 12512-12549, mismatch: 1, identity: 0.974

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacgcatgtgaagtttgttt	Protospacer
************************* ************

3. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 1048653-1048690, mismatch: 1, identity: 0.974

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacgcatgtgaagtttgttt	Protospacer
************************* ************

4. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 3066194-3066231, mismatch: 1, identity: 0.974

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacgcatgtgaagtttgttt	Protospacer
************************* ************

5. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 3819312-3819349, mismatch: 1, identity: 0.974

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacgcatgtgaagtttgttt	Protospacer
************************* ************

6. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 3949793-3949830, mismatch: 1, identity: 0.974

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacgcatgtgaagtttgttt	Protospacer
************************* ************

7. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 18052-18089, mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

8. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 134755-134792, mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

9. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 141639-141676, mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

10. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 152200-152237, mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

11. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to position: 157614-157651, mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026613_2	2.1\|150198\|29\|CP026613\|CRISPRCasFinder	150198-150226	29	NZ_CP033215	Clostridioides difficile strain 12038 plasmid unnamed1, complete sequence	5105-5133	0	1.0
CP026613_6	6.2\|1244905\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244905-1244942	38	NZ_MG266000	Clostridioides difficile strain 7032985 plasmid pCD-ISS1, complete sequence	7213-7250	0	1.0
CP026613_6	6.3\|1244972\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244972-1245009	38	NC_008226	Clostridioides difficile 630 plasmid pCD630, complete sequence	6216-6253	0	1.0
CP026613_6	6.3\|1244972\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244972-1245009	38	NZ_CP016319	Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence	1237-1274	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	34810-34846	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	NC_007917	Clostridium phage phi CD119, complete genome	34810-34846	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	LN681542	Clostridium phage phiMMP03, complete genome	35246-35282	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	NC_009231	Clostridium phage phiC2, complete genome	38783-38819	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	JX145341	Clostridium phage phiMMP02, complete genome	35766-35802	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	LN681541	Clostridium phage phiMMP01, complete genome	32536-32572	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	NC_011398	Clostridium phage phiCD27, complete genome	37556-37592	0	1.0
CP026613_8	8.3\|1746044\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746044-1746080	37	NC_048642	Clostridium phage CDKM9, complete genome	36730-36766	0	1.0
CP026613_8	8.7\|1746307\|36\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746307-1746342	36	GU949551	Clostridium phage phiCD6356, complete genome	2657-2692	0	1.0
CP026613_9	9.1\|2198325\|37\|CP026613\|CRISPRCasFinder,CRT	2198325-2198361	37	NZ_MF547664	Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence	66323-66359	0	1.0
CP026613_9	9.5\|2198589\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198589-2198625	37	NC_048642	Clostridium phage CDKM9, complete genome	41013-41049	0	1.0
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	NC_028838	Clostridium phage phiCD506, complete genome	6082-6117	0	1.0
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	30916-30953	0	1.0
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	24960-24997	0	1.0
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	MK473382	Clostridium phage JD032, complete genome	19287-19324	0	1.0
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	JX145342	Clostridium phage phiMMP04, complete genome	15368-15405	0	1.0
CP026613_9	9.18\|2199447\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199447-2199483	37	NC_028838	Clostridium phage phiCD506, complete genome	6223-6259	0	1.0
CP026613_9	9.18\|2199447\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199447-2199483	37	LN681538	Clostridium phage phiCD481-1, complete genome	6249-6285	0	1.0
CP026613_9	9.20\|2199579\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199579-2199615	37	MK473382	Clostridium phage JD032, complete genome	12222-12258	0	1.0
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	NC_048665	Clostridium phage phiCDHM14, complete genome	8812-8847	0	1.0
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	HG796225	Clostridium phage phiCDHM13 complete genome	8780-8815	0	1.0
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	HG798901	Clostridium phage phiCDHM11 complete genome	8779-8814	0	1.0
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	MK473382	Clostridium phage JD032, complete genome	25865-25900	0	1.0
CP026613_9	9.25\|2199909\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199909-2199944	36	NC_008226	Clostridioides difficile 630 plasmid pCD630, complete sequence	6558-6593	0	1.0
CP026613_9	9.25\|2199909\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199909-2199944	36	NZ_CP016319	Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence	1579-1614	0	1.0
CP026613_9	9.28\|2200105\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200105-2200141	37	LN681542	Clostridium phage phiMMP03, complete genome	20289-20325	0	1.0
CP026613_9	9.28\|2200105\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200105-2200141	37	NC_009231	Clostridium phage phiC2, complete genome	20242-20278	0	1.0
CP026613_9	9.28\|2200105\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200105-2200141	37	LN681541	Clostridium phage phiMMP01, complete genome	20288-20324	0	1.0
CP026613_9	9.29\|2200171\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200171-2200207	37	NC_011398	Clostridium phage phiCD27, complete genome	48599-48635	0	1.0
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	20608-20644	0	1.0
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	19253-19289	0	1.0
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	15930-15966	0	1.0
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	HG531805	Clostridium phage CDMH1 complete genome	25917-25953	0	1.0
CP026613_9	9.35\|2200569\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200569-2200604	36	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	2395-2430	0	1.0
CP026613_9	9.35\|2200569\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200569-2200604	36	NC_007917	Clostridium phage phi CD119, complete genome	2395-2430	0	1.0
CP026613_9	9.35\|2200569\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200569-2200604	36	NC_028996	Clostridium phage phiCDHM19, complete genome	2642-2677	0	1.0
CP026613_9	9.39\|2200832\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200832-2200868	37	LN681539	Clostridium phage phiCD505, complete genome	46819-46855	0	1.0
CP026613_9	9.39\|2200832\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200832-2200868	37	LN681542	Clostridium phage phiMMP03, complete genome	48619-48655	0	1.0
CP026613_9	9.39\|2200832\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200832-2200868	37	NC_009231	Clostridium phage phiC2, complete genome	52157-52193	0	1.0
CP026613_9	9.39\|2200832\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200832-2200868	37	NC_011398	Clostridium phage phiCD27, complete genome	46118-46154	0	1.0
CP026613_9	9.39\|2200832\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200832-2200868	37	NC_048642	Clostridium phage CDKM9, complete genome	47263-47299	0	1.0
CP026613_9	9.43\|2201096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201096-2201130	35	HG531805	Clostridium phage CDMH1 complete genome	15144-15178	0	1.0
CP026613_10	10.7\|2248532\|36\|CP026613\|CRISPRCasFinder,CRT	2248532-2248567	36	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	1757-1792	0	1.0
CP026613_10	10.7\|2248532\|36\|CP026613\|CRISPRCasFinder,CRT	2248532-2248567	36	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	420-455	0	1.0
CP026613_10	10.7\|2248532\|36\|CP026613\|CRISPRCasFinder,CRT	2248532-2248567	36	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	42266-42301	0	1.0
CP026613_10	10.19\|2248533\|36\|CP026613\|PILER-CR	2248533-2248568	36	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	1757-1792	0	1.0
CP026613_10	10.19\|2248533\|36\|CP026613\|PILER-CR	2248533-2248568	36	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	420-455	0	1.0
CP026613_10	10.19\|2248533\|36\|CP026613\|PILER-CR	2248533-2248568	36	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	42266-42301	0	1.0
CP026613_11	11.3\|2359252\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359252-2359287	36	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	41065-41100	0	1.0
CP026613_11	11.3\|2359252\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359252-2359287	36	NC_007917	Clostridium phage phi CD119, complete genome	41065-41100	0	1.0
CP026613_11	11.3\|2359252\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359252-2359287	36	HG531805	Clostridium phage CDMH1 complete genome	43917-43952	0	1.0
CP026613_11	11.9\|2359646\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359646-2359681	36	KU057941	Clostridium phage CDSH1, complete genome	21442-21477	0	1.0
CP026613_11	11.9\|2359646\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359646-2359681	36	NC_028905	Clostridium phage phiCD111, complete genome	21182-21217	0	1.0
CP026613_11	11.9\|2359646\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359646-2359681	36	HM568888	Clostridium phage phiCD38-2, complete genome	20938-20973	0	1.0
CP026613_11	11.9\|2359646\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359646-2359681	36	NC_028958	Clostridium phage phiCD146, complete genome	20500-20535	0	1.0
CP026613_11	11.9\|2359646\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359646-2359681	36	LN881738	Escherichia phage slur17, complete genome	40579-40614	0	1.0
CP026613_11	11.22\|2360505\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360505-2360540	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	74090-74125	0	1.0
CP026613_11	11.23\|2360571\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360571-2360606	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	102792-102827	0	1.0
CP026613_11	11.23\|2360571\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360571-2360606	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	74441-74476	0	1.0
CP026613_11	11.23\|2360571\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360571-2360606	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	19173-19208	0	1.0
CP026613_11	11.23\|2360571\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360571-2360606	36	LN681537	Clostridium phage phiCD211, complete genome	28035-28070	0	1.0
CP026613_11	11.24\|2360637\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360637-2360672	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	101810-101845	0	1.0
CP026613_11	11.24\|2360637\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360637-2360672	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	20155-20190	0	1.0
CP026613_11	11.24\|2360637\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360637-2360672	36	LN681537	Clostridium phage phiCD211, complete genome	29017-29052	0	1.0
CP026613_11	11.30\|2361030\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361030-2361065	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	99213-99248	0	1.0
CP026613_11	11.30\|2361030\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361030-2361065	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	77943-77978	0	1.0
CP026613_11	11.30\|2361030\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361030-2361065	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	22752-22787	0	1.0
CP026613_11	11.30\|2361030\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361030-2361065	36	LN681537	Clostridium phage phiCD211, complete genome	31614-31649	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	106698-106733	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	MF547662	Clostridioides phage LIBA6276, complete genome	60551-60586	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	MF547663	Clostridioides phage LIBA2945, complete genome	60401-60436	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	52848-52883	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	LN681537	Clostridium phage phiCD211, complete genome	61710-61745	0	1.0
CP026613_11	11.34\|2361293\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361293-2361328	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	69117-69152	0	1.0
CP026613_15	15.3\|3312391\|37\|CP026613\|CRISPRCasFinder,CRT	3312391-3312427	37	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	61044-61080	0	1.0
CP026613_15	15.3\|3312391\|37\|CP026613\|CRISPRCasFinder,CRT	3312391-3312427	37	MF547663	Clostridioides phage LIBA2945, complete genome	64508-64544	0	1.0
CP026613_15	15.3\|3312391\|37\|CP026613\|CRISPRCasFinder,CRT	3312391-3312427	37	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	60920-60956	0	1.0
CP026613_15	15.3\|3312391\|37\|CP026613\|CRISPRCasFinder,CRT	3312391-3312427	37	LN681537	Clostridium phage phiCD211, complete genome	69782-69818	0	1.0
CP026613_15	15.4\|3312457\|36\|CP026613\|CRISPRCasFinder,CRT	3312457-3312492	36	NC_028905	Clostridium phage phiCD111, complete genome	34736-34771	0	1.0
CP026613_15	15.16\|3313238\|37\|CP026613\|CRISPRCasFinder,CRT	3313238-3313274	37	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	96659-96695	0	1.0
CP026613_15	15.16\|3313238\|37\|CP026613\|CRISPRCasFinder,CRT	3313238-3313274	37	MF547662	Clostridioides phage LIBA6276, complete genome	50512-50548	0	1.0
CP026613_15	15.16\|3313238\|37\|CP026613\|CRISPRCasFinder,CRT	3313238-3313274	37	MF547663	Clostridioides phage LIBA2945, complete genome	50362-50398	0	1.0
CP026613_15	15.16\|3313238\|37\|CP026613\|CRISPRCasFinder,CRT	3313238-3313274	37	JX145342	Clostridium phage phiMMP04, complete genome	16987-17023	0	1.0
CP026613_15	15.19\|3313438\|36\|CP026613\|CRISPRCasFinder,CRT	3313438-3313473	36	NC_048665	Clostridium phage phiCDHM14, complete genome	27689-27724	0	1.0
CP026613_15	15.19\|3313438\|36\|CP026613\|CRISPRCasFinder,CRT	3313438-3313473	36	JX145342	Clostridium phage phiMMP04, complete genome	26659-26694	0	1.0
CP026613_15	15.19\|3313438\|36\|CP026613\|CRISPRCasFinder,CRT	3313438-3313473	36	HG796225	Clostridium phage phiCDHM13 complete genome	27723-27758	0	1.0
CP026613_15	15.19\|3313438\|36\|CP026613\|CRISPRCasFinder,CRT	3313438-3313473	36	LN681538	Clostridium phage phiCD481-1, complete genome	27458-27493	0	1.0
CP026613_15	15.19\|3313438\|36\|CP026613\|CRISPRCasFinder,CRT	3313438-3313473	36	HG798901	Clostridium phage phiCDHM11 complete genome	27720-27755	0	1.0
CP026613_15	15.20\|3313503\|36\|CP026613\|CRISPRCasFinder,CRT	3313503-3313538	36	NC_048665	Clostridium phage phiCDHM14, complete genome	12408-12443	0	1.0
CP026613_15	15.20\|3313503\|36\|CP026613\|CRISPRCasFinder,CRT	3313503-3313538	36	HG796225	Clostridium phage phiCDHM13 complete genome	12376-12411	0	1.0
CP026613_15	15.20\|3313503\|36\|CP026613\|CRISPRCasFinder,CRT	3313503-3313538	36	HG798901	Clostridium phage phiCDHM11 complete genome	12375-12410	0	1.0
CP026613_15	15.20\|3313503\|36\|CP026613\|CRISPRCasFinder,CRT	3313503-3313538	36	MK473382	Clostridium phage JD032, complete genome	22269-22304	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	NC_048665	Clostridium phage phiCDHM14, complete genome	9236-9271	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	MK473382	Clostridium phage JD032, complete genome	25441-25476	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	JX145342	Clostridium phage phiMMP04, complete genome	9222-9257	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	NC_028838	Clostridium phage phiCD506, complete genome	9662-9697	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	HG796225	Clostridium phage phiCDHM13 complete genome	9204-9239	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	LN681538	Clostridium phage phiCD481-1, complete genome	9689-9724	0	1.0
CP026613_15	15.21\|3313568\|36\|CP026613\|CRISPRCasFinder,CRT	3313568-3313603	36	HG798901	Clostridium phage phiCDHM11 complete genome	9203-9238	0	1.0
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	MK473382	Clostridium phage JD032, complete genome	493-529	0	1.0
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	LN681541	Clostridium phage phiMMP01, complete genome	36335-36370	0	1.0
CP026613_15	15.27\|3313963\|34\|CP026613\|CRISPRCasFinder,CRT	3313963-3313996	34	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	96290-96323	0	1.0
CP026613_15	15.27\|3313963\|34\|CP026613\|CRISPRCasFinder,CRT	3313963-3313996	34	MF547662	Clostridioides phage LIBA6276, complete genome	50143-50176	0	1.0
CP026613_15	15.27\|3313963\|34\|CP026613\|CRISPRCasFinder,CRT	3313963-3313996	34	MF547663	Clostridioides phage LIBA2945, complete genome	49993-50026	0	1.0
CP026613_16	16.21\|3638792\|20\|CP026613\|CRT	3638792-3638811	20	MN694697	Marine virus AFVG_250M792, complete genome	19464-19483	0	1.0
CP026613_6	6.3\|1244972\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244972-1245009	38	NZ_MG266000	Clostridioides difficile strain 7032985 plasmid pCD-ISS1, complete sequence	6382-6419	1	0.974
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	MK473382	Clostridium phage JD032, complete genome	35043-35079	1	0.973
CP026613_9	9.13\|2199117\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199117-2199153	37	NC_009231	Clostridium phage phiC2, complete genome	17675-17711	1	0.973
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	LN681538	Clostridium phage phiCD481-1, complete genome	6108-6143	1	0.972
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	16703-16740	1	0.974
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	15348-15385	1	0.974
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	12025-12062	1	0.974
CP026613_9	9.23\|2199777\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199777-2199813	37	LN681539	Clostridium phage phiCD505, complete genome	25906-25942	1	0.973
CP026613_9	9.23\|2199777\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199777-2199813	37	LN681542	Clostridium phage phiMMP03, complete genome	24885-24921	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NC_048665	Clostridium phage phiCDHM14, complete genome	18934-18970	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	LN681539	Clostridium phage phiCD505, complete genome	28459-28495	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	JX145342	Clostridium phage phiMMP04, complete genome	18939-18975	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	LN681542	Clostridium phage phiMMP03, complete genome	27438-27474	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NC_028838	Clostridium phage phiCD506, complete genome	19063-19099	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	HG796225	Clostridium phage phiCDHM13 complete genome	18434-18470	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	JX145341	Clostridium phage phiMMP02, complete genome	27690-27726	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	LN681541	Clostridium phage phiMMP01, complete genome	24681-24717	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NC_011398	Clostridium phage phiCD27, complete genome	27974-28010	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	HG798901	Clostridium phage phiCDHM11 complete genome	18433-18469	1	0.973
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	KX228400	Clostridium phage CDKM15, complete genome	29839-29875	1	0.973
CP026613_9	9.40\|2200898\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200898-2200935	38	LN681542	Clostridium phage phiMMP03, complete genome	15825-15862	1	0.974
CP026613_9	9.40\|2200898\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200898-2200935	38	NC_009231	Clostridium phage phiC2, complete genome	15856-15893	1	0.974
CP026613_9	9.40\|2200898\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200898-2200935	38	LN681541	Clostridium phage phiMMP01, complete genome	15825-15862	1	0.974
CP026613_9	9.41\|2200965\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200965-2201000	36	LN681539	Clostridium phage phiCD505, complete genome	36578-36613	1	0.972
CP026613_9	9.41\|2200965\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200965-2201000	36	LN681542	Clostridium phage phiMMP03, complete genome	36640-36675	1	0.972
CP026613_9	9.41\|2200965\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200965-2201000	36	NC_009231	Clostridium phage phiC2, complete genome	40177-40212	1	0.972
CP026613_9	9.41\|2200965\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200965-2201000	36	NC_048642	Clostridium phage CDKM9, complete genome	38124-38159	1	0.972
CP026613_9	9.43\|2201096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201096-2201130	35	LN681542	Clostridium phage phiMMP03, complete genome	14004-14038	1	0.971
CP026613_9	9.43\|2201096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201096-2201130	35	NC_009231	Clostridium phage phiC2, complete genome	14035-14069	1	0.971
CP026613_9	9.43\|2201096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201096-2201130	35	LN681541	Clostridium phage phiMMP01, complete genome	14004-14038	1	0.971
CP026613_10	10.7\|2248532\|36\|CP026613\|CRISPRCasFinder,CRT	2248532-2248567	36	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	45852-45887	1	0.972
CP026613_10	10.7\|2248532\|36\|CP026613\|CRISPRCasFinder,CRT	2248532-2248567	36	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	39896-39931	1	0.972
CP026613_10	10.9\|2248662\|36\|CP026613\|CRISPRCasFinder,CRT	2248662-2248697	36	LN681539	Clostridium phage phiCD505, complete genome	49161-49196	1	0.972
CP026613_10	10.9\|2248662\|36\|CP026613\|CRISPRCasFinder,CRT	2248662-2248697	36	HG531805	Clostridium phage CDMH1 complete genome	51883-51918	1	0.972
CP026613_10	10.9\|2248662\|36\|CP026613\|CRISPRCasFinder,CRT	2248662-2248697	36	JX145341	Clostridium phage phiMMP02, complete genome	48240-48275	1	0.972
CP026613_10	10.9\|2248662\|36\|CP026613\|CRISPRCasFinder,CRT	2248662-2248697	36	NC_011398	Clostridium phage phiCD27, complete genome	50766-50801	1	0.972
CP026613_10	10.9\|2248662\|36\|CP026613\|CRISPRCasFinder,CRT	2248662-2248697	36	NC_048642	Clostridium phage CDKM9, complete genome	49605-49640	1	0.972
CP026613_10	10.19\|2248533\|36\|CP026613\|PILER-CR	2248533-2248568	36	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	45852-45887	1	0.972
CP026613_10	10.19\|2248533\|36\|CP026613\|PILER-CR	2248533-2248568	36	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	39896-39931	1	0.972
CP026613_10	10.21\|2248663\|36\|CP026613\|PILER-CR	2248663-2248698	36	LN681539	Clostridium phage phiCD505, complete genome	49161-49196	1	0.972
CP026613_10	10.21\|2248663\|36\|CP026613\|PILER-CR	2248663-2248698	36	HG531805	Clostridium phage CDMH1 complete genome	51883-51918	1	0.972
CP026613_10	10.21\|2248663\|36\|CP026613\|PILER-CR	2248663-2248698	36	JX145341	Clostridium phage phiMMP02, complete genome	48240-48275	1	0.972
CP026613_10	10.21\|2248663\|36\|CP026613\|PILER-CR	2248663-2248698	36	NC_011398	Clostridium phage phiCD27, complete genome	50766-50801	1	0.972
CP026613_10	10.21\|2248663\|36\|CP026613\|PILER-CR	2248663-2248698	36	NC_048642	Clostridium phage CDKM9, complete genome	49605-49640	1	0.972
CP026613_11	11.3\|2359252\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359252-2359287	36	LN681539	Clostridium phage phiCD505, complete genome	41179-41214	1	0.972
CP026613_11	11.4\|2359318\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359318-2359353	36	NZ_MF547664	Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence	62659-62694	1	0.972
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	111280-111315	1	0.972
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	MF547662	Clostridioides phage LIBA6276, complete genome	64625-64660	1	0.972
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	57448-57483	1	0.972
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	LN681537	Clostridium phage phiCD211, complete genome	66310-66345	1	0.972
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	64517-64552	1	0.972
CP026613_11	11.18\|2360240\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360240-2360275	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	47983-48018	1	0.972
CP026613_11	11.18\|2360240\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360240-2360275	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	125389-125424	1	0.972
CP026613_11	11.18\|2360240\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360240-2360275	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	73982-74017	1	0.972
CP026613_11	11.18\|2360240\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360240-2360275	36	LN681537	Clostridium phage phiCD211, complete genome	82844-82879	1	0.972
CP026613_11	11.20\|2360372\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360372-2360407	36	GU949551	Clostridium phage phiCD6356, complete genome	36074-36109	1	0.972
CP026613_11	11.22\|2360505\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360505-2360540	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	103143-103178	1	0.972
CP026613_11	11.22\|2360505\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360505-2360540	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	18822-18857	1	0.972
CP026613_11	11.22\|2360505\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360505-2360540	36	LN681537	Clostridium phage phiCD211, complete genome	27684-27719	1	0.972
CP026613_11	11.25\|2360703\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360703-2360738	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	78642-78677	1	0.972
CP026613_11	11.25\|2360703\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360703-2360738	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	23451-23486	1	0.972
CP026613_11	11.25\|2360703\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360703-2360738	36	LN681537	Clostridium phage phiCD211, complete genome	32313-32348	1	0.972
CP026613_11	11.25\|2360703\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360703-2360738	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	98514-98549	1	0.972
CP026613_11	11.33\|2361227\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361227-2361262	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	79416-79451	1	0.972
CP026613_11	11.39\|2361623\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361623-2361658	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	52293-52328	1	0.972
CP026613_11	11.39\|2361623\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361623-2361658	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	123047-123082	1	0.972
CP026613_11	11.39\|2361623\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361623-2361658	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	69672-69707	1	0.972
CP026613_11	11.39\|2361623\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361623-2361658	36	LN681537	Clostridium phage phiCD211, complete genome	78534-78569	1	0.972
CP026613_15	15.3\|3312391\|37\|CP026613\|CRISPRCasFinder,CRT	3312391-3312427	37	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	114752-114788	1	0.973
CP026613_15	15.7\|3312653\|37\|CP026613\|CRISPRCasFinder,CRT	3312653-3312689	37	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	27115-27151	1	0.973
CP026613_15	15.7\|3312653\|37\|CP026613\|CRISPRCasFinder,CRT	3312653-3312689	37	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	21159-21195	1	0.973
CP026613_15	15.7\|3312653\|37\|CP026613\|CRISPRCasFinder,CRT	3312653-3312689	37	NC_048665	Clostridium phage phiCDHM14, complete genome	18138-18174	1	0.973
CP026613_15	15.7\|3312653\|37\|CP026613\|CRISPRCasFinder,CRT	3312653-3312689	37	HG796225	Clostridium phage phiCDHM13 complete genome	17638-17674	1	0.973
CP026613_15	15.7\|3312653\|37\|CP026613\|CRISPRCasFinder,CRT	3312653-3312689	37	HG798901	Clostridium phage phiCDHM11 complete genome	17637-17673	1	0.973
CP026613_15	15.11\|3312914\|36\|CP026613\|CRISPRCasFinder,CRT	3312914-3312949	36	JX145342	Clostridium phage phiMMP04, complete genome	9722-9757	1	0.972
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	NC_008226	Clostridioides difficile 630 plasmid pCD630, complete sequence	5600-5636	1	0.973
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	NZ_CP016319	Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence	621-657	1	0.973
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	NC_048665	Clostridium phage phiCDHM14, complete genome	31765-31801	1	0.973
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	NC_028838	Clostridium phage phiCD506, complete genome	32852-32888	1	0.973
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	HG796225	Clostridium phage phiCDHM13 complete genome	32715-32751	1	0.973
CP026613_15	15.22\|3313633\|37\|CP026613\|CRISPRCasFinder,CRT	3313633-3313669	37	LN681538	Clostridium phage phiCD481-1, complete genome	32446-32482	1	0.973
CP026613_15	15.24\|3313765\|38\|CP026613\|CRISPRCasFinder,CRT	3313765-3313802	38	NC_028996	Clostridium phage phiCDHM19, complete genome	41368-41405	1	0.974
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	37275-37310	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	NC_007917	Clostridium phage phi CD119, complete genome	37275-37310	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	LN681539	Clostridium phage phiCD505, complete genome	38774-38809	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	LN681542	Clostridium phage phiMMP03, complete genome	40017-40052	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	HG531805	Clostridium phage CDMH1 complete genome	40261-40296	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	NC_009231	Clostridium phage phiC2, complete genome	43554-43589	1	0.972
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	KX228400	Clostridium phage CDKM15, complete genome	40539-40574	1	0.972
CP026613_15	15.29\|3314092\|36\|CP026613\|CRISPRCasFinder,CRT	3314092-3314127	36	LN681542	Clostridium phage phiMMP03, complete genome	20933-20968	1	0.972
CP026613_15	15.29\|3314092\|36\|CP026613\|CRISPRCasFinder,CRT	3314092-3314127	36	HG531805	Clostridium phage CDMH1 complete genome	22030-22065	1	0.972
CP026613_15	15.29\|3314092\|36\|CP026613\|CRISPRCasFinder,CRT	3314092-3314127	36	NC_009231	Clostridium phage phiC2, complete genome	20886-20921	1	0.972
CP026613_15	15.29\|3314092\|36\|CP026613\|CRISPRCasFinder,CRT	3314092-3314127	36	LN681541	Clostridium phage phiMMP01, complete genome	20932-20967	1	0.972
CP026613_15	15.31\|3314222\|35\|CP026613\|CRISPRCasFinder,CRT	3314222-3314256	35	NC_048642	Clostridium phage CDKM9, complete genome	41504-41538	1	0.971
CP026613_15	15.35\|3312391\|38\|CP026613\|PILER-CR	3312391-3312428	38	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	61044-61081	1	0.974
CP026613_15	15.35\|3312391\|38\|CP026613\|PILER-CR	3312391-3312428	38	MF547663	Clostridioides phage LIBA2945, complete genome	64507-64544	1	0.974
CP026613_15	15.35\|3312391\|38\|CP026613\|PILER-CR	3312391-3312428	38	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	60919-60956	1	0.974
CP026613_15	15.35\|3312391\|38\|CP026613\|PILER-CR	3312391-3312428	38	LN681537	Clostridium phage phiCD211, complete genome	69781-69818	1	0.974
CP026613_15	15.36\|3312457\|37\|CP026613\|PILER-CR	3312457-3312493	37	NC_028905	Clostridium phage phiCD111, complete genome	34736-34772	1	0.973
CP026613_15	15.48\|3313238\|38\|CP026613\|PILER-CR	3313238-3313275	38	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	96659-96696	1	0.974
CP026613_15	15.48\|3313238\|38\|CP026613\|PILER-CR	3313238-3313275	38	MF547662	Clostridioides phage LIBA6276, complete genome	50512-50549	1	0.974
CP026613_15	15.48\|3313238\|38\|CP026613\|PILER-CR	3313238-3313275	38	MF547663	Clostridioides phage LIBA2945, complete genome	50362-50399	1	0.974
CP026613_15	15.48\|3313238\|38\|CP026613\|PILER-CR	3313238-3313275	38	JX145342	Clostridium phage phiMMP04, complete genome	16987-17024	1	0.974
CP026613_15	15.51\|3313438\|37\|CP026613\|PILER-CR	3313438-3313474	37	NC_048665	Clostridium phage phiCDHM14, complete genome	27689-27725	1	0.973
CP026613_15	15.51\|3313438\|37\|CP026613\|PILER-CR	3313438-3313474	37	JX145342	Clostridium phage phiMMP04, complete genome	26659-26695	1	0.973
CP026613_15	15.51\|3313438\|37\|CP026613\|PILER-CR	3313438-3313474	37	HG796225	Clostridium phage phiCDHM13 complete genome	27723-27759	1	0.973
CP026613_15	15.51\|3313438\|37\|CP026613\|PILER-CR	3313438-3313474	37	LN681538	Clostridium phage phiCD481-1, complete genome	27458-27494	1	0.973
CP026613_15	15.51\|3313438\|37\|CP026613\|PILER-CR	3313438-3313474	37	HG798901	Clostridium phage phiCDHM11 complete genome	27720-27756	1	0.973
CP026613_15	15.52\|3313503\|37\|CP026613\|PILER-CR	3313503-3313539	37	NC_048665	Clostridium phage phiCDHM14, complete genome	12408-12444	1	0.973
CP026613_15	15.52\|3313503\|37\|CP026613\|PILER-CR	3313503-3313539	37	HG796225	Clostridium phage phiCDHM13 complete genome	12376-12412	1	0.973
CP026613_15	15.52\|3313503\|37\|CP026613\|PILER-CR	3313503-3313539	37	HG798901	Clostridium phage phiCDHM11 complete genome	12375-12411	1	0.973
CP026613_15	15.52\|3313503\|37\|CP026613\|PILER-CR	3313503-3313539	37	MK473382	Clostridium phage JD032, complete genome	22268-22304	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	NC_048665	Clostridium phage phiCDHM14, complete genome	9235-9271	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	MK473382	Clostridium phage JD032, complete genome	25441-25477	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	JX145342	Clostridium phage phiMMP04, complete genome	9221-9257	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	NC_028838	Clostridium phage phiCD506, complete genome	9661-9697	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	HG796225	Clostridium phage phiCDHM13 complete genome	9203-9239	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	LN681538	Clostridium phage phiCD481-1, complete genome	9688-9724	1	0.973
CP026613_15	15.53\|3313568\|37\|CP026613\|PILER-CR	3313568-3313604	37	HG798901	Clostridium phage phiCDHM11 complete genome	9202-9238	1	0.973
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	MK473382	Clostridium phage JD032, complete genome	492-529	1	0.974
CP026613_15	15.56\|3313765\|39\|CP026613\|PILER-CR	3313765-3313803	39	NC_028996	Clostridium phage phiCDHM19, complete genome	41367-41405	1	0.974
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	LN681541	Clostridium phage phiMMP01, complete genome	36334-36370	1	0.973
CP026613_15	15.59\|3313963\|35\|CP026613\|PILER-CR	3313963-3313997	35	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	96289-96323	1	0.971
CP026613_15	15.59\|3313963\|35\|CP026613\|PILER-CR	3313963-3313997	35	MF547662	Clostridioides phage LIBA6276, complete genome	50142-50176	1	0.971
CP026613_15	15.59\|3313963\|35\|CP026613\|PILER-CR	3313963-3313997	35	MF547663	Clostridioides phage LIBA2945, complete genome	49992-50026	1	0.971
CP026613_15	15.61\|3314092\|37\|CP026613\|PILER-CR	3314092-3314128	37	LN681542	Clostridium phage phiMMP03, complete genome	20933-20969	1	0.973
CP026613_15	15.61\|3314092\|37\|CP026613\|PILER-CR	3314092-3314128	37	HG531805	Clostridium phage CDMH1 complete genome	22030-22066	1	0.973
CP026613_15	15.61\|3314092\|37\|CP026613\|PILER-CR	3314092-3314128	37	NC_009231	Clostridium phage phiC2, complete genome	20886-20922	1	0.973
CP026613_15	15.61\|3314092\|37\|CP026613\|PILER-CR	3314092-3314128	37	LN681541	Clostridium phage phiMMP01, complete genome	20932-20968	1	0.973
CP026613_16	16.4\|3637874\|20\|CP026613\|CRT	3637874-3637893	20	MT952845	Microbacterium phage GardenState, complete genome	19870-19889	1	0.95
CP026613_16	16.4\|3637874\|20\|CP026613\|CRT	3637874-3637893	20	MK880124	Microbacterium phage IAmGroot, complete genome	20531-20550	1	0.95
CP026613_1	1.1\|32284\|38\|CP026613\|CRISPRCasFinder	32284-32321	38	NZ_CP033215	Clostridioides difficile strain 12038 plasmid unnamed1, complete sequence	3094-3131	2	0.947
CP026613_6	6.2\|1244905\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244905-1244942	38	NC_008226	Clostridioides difficile 630 plasmid pCD630, complete sequence	7047-7084	2	0.947
CP026613_6	6.2\|1244905\|38\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1244905-1244942	38	NZ_CP016319	Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence	2068-2105	2	0.947
CP026613_6	6.5\|1245106\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245106-1245142	37	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	26227-26263	2	0.946
CP026613_6	6.5\|1245106\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245106-1245142	37	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	20514-20550	2	0.946
CP026613_6	6.5\|1245106\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245106-1245142	37	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	14558-14594	2	0.946
CP026613_6	6.5\|1245106\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245106-1245142	37	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	24872-24908	2	0.946
CP026613_6	6.5\|1245106\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245106-1245142	37	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	21549-21585	2	0.946
CP026613_8	8.2\|1745978\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1745978-1746014	37	LN681539	Clostridium phage phiCD505, complete genome	32018-32054	2	0.946
CP026613_8	8.4\|1746110\|36\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746110-1746145	36	JX145342	Clostridium phage phiMMP04, complete genome	27308-27343	2	0.944
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	NC_048665	Clostridium phage phiCDHM14, complete genome	32247-32283	2	0.946
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	JX145342	Clostridium phage phiMMP04, complete genome	31297-31333	2	0.946
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	NC_028838	Clostridium phage phiCD506, complete genome	60-96	2	0.946
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	HG796225	Clostridium phage phiCDHM13 complete genome	33197-33233	2	0.946
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	LN681538	Clostridium phage phiCD481-1, complete genome	83-119	2	0.946
CP026613_8	8.8\|1746372\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746372-1746408	37	HG798901	Clostridium phage phiCDHM11 complete genome	31600-31636	2	0.946
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	NC_048665	Clostridium phage phiCDHM14, complete genome	205-241	2	0.946
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	JX145342	Clostridium phage phiMMP04, complete genome	226-262	2	0.946
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	HG796225	Clostridium phage phiCDHM13 complete genome	205-241	2	0.946
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	HG798901	Clostridium phage phiCDHM11 complete genome	205-241	2	0.946
CP026613_9	9.8\|2198788\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198788-2198823	36	KX905163	Clostridioides phage phiSemix9P1, complete genome	16013-16048	2	0.944
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	MK473382	Clostridium phage JD032, complete genome	29020-29055	2	0.944
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	NC_048665	Clostridium phage phiCDHM14, complete genome	5624-5659	2	0.944
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	HG796225	Clostridium phage phiCDHM13 complete genome	5625-5660	2	0.944
CP026613_9	9.16\|2199315\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199315-2199350	36	HG798901	Clostridium phage phiCDHM11 complete genome	5624-5659	2	0.944
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	NC_048665	Clostridium phage phiCDHM14, complete genome	15385-15422	2	0.947
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	HG796225	Clostridium phage phiCDHM13 complete genome	15353-15390	2	0.947
CP026613_9	9.17\|2199380\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199380-2199417	38	HG798901	Clostridium phage phiCDHM11 complete genome	15352-15389	2	0.947
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	MN718463	Clostridium phage phiCDKH01, complete genome	4382-4418	2	0.946
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	NC_048642	Clostridium phage CDKM9, complete genome	26661-26697	2	0.946
CP026613_9	9.40\|2200898\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200898-2200935	38	HG531805	Clostridium phage CDMH1 complete genome	17018-17055	2	0.947
CP026613_9	9.44\|2201160\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201160-2201197	38	NC_011398	Clostridium phage phiCD27, complete genome	49299-49336	2	0.947
CP026613_10	10.6\|2248466\|37\|CP026613\|CRISPRCasFinder,CRT	2248466-2248502	37	NC_048665	Clostridium phage phiCDHM14, complete genome	13309-13345	2	0.946
CP026613_10	10.6\|2248466\|37\|CP026613\|CRISPRCasFinder,CRT	2248466-2248502	37	MK473382	Clostridium phage JD032, complete genome	21367-21403	2	0.946
CP026613_10	10.6\|2248466\|37\|CP026613\|CRISPRCasFinder,CRT	2248466-2248502	37	HG796225	Clostridium phage phiCDHM13 complete genome	13277-13313	2	0.946
CP026613_10	10.6\|2248466\|37\|CP026613\|CRISPRCasFinder,CRT	2248466-2248502	37	HG798901	Clostridium phage phiCDHM11 complete genome	13276-13312	2	0.946
CP026613_10	10.18\|2248467\|37\|CP026613\|PILER-CR	2248467-2248503	37	NC_048665	Clostridium phage phiCDHM14, complete genome	13309-13345	2	0.946
CP026613_10	10.18\|2248467\|37\|CP026613\|PILER-CR	2248467-2248503	37	MK473382	Clostridium phage JD032, complete genome	21367-21403	2	0.946
CP026613_10	10.18\|2248467\|37\|CP026613\|PILER-CR	2248467-2248503	37	HG796225	Clostridium phage phiCDHM13 complete genome	13277-13313	2	0.946
CP026613_10	10.18\|2248467\|37\|CP026613\|PILER-CR	2248467-2248503	37	HG798901	Clostridium phage phiCDHM11 complete genome	13276-13312	2	0.946
CP026613_11	11.17\|2360174\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360174-2360209	36	MF547663	Clostridioides phage LIBA2945, complete genome	63090-63125	2	0.944
CP026613_11	11.33\|2361227\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361227-2361262	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	24225-24260	2	0.944
CP026613_11	11.33\|2361227\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361227-2361262	36	LN681537	Clostridium phage phiCD211, complete genome	33087-33122	2	0.944
CP026613_11	11.33\|2361227\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361227-2361262	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	97740-97775	2	0.944
CP026613_11	11.38\|2361557\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361557-2361592	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	33780-33815	2	0.944
CP026613_11	11.38\|2361557\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361557-2361592	36	LN681537	Clostridium phage phiCD211, complete genome	42642-42677	2	0.944
CP026613_11	11.38\|2361557\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361557-2361592	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	88185-88220	2	0.944
CP026613_15	15.6\|3312587\|37\|CP026613\|CRISPRCasFinder,CRT	3312587-3312623	37	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	40544-40580	2	0.946
CP026613_15	15.6\|3312587\|37\|CP026613\|CRISPRCasFinder,CRT	3312587-3312623	37	NC_007917	Clostridium phage phi CD119, complete genome	40544-40580	2	0.946
CP026613_15	15.6\|3312587\|37\|CP026613\|CRISPRCasFinder,CRT	3312587-3312623	37	HG531805	Clostridium phage CDMH1 complete genome	43397-43433	2	0.946
CP026613_15	15.8\|3312719\|36\|CP026613\|CRISPRCasFinder,CRT	3312719-3312754	36	GU949551	Clostridium phage phiCD6356, complete genome	10970-11005	2	0.944
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	21499-21535	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NC_048665	Clostridium phage phiCDHM14, complete genome	14654-14690	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NC_007917	Clostridium phage phi CD119, complete genome	21499-21535	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NC_028996	Clostridium phage phiCDHM19, complete genome	21752-21788	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	MK473382	Clostridium phage JD032, complete genome	20019-20055	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	HG796225	Clostridium phage phiCDHM13 complete genome	14622-14658	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	LN681538	Clostridium phage phiCD481-1, complete genome	15110-15146	2	0.946
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	HG798901	Clostridium phage phiCDHM11 complete genome	14621-14657	2	0.946
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	NC_028996	Clostridium phage phiCDHM19, complete genome	41037-41072	2	0.944
CP026613_15	15.26\|3313898\|36\|CP026613\|CRISPRCasFinder,CRT	3313898-3313933	36	JX145341	Clostridium phage phiMMP02, complete genome	38199-38234	2	0.944
CP026613_15	15.27\|3313963\|34\|CP026613\|CRISPRCasFinder,CRT	3313963-3313996	34	LN681538	Clostridium phage phiCD481-1, complete genome	17348-17381	2	0.941
CP026613_15	15.30\|3314157\|36\|CP026613\|CRISPRCasFinder,CRT	3314157-3314192	36	LN681539	Clostridium phage phiCD505, complete genome	33801-33836	2	0.944
CP026613_15	15.30\|3314157\|36\|CP026613\|CRISPRCasFinder,CRT	3314157-3314192	36	JX145341	Clostridium phage phiMMP02, complete genome	33030-33065	2	0.944
CP026613_15	15.35\|3312391\|38\|CP026613\|PILER-CR	3312391-3312428	38	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	114751-114788	2	0.947
CP026613_15	15.39\|3312653\|38\|CP026613\|PILER-CR	3312653-3312690	38	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	27114-27151	2	0.947
CP026613_15	15.39\|3312653\|38\|CP026613\|PILER-CR	3312653-3312690	38	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	21158-21195	2	0.947
CP026613_15	15.39\|3312653\|38\|CP026613\|PILER-CR	3312653-3312690	38	NC_048665	Clostridium phage phiCDHM14, complete genome	18138-18175	2	0.947
CP026613_15	15.39\|3312653\|38\|CP026613\|PILER-CR	3312653-3312690	38	HG796225	Clostridium phage phiCDHM13 complete genome	17638-17675	2	0.947
CP026613_15	15.39\|3312653\|38\|CP026613\|PILER-CR	3312653-3312690	38	HG798901	Clostridium phage phiCDHM11 complete genome	17637-17674	2	0.947
CP026613_15	15.43\|3312914\|37\|CP026613\|PILER-CR	3312914-3312950	37	JX145342	Clostridium phage phiMMP04, complete genome	9722-9758	2	0.946
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	NC_008226	Clostridioides difficile 630 plasmid pCD630, complete sequence	5599-5636	2	0.947
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	NZ_CP016319	Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence	620-657	2	0.947
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	NC_048665	Clostridium phage phiCDHM14, complete genome	31765-31802	2	0.947
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	NC_028838	Clostridium phage phiCD506, complete genome	32852-32889	2	0.947
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	HG796225	Clostridium phage phiCDHM13 complete genome	32715-32752	2	0.947
CP026613_15	15.54\|3313633\|38\|CP026613\|PILER-CR	3313633-3313670	38	LN681538	Clostridium phage phiCD481-1, complete genome	32446-32483	2	0.947
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	37274-37310	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	NC_007917	Clostridium phage phi CD119, complete genome	37274-37310	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	LN681539	Clostridium phage phiCD505, complete genome	38773-38809	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	LN681542	Clostridium phage phiMMP03, complete genome	40016-40052	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	HG531805	Clostridium phage CDMH1 complete genome	40260-40296	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	NC_009231	Clostridium phage phiC2, complete genome	43553-43589	2	0.946
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	KX228400	Clostridium phage CDKM15, complete genome	40538-40574	2	0.946
CP026613_15	15.63\|3314222\|36\|CP026613\|PILER-CR	3314222-3314257	36	NC_048642	Clostridium phage CDKM9, complete genome	41504-41539	2	0.944
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	442-470	2	0.931
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321703-321731	2	0.931
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	KY421186	Flavobacterium phage FL-1, complete genome	26883-26911	2	0.931
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134065-134091	2	0.926
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	234638-234664	2	0.926
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236103-236129	2	0.926
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	MN694423	Marine virus AFVG_250M1001, complete genome	26187-26213	2	0.926
CP026613_17	17.9\|3755522\|24\|CP026613\|CRT	3755522-3755545	24	KT264821	Gokushovirus WZ-2015a isolate 73Mky18, complete genome	5139-5162	2	0.917
CP026613_6	6.6\|1245172\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245172-1245208	37	NC_005326	[Clostridium] difficile plasmid pCD6, complete sequence	6388-6424	3	0.919
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	GU949551	Clostridium phage phiCD6356, complete genome	34408-34444	3	0.919
CP026613_9	9.26\|2199974\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199974-2200008	35	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	12603-12637	3	0.914
CP026613_9	9.26\|2199974\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199974-2200008	35	NC_007917	Clostridium phage phi CD119, complete genome	12603-12637	3	0.914
CP026613_9	9.26\|2199974\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199974-2200008	35	NC_028996	Clostridium phage phiCDHM19, complete genome	12848-12882	3	0.914
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	37529-37566	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	NC_007917	Clostridium phage phi CD119, complete genome	37529-37566	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	NC_028996	Clostridium phage phiCDHM19, complete genome	41291-41328	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	LN681542	Clostridium phage phiMMP03, complete genome	40271-40308	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	NC_009231	Clostridium phage phiC2, complete genome	43808-43845	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	JX145341	Clostridium phage phiMMP02, complete genome	38453-38490	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	NC_011398	Clostridium phage phiCD27, complete genome	39278-39315	3	0.921
CP026613_10	10.11\|2248791\|38\|CP026613\|CRISPRCasFinder,CRT	2248791-2248828	38	KX228400	Clostridium phage CDKM15, complete genome	40793-40830	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	37529-37566	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	NC_007917	Clostridium phage phi CD119, complete genome	37529-37566	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	NC_028996	Clostridium phage phiCDHM19, complete genome	41291-41328	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	LN681542	Clostridium phage phiMMP03, complete genome	40271-40308	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	NC_009231	Clostridium phage phiC2, complete genome	43808-43845	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	JX145341	Clostridium phage phiMMP02, complete genome	38453-38490	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	NC_011398	Clostridium phage phiCD27, complete genome	39278-39315	3	0.921
CP026613_10	10.23\|2248792\|38\|CP026613\|PILER-CR	2248792-2248829	38	KX228400	Clostridium phage CDKM15, complete genome	40793-40830	3	0.921
CP026613_11	11.16\|2360107\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360107-2360143	37	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	103288-103324	3	0.919
CP026613_11	11.16\|2360107\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360107-2360143	37	MF547662	Clostridioides phage LIBA6276, complete genome	57141-57177	3	0.919
CP026613_11	11.16\|2360107\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360107-2360143	37	MF547663	Clostridioides phage LIBA2945, complete genome	56991-57027	3	0.919
CP026613_11	11.20\|2360372\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360372-2360407	36	NC_028838	Clostridium phage phiCD506, complete genome	31845-31880	3	0.917
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	74943-74977	3	0.914
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	99230-99264	3	0.914
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	MF547662	Clostridioides phage LIBA6276, complete genome	53083-53117	3	0.914
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	MF547663	Clostridioides phage LIBA2945, complete genome	52933-52967	3	0.914
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	47023-47057	3	0.914
CP026613_15	15.14\|3313109\|35\|CP026613\|CRISPRCasFinder,CRT	3313109-3313143	35	LN681537	Clostridium phage phiCD211, complete genome	55885-55919	3	0.914
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	JX145342	Clostridium phage phiMMP04, complete genome	14637-14673	3	0.919
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NC_028838	Clostridium phage phiCD506, complete genome	15083-15119	3	0.919
CP026613_15	15.38\|3312587\|38\|CP026613\|PILER-CR	3312587-3312624	38	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	40544-40581	3	0.921
CP026613_15	15.38\|3312587\|38\|CP026613\|PILER-CR	3312587-3312624	38	NC_007917	Clostridium phage phi CD119, complete genome	40544-40581	3	0.921
CP026613_15	15.38\|3312587\|38\|CP026613\|PILER-CR	3312587-3312624	38	HG531805	Clostridium phage CDMH1 complete genome	43397-43434	3	0.921
CP026613_15	15.40\|3312719\|37\|CP026613\|PILER-CR	3312719-3312755	37	GU949551	Clostridium phage phiCD6356, complete genome	10970-11006	3	0.919
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	74943-74978	3	0.917
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	NZ_CP029155	Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence	99229-99264	3	0.917
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	MF547662	Clostridioides phage LIBA6276, complete genome	53082-53117	3	0.917
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	MF547663	Clostridioides phage LIBA2945, complete genome	52932-52967	3	0.917
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	CP011970	Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence	47022-47057	3	0.917
CP026613_15	15.46\|3313109\|36\|CP026613\|PILER-CR	3313109-3313144	36	LN681537	Clostridium phage phiCD211, complete genome	55884-55919	3	0.917
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	21498-21535	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NC_048665	Clostridium phage phiCDHM14, complete genome	14653-14690	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NC_007917	Clostridium phage phi CD119, complete genome	21498-21535	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NC_028996	Clostridium phage phiCDHM19, complete genome	21751-21788	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	MK473382	Clostridium phage JD032, complete genome	20019-20056	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	HG796225	Clostridium phage phiCDHM13 complete genome	14621-14658	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	LN681538	Clostridium phage phiCD481-1, complete genome	15109-15146	3	0.921
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	HG798901	Clostridium phage phiCDHM11 complete genome	14620-14657	3	0.921
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	NC_028996	Clostridium phage phiCDHM19, complete genome	41036-41072	3	0.919
CP026613_15	15.58\|3313898\|37\|CP026613\|PILER-CR	3313898-3313934	37	JX145341	Clostridium phage phiMMP02, complete genome	38198-38234	3	0.919
CP026613_15	15.59\|3313963\|35\|CP026613\|PILER-CR	3313963-3313997	35	LN681538	Clostridium phage phiCD481-1, complete genome	17347-17381	3	0.914
CP026613_15	15.62\|3314157\|37\|CP026613\|PILER-CR	3314157-3314193	37	LN681539	Clostridium phage phiCD505, complete genome	33801-33837	3	0.919
CP026613_15	15.62\|3314157\|37\|CP026613\|PILER-CR	3314157-3314193	37	JX145341	Clostridium phage phiMMP02, complete genome	33030-33066	3	0.919
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN693968	Marine virus AFVG_250M909, complete genome	17693-17721	3	0.897
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	397-425	3	0.897
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321748-321776	3	0.897
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32384-32412	3	0.897
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251883-251911	3	0.897
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132600-132626	3	0.889
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253687-253713	3	0.889
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	8652-8678	3	0.889
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11688-11714	3	0.889
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41466-41492	3	0.889
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15458-15484	3	0.889
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	MN693383	Marine virus AFVG_25M295, complete genome	19800-19826	3	0.889
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	MN693263	Marine virus AFVG_25M296, complete genome	13691-13717	3	0.889
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	MK473382	Clostridium phage JD032, complete genome	34438-34474	4	0.892
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	NC_028838	Clostridium phage phiCD506, complete genome	665-701	4	0.892
CP026613_8	8.9\|1746438\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746438-1746474	37	LN681538	Clostridium phage phiCD481-1, complete genome	688-724	4	0.892
CP026613_8	8.10\|1746504\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746504-1746540	37	NC_009231	Clostridium phage phiC2, complete genome	25925-25961	4	0.892
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	JX145342	Clostridium phage phiMMP04, complete genome	14636-14673	4	0.895
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NC_028838	Clostridium phage phiCD506, complete genome	15082-15119	4	0.895
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10316-10344	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	127-155	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-164	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	226-254	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-263	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-434	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321739-321767	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321883-321911	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321892-321920	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	KY421186	Flavobacterium phage FL-1, complete genome	26595-26623	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	KY421186	Flavobacterium phage FL-1, complete genome	26694-26722	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	KY421186	Flavobacterium phage FL-1, complete genome	26874-26902	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73630-73658	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68914-68942	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72582-72610	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73720-73748	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-74000	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130734-130762	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130743-130771	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130761-130789	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32375-32403	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251956	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58283-58311	4	0.862
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30737-30765	4	0.862
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132600-132626	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134065-134091	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	234638-234664	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236103-236129	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	MN693383	Marine virus AFVG_25M295, complete genome	19800-19826	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	MN693263	Marine virus AFVG_25M296, complete genome	13691-13717	4	0.852
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	MN694423	Marine virus AFVG_250M1001, complete genome	26187-26213	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253753-253779	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	234971-234997	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236436-236462	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173139-173165	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173184-173210	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	JQ015307	Pectobacterium phage phiTE, complete genome	117045-117071	4	0.852
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	KY514263	Pectobacterium phage vB_PatM_CB7, complete genome	8691-8717	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236007-236033	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	243078-243104	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	243087-243113	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161308-161334	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253696-253722	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131472-131498	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8226-8252	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	1003-1029	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355376-355402	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355421-355447	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355430-355456	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355439-355465	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355448-355474	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355457-355483	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355466-355492	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355475-355501	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355484-355510	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355493-355519	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355529-355555	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355538-355564	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355556-355582	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355565-355591	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355574-355600	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355583-355609	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355592-355618	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355673-355699	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355682-355708	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355691-355717	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355727-355753	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355736-355762	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355763-355789	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355781-355807	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355790-355816	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355799-355825	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355808-355834	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355817-355843	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355826-355852	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355835-355861	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9054-9080	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9072-9098	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9090-9116	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116641-116667	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116650-116676	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116731-116757	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693183	Marine virus AFVG_25M360, complete genome	15039-15065	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	114716-114742	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	114725-114751	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	114779-114805	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41457-41483	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11697-11723	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	91608-91634	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15449-15475	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MT375529	Pelagibacter phage Kolga EXVC01, complete genome	13664-13690	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693263	Marine virus AFVG_25M296, complete genome	14159-14185	4	0.852
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693968	Marine virus AFVG_250M909, complete genome	17547-17573	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693263	Marine virus AFVG_25M296, complete genome	14159-14185	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	91599-91625	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP011156	Bacillus cereus strain HN001 plasmid pRML01, complete sequence	127074-127100	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131073-131099	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355367-355393	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355628-355654	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355655-355681	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	1133-1159	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	243078-243104	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	2238-2264	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3476-3502	4	0.852
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130603-130629	4	0.852
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161176-161202	4	0.852
CP026613_5	5.1\|865326\|25\|CP026613\|PILER-CR	865326-865350	25	NZ_CP040675	Exiguobacterium mexicanum strain A-EM plasmid punnamed1, complete sequence	7749-7773	5	0.8
CP026613_8	8.17\|1746968\|36\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746968-1747003	36	MK473382	Clostridium phage JD032, complete genome	34535-34570	5	0.861
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	JX145342	Clostridium phage phiMMP04, complete genome	8798-8833	5	0.861
CP026613_9	9.42\|2201030\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2201030-2201066	37	HG531805	Clostridium phage CDMH1 complete genome	20853-20889	5	0.865
CP026613_15	15.18\|3313370\|39\|CP026613\|CRISPRCasFinder,CRT	3313370-3313408	39	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	20149-20187	5	0.872
CP026613_15	15.18\|3313370\|39\|CP026613\|CRISPRCasFinder,CRT	3313370-3313408	39	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	18794-18832	5	0.872
CP026613_15	15.18\|3313370\|39\|CP026613\|CRISPRCasFinder,CRT	3313370-3313408	39	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	15471-15509	5	0.872
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MH617115	Siphoviridae sp. isolate ctjh_2, complete genome	23115-23143	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173150-173178	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12522-12550	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN693279	Marine virus AFVG_25M346, complete genome	16382-16410	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163868-163896	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	577005-577033	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213880-213908	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194765-194793	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183661-183689	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228707-228735	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58283-58311	5	0.828
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30737-30765	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-479	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321694-321722	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73747-73775	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72750-72778	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73549-73577	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73666-73694	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73909-73937	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71380-71408	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163580-163608	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179076-179104	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576717-576745	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213592-213620	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270977-271005	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195053-195081	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183373-183401	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228788-228816	5	0.828
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	MN694114	Marine virus AFVG_250M252, complete genome	19703-19731	5	0.828
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35405-35431	5	0.815
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35478-35504	5	0.815
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP021407	Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence	62651-62677	5	0.815
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	173346-173372	5	0.815
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP021407	Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence	62651-62677	5	0.815
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	MN693770	Marine virus AFVG_250M115, complete genome	22511-22537	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	233068-233094	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	240543-240569	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	254089-254115	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253753-253779	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274703-274729	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	310-336	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355655-355681	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355718-355744	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	244742-244768	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693556	Marine virus AFVG_25M429, complete genome	13107-13133	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693156	Marine virus AFVG_25M428, complete genome	12869-12895	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_KU950310	Pseudomonas syringae pv. actinidiae strain SR198 plasmid pMG2_SR198, complete sequence	110563-110589	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_KX009059	Pseudomonas syringae pv. actinidiae strain RT685 plasmid pMG1_RT685, complete sequence	118058-118084	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	31260-31286	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	34060-34086	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN694558	Marine virus AFVG_250M9, complete genome	20707-20733	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693383	Marine virus AFVG_25M295, complete genome	21449-21475	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN693263	Marine virus AFVG_25M296, complete genome	12041-12067	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NC_007734	Bacillus phage WBeta, complete genome	34060-34086	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN694640	Marine virus AFVG_250M10, complete genome	20719-20745	5	0.815
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	4177-4203	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	91608-91634	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	1012-1038	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125277-125303	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472799-472825	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131034-131060	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131082-131108	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132552-132578	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134398-134424	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355376-355402	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355421-355447	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355430-355456	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355439-355465	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355448-355474	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355457-355483	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355466-355492	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355475-355501	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355484-355510	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355493-355519	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355502-355528	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355547-355573	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355574-355600	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355583-355609	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355592-355618	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355601-355627	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355664-355690	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355691-355717	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355718-355744	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355727-355753	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355736-355762	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355745-355771	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355799-355825	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355808-355834	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355817-355843	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355826-355852	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355835-355861	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355412-355438	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321755-321781	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321782-321808	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693968	Marine virus AFVG_250M909, complete genome	17547-17573	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	365-391	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	392-418	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49753-49779	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	244742-244768	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68783-68809	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68792-68818	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68801-68827	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68810-68836	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68819-68845	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68828-68854	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68837-68863	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68846-68872	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68855-68881	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68864-68890	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90223-90249	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90232-90258	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90241-90267	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90250-90276	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90259-90285	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90268-90294	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90277-90303	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130585-130611	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130594-130620	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130666-130692	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130675-130701	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130684-130710	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130693-130719	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130702-130728	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130711-130737	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130720-130746	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130729-130755	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130630-130656	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693798	Marine virus AFVG_250M119, complete genome	11470-11496	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42453-42479	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42489-42515	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42525-42551	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42561-42587	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42597-42623	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42615-42641	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42633-42659	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42651-42677	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137854-137880	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137890-137916	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137926-137952	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137962-137988	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137998-138024	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138016-138042	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138034-138060	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138052-138078	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246952-246978	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179439-179465	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179475-179501	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179511-179537	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179547-179573	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179583-179609	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179601-179627	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179619-179645	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179637-179663	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	LT598654	Phage NCTB genome assembly, complete genome: monopartite	101206-101232	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327927-327953	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327945-327971	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327981-328007	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328071-328097	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328089-328115	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328107-328133	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328143-328169	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328179-328205	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328197-328223	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328269-328295	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328287-328313	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328305-328331	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328323-328349	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116704-116730	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4487-4513	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4505-4531	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4541-4567	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4631-4657	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4649-4675	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4667-4693	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4703-4729	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4739-4765	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4757-4783	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4829-4855	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4847-4873	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4865-4891	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4883-4909	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_022111	Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence	235540-235566	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53515-53541	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53533-53559	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53551-53577	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53569-53595	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53605-53631	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53641-53667	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53677-53703	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53713-53739	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	AP014445	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C39-MedDCM-OCT-S35-C62, * SEQUENCING IN PROGRESS *, 4 ordered pieces	24374-24400	5	0.815
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693279	Marine virus AFVG_25M346, complete genome	16368-16394	5	0.815
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131082-131117	5	0.861
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131073-131108	5	0.861
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130657-130692	5	0.861
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130594-130629	5	0.861
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161095-161121	5	0.815
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161203-161229	5	0.815
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	MN693383	Marine virus AFVG_25M295, complete genome	21440-21466	5	0.815
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	MN693263	Marine virus AFVG_25M296, complete genome	12050-12076	5	0.815
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	301-327	5	0.815
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	114689-114715	5	0.815
CP026613_2	2.1\|150198\|29\|CP026613\|CRISPRCasFinder	150198-150226	29	KY971610	Pseudomonas phage PspYZU05, complete genome	134239-134267	6	0.793
CP026613_5	5.3\|865325\|30\|CP026613\|CRISPRCasFinder	865325-865354	30	NZ_CP040675	Exiguobacterium mexicanum strain A-EM plasmid punnamed1, complete sequence	7748-7777	6	0.8
CP026613_9	9.31\|2200305\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2200305-2200341	37	MK473382	Clostridium phage JD032, complete genome	15449-15485	6	0.838
CP026613_15	15.9\|3312784\|36\|CP026613\|CRISPRCasFinder,CRT	3312784-3312819	36	MK473382	Clostridium phage JD032, complete genome	6548-6583	6	0.833
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	15975-16011	6	0.838
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	14620-14656	6	0.838
CP026613_15	15.25\|3313832\|37\|CP026613\|CRISPRCasFinder,CRT	3313832-3313868	37	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	11297-11333	6	0.838
CP026613_15	15.50\|3313370\|40\|CP026613\|PILER-CR	3313370-3313409	40	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	20149-20188	6	0.85
CP026613_15	15.50\|3313370\|40\|CP026613\|PILER-CR	3313370-3313409	40	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	18794-18833	6	0.85
CP026613_15	15.50\|3313370\|40\|CP026613\|PILER-CR	3313370-3313409	40	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	15471-15510	6	0.85
CP026613_16	16.11\|3638261\|29\|CP026613\|CRT	3638261-3638289	29	MH920640	Synechoccus phage S-E7, complete genome	31394-31422	6	0.793
CP026613_16	16.11\|3638261\|29\|CP026613\|CRT	3638261-3638289	29	MH920639	Synechoccus phage S-P4, partial genome	43108-43136	6	0.793
CP026613_16	16.11\|3638261\|29\|CP026613\|CRT	3638261-3638289	29	HQ634189	Cyanophage Syn30 genomic sequence	159732-159760	6	0.793
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN693469	Marine virus AFVG_25M404, complete genome	22263-22291	6	0.793
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN103543	Pseudomonas phage vB_PaeM_PS119XW, complete genome	68322-68350	6	0.793
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MK599315	Pseudomonas phage PA1C, complete genome	68001-68029	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251892-251920	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41498-41526	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11654-11682	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	118-146	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	163-191	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	190-218	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	217-245	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	262-290	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	289-317	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	316-344	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	352-380	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-479	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321694-321722	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321793-321821	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321829-321857	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321856-321884	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321901-321929	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15490-15518	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68923-68951	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71164-71192	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130572-130600	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130752-130780	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71209-71237	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68869-68897	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68932-68960	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN855854	Siphoviridae sp. isolate 269, complete genome	2178-2206	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76833-76861	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76977-77005	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163661-163689	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131075-131103	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576798-576826	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8469-8497	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8613-8641	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19882-19910	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20026-20054	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23088-23116	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23232-23260	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88990-89018	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89134-89162	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213673-213701	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16868-16896	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17012-17040	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80736-80764	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80880-80908	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194972-195000	6	0.793
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183454-183482	6	0.793
CP026613_16	16.17\|3638594\|29\|CP026613\|CRT	3638594-3638622	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73549-73577	6	0.793
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73963-73991	6	0.793
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416112-416140	6	0.793
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251766-251794	6	0.793
CP026613_17	17.3\|3755216\|27\|CP026613\|CRT	3755216-3755242	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173139-173165	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP023318	Bacillus megaterium strain A plasmid p1, complete sequence	138176-138202	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	MN693383	Marine virus AFVG_25M295, complete genome	19800-19826	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	69833-69859	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	70373-70399	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	70661-70687	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	70841-70867	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	71057-71083	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	71561-71587	6	0.778
CP026613_17	17.4\|3755261\|27\|CP026613\|CRT	3755261-3755287	27	MN693263	Marine virus AFVG_25M296, complete genome	13691-13717	6	0.778
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169269-169295	6	0.778
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	91599-91625	6	0.778
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MN856005	Myoviridae sp. isolate 302, complete genome	25958-25984	6	0.778
CP026613_17	17.5\|3755306\|27\|CP026613\|CRT	3755306-3755332	27	MH629685	Synechococcus virus S-PRM1, complete genome	127319-127345	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9063-9089	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9081-9107	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	9099-9125	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693263	Marine virus AFVG_25M296, complete genome	14084-14110	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125334-125360	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125391-125417	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125523-125549	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125580-125606	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125637-125663	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125694-125720	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125751-125777	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131091-131117	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253687-253713	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253696-253722	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355385-355411	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355538-355564	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355565-355591	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355682-355708	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355772-355798	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355790-355816	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693968	Marine virus AFVG_250M909, complete genome	17556-17582	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49885-49911	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49921-49947	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49957-49983	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49993-50019	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	50029-50055	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68873-68899	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68936-68962	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130657-130683	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42435-42461	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42687-42713	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137836-137862	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138088-138114	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179421-179447	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179673-179699	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327891-327917	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328035-328061	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328233-328259	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328359-328385	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4451-4477	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4595-4621	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4793-4819	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4919-4945	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53479-53505	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53731-53757	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693383	Marine virus AFVG_25M295, complete genome	19407-19433	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	AP013524	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15	37336-37362	6	0.778
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58720-58746	6	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68783-68818	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68792-68827	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68801-68836	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68810-68845	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68819-68854	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68828-68863	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68837-68872	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68846-68881	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68855-68890	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90223-90258	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90232-90267	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90241-90276	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90250-90285	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90259-90294	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90268-90303	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130585-130620	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130666-130701	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130675-130710	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130684-130719	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130693-130728	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130702-130737	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130711-130746	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130720-130755	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68774-68809	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90214-90249	6	0.833
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	KF437907	Phormidium phage MIS-PhV1A, complete genome	8747-8782	6	0.833
CP026613_17	17.10\|3755564\|27\|CP026613\|CRT	3755564-3755590	27	NC_041884	Acinetobacter phage vB_AbaM_ME3, complete genome	24729-24755	6	0.778
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	616-642	6	0.778
CP026613_17	17.13\|3755699\|27\|CP026613\|CRT	3755699-3755725	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8298-8324	6	0.778
CP026613_17	17.14\|3755744\|27\|CP026613\|CRT	3755744-3755770	27	NC_049930	Enterococcus phage vB_EfaP_Zip, complete genome	11740-11766	6	0.778
CP026613_4	4.1\|864995\|30\|CP026613\|CRISPRCasFinder	864995-865024	30	NZ_CP015323	Bacillus filamentosus strain Hbe603 plasmid pBEH1, complete sequence	34052-34081	7	0.767
CP026613_4	4.1\|864995\|30\|CP026613\|CRISPRCasFinder	864995-865024	30	NC_025171	Acinetobacter sp. M131 plasmid pM131-5, complete sequence	4697-4726	7	0.767
CP026613_4	4.2\|865061\|30\|CP026613\|CRISPRCasFinder	865061-865090	30	NC_015426	Clostridium botulinum BKT015925 plasmid p2BKT015925, complete sequence	60200-60229	7	0.767
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	NZ_CP043618	Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence	3662-3698	7	0.811
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	NZ_CP043618	Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence	32895-32931	7	0.811
CP026613_9	9.3\|2198457\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198457-2198493	37	NZ_CP013206	Paenibacillus sp. IHB B 3084 plasmid pHD03, complete sequence	39283-39319	7	0.811
CP026613_11	11.31\|2361096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361096-2361130	35	MN855865	Myoviridae sp. isolate 346, complete genome	2209-2243	7	0.8
CP026613_15	15.41\|3312784\|37\|CP026613\|PILER-CR	3312784-3312820	37	MK473382	Clostridium phage JD032, complete genome	6547-6583	7	0.811
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	15974-16011	7	0.816
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	14619-14656	7	0.816
CP026613_15	15.57\|3313832\|38\|CP026613\|PILER-CR	3313832-3313869	38	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	11296-11333	7	0.816
CP026613_16	16.11\|3638261\|29\|CP026613\|CRT	3638261-3638289	29	NC_015059	Granulicella tundricola MP5ACTX9 plasmid pACIX904, complete sequence	64543-64571	7	0.759
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN693834	Marine virus AFVG_250M755, complete genome	20213-20241	7	0.759
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN694396	Marine virus AFVG_250M754, complete genome	20213-20241	7	0.759
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN694618	Marine virus AFVG_250M753, complete genome	19975-20003	7	0.759
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MT254578	Bacillus phage Izhevsk, complete genome	113947-113975	7	0.759
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	MN693124	Marine virus AFVG_25M44, complete genome	16495-16523	7	0.759
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	NC_021536	Synechococcus phage S-IOM18 genomic sequence	42079-42107	7	0.759
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	NZ_CP010611	Phaeobacter inhibens strain P92 plasmid pP92_a, complete sequence	26882-26910	7	0.759
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	NZ_CP010716	Phaeobacter piscinae strain P18 plasmid pP18_a, complete sequence	26882-26910	7	0.759
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	NZ_CP010662	Phaeobacter inhibens strain P74 plasmid pP74_a, complete sequence	26882-26910	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251964-251992	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179049-179077	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	91-119	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-164	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-263	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	361-389	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-434	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270950-270978	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321928-321956	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321739-321767	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321784-321812	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321883-321911	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73792-73820	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68779-68807	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68788-68816	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68797-68825	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68806-68834	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68815-68843	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68824-68852	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68833-68861	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68842-68870	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68851-68879	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68860-68888	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68914-68942	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71554-71582	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72573-72601	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72723-72751	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73603-73631	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73639-73667	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73675-73703	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73738-73766	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73747-73775	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-74000	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73981-74009	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90219-90247	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90228-90256	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90237-90265	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90246-90274	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90255-90283	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90264-90292	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90273-90301	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130581-130609	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130590-130618	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130599-130627	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130662-130690	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130671-130699	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130680-130708	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130689-130717	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130698-130726	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130707-130735	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130716-130744	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130725-130753	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130743-130771	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14667-14695	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN693968	Marine virus AFVG_250M909, complete genome	17702-17730	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN693798	Marine virus AFVG_250M119, complete genome	11466-11494	7	0.759
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32384-32412	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76572-76600	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76716-76744	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8208-8236	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8352-8380	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20143-20171	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20287-20315	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22827-22855	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22971-22999	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17129-17157	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17273-17301	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80997-81025	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81141-81169	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88729-88757	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88873-88901	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	322-350	7	0.759
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1481-1509	7	0.759
CP026613_17	17.6\|3755351\|27\|CP026613\|CRT	3755351-3755377	27	MN693226	Marine virus AFVG_25M419, complete genome	11825-11851	7	0.741
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68864-68899	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130576-130611	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355592-355627	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321746-321781	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321782-321817	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	356-391	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	392-427	7	0.806
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	MN693798	Marine virus AFVG_250M119, complete genome	11461-11496	7	0.806
CP026613_17	17.18\|3755990\|33\|CP026613\|CRT	3755990-3756022	33	MN693889	Marine virus AFVG_250M624, complete genome	14784-14816	7	0.788
CP026613_4	4.2\|865061\|30\|CP026613\|CRISPRCasFinder	865061-865090	30	NC_014663	Acinetobacter phage Acj9, complete genome	46685-46714	8	0.733
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	NC_041928	Staphylococcus phage phiIBB-SEP1, complete genome	37105-37141	8	0.784
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	KP027447	Staphylococcus phage phiIPLA-C1C, complete genome	35955-35991	8	0.784
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	MH321490	Staphylococcus phage Quidividi, complete genome	71906-71942	8	0.784
CP026613_6	6.8\|1245304\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1245304-1245340	37	MF417868	Uncultured Caudovirales phage clone 7AX_1, partial genome	110184-110220	8	0.784
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	AP013453	Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S28-C28	9566-9597	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	150973-151004	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	68291-68322	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	111143-111174	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	100671-100702	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	23887-23918	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	118355-118386	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	144805-144836	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	66860-66891	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	44298-44329	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	140254-140285	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	73999-74030	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	175685-175716	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	97410-97441	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	145680-145711	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	74349-74380	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	162261-162292	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	144808-144839	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	74349-74380	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NC_025146	Clostridium botulinum plasmid pCB111 DNA, complete sequence, strain: 111	10348-10379	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	206389-206420	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	93865-93896	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NC_012654	Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence	105050-105081	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	179991-180022	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	142337-142368	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	119042-119073	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	170141-170172	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP031095	Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence	7078-7109	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	191990-192021	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	84548-84579	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	50736-50767	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	78181-78212	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	78183-78214	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	84553-84584	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	203456-203487	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	85929-85960	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	135451-135482	8	0.75
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	69501-69532	8	0.75
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	NC_013944	Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK1, complete sequence	26064-26099	8	0.778
CP026613_9	9.21\|2199645\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199645-2199680	36	NC_013945	Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK3, complete sequence	26064-26099	8	0.778
CP026613_11	11.4\|2359318\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359318-2359353	36	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	32365-32400	8	0.778
CP026613_11	11.4\|2359318\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359318-2359353	36	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	393669-393704	8	0.778
CP026613_11	11.14\|2359975\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359975-2360010	36	MH884511	Exiguobacterium phage vB_EalM-132, complete genome	57668-57703	8	0.778
CP026613_11	11.31\|2361096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361096-2361130	35	NC_017736	Helicobacter cetorum MIT 99-5656 plasmid pHCD, complete sequence	8468-8502	8	0.771
CP026613_11	11.31\|2361096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361096-2361130	35	NC_017736	Helicobacter cetorum MIT 99-5656 plasmid pHCD, complete sequence	8705-8739	8	0.771
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN693487	Marine virus AFVG_25M100, complete genome	23131-23159	8	0.724
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN694586	Marine virus AFVG_250M370, complete genome	22375-22403	8	0.724
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	NC_016658	Cyanophage NATL1A-7, complete genome	35128-35156	8	0.724
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	MG592614	Vibrio phage 1.248.O._10N.261.54.F1, partial genome	11992-12020	8	0.724
CP026613_16	16.14\|3638441\|29\|CP026613\|CRT	3638441-3638469	29	MG592400	Vibrio phage 1.016.O._10N.286.46.A11, partial genome	35123-35151	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251956	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251982-252010	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252000-252028	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71200-71228	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131084-131112	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN694114	Marine virus AFVG_250M252, complete genome	19694-19722	8	0.724
CP026613_16	16.15\|3638495\|29\|CP026613\|CRT	3638495-3638523	29	MN694114	Marine virus AFVG_250M252, complete genome	19712-19740	8	0.724
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130563-130591	8	0.724
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	LR606152	Rhizobium sp. Q54 genome assembly, plasmid: 9	71160-71188	8	0.724
CP026613_16	16.19\|3638693\|29\|CP026613\|CRT	3638693-3638721	29	NC_010627	Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence	302529-302557	8	0.724
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73967-74002	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130756-130791	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321818-321853	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321890-321925	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	MN693968	Marine virus AFVG_250M909, complete genome	17547-17582	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	122-157	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	221-256	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	320-355	8	0.778
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173139-173174	8	0.778
CP026613_17	17.10\|3755564\|27\|CP026613\|CRT	3755564-3755590	27	NC_014663	Acinetobacter phage Acj9, complete genome	160210-160236	8	0.704
CP026613_17	17.18\|3755990\|33\|CP026613\|CRT	3755990-3756022	33	CP024691	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-7-9K, complete sequence	97-129	8	0.758
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	379558-379589	9	0.719
CP026613_7	7.1\|1581116\|32\|CP026613\|CRISPRCasFinder	1581116-1581147	32	NC_019763	Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence	147487-147518	9	0.719
CP026613_8	8.6\|1746241\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746241-1746277	37	NZ_LR215006	Mycoplasma conjunctivae strain NCTC10147 plasmid 10	11741-11777	9	0.757
CP026613_8	8.6\|1746241\|37\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1746241-1746277	37	LR214957	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 3	10204-10240	9	0.757
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MG065657	UNVERIFIED: Campylobacter phage C4, complete genome	13370-13407	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MG065649	UNVERIFIED: Campylobacter phage A143, complete genome	21552-21589	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	KC710998	Shigella phage pSf-1, complete genome	51055-51092	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	NC_049821	Salmonella phage slyngel, complete genome	28580-28617	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MK373798	Escherichia phage vB_EcoS_G29-2, complete genome	34911-34948	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MG065681	UNVERIFIED: Campylobacter phage A139, complete genome	45515-45552	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MG065680	UNVERIFIED: Campylobacter phage A113, complete genome	22100-22137	9	0.763
CP026613_9	9.7\|2198721\|38\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198721-2198758	38	MG065643	UNVERIFIED: Campylobacter phage E6, complete genome	36773-36810	9	0.763
CP026613_11	11.6\|2359450\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2359450-2359484	35	MT774406	CrAssphage cr124_1, complete genome	86796-86830	9	0.743
CP026613_11	11.26\|2360769\|34\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360769-2360802	34	NC_015851	Acidithiobacillus caldus SM-1 megaplasmid, complete sequence	236190-236223	9	0.735
CP026613_11	11.26\|2360769\|34\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360769-2360802	34	NZ_CP005987	Acidithiobacillus caldus ATCC 51756 plasmid megap mpAca1.1, complete sequence	119031-119064	9	0.735
CP026613_11	11.26\|2360769\|34\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360769-2360802	34	NZ_CP026329	Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence	174745-174778	9	0.735
CP026613_16	16.13\|3638387\|29\|CP026613\|CRT	3638387-3638415	29	MN694774	Marine virus AFVG_250M941, complete genome	11427-11455	9	0.69
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72718-72753	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73742-73777	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321845-321880	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321863-321898	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321917-321952	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	MN693968	Marine virus AFVG_250M909, complete genome	17700-17735	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	95-130	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	149-184	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	167-202	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	194-229	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	248-283	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	266-301	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	293-328	9	0.75
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251977-252012	9	0.75
CP026613_17	17.12\|3755645\|36\|CP026613\|CRT	3755645-3755680	36	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472781-472816	9	0.75
CP026613_9	9.26\|2199974\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2199974-2200008	35	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	80296-80330	10	0.714
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	NZ_CP050647	Escherichia coli strain PapM-36-2 plasmid pIncFIB, complete sequence	2680-2715	10	0.722
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	NC_019348	Lactococcus lactis subsp. cremoris plasmid pAF07, complete sequence	2990-3025	10	0.722
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	MN693542	Marine virus AFVG_25M165, complete genome	18964-18999	10	0.722
CP026613_11	11.31\|2361096\|35\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2361096-2361130	35	NZ_CP034172	Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence	21901-21935	10	0.714
CP026613_15	15.31\|3314222\|35\|CP026613\|CRISPRCasFinder,CRT	3314222-3314256	35	MN033866	Leviviridae sp. isolate H1_Bulk_Litter_6_scaffold_308 hypothetical protein (H1BulkLitter6308_000001), hypothetical protein (H1BulkLitter6308_000002), RNA-dependent RNA polymerase (H1BulkLitter6308_000003), and hypothetical protein (H1BulkLitter6308_000004) genes, complete cds	3011-3045	10	0.714
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	91608-91643	10	0.722
CP026613_17	17.7\|3755396\|36\|CP026613\|CRT	3755396-3755431	36	NZ_CP024167	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence	15778-15813	10	0.722
CP026613_8	8.1\|1745913\|36\|CP026613\|PILER-CR,CRISPRCasFinder,CRT	1745913-1745948	36	NC_014389	Butyrivibrio proteoclasticus B316 plasmid pCY360, complete sequence	203717-203752	11	0.694
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	MN693056	Marine virus AFVG_25M10, complete genome	18618-18653	11	0.694
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	MN693152	Marine virus AFVG_25M11, complete genome	41143-41178	11	0.694
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	MN693342	Marine virus AFVG_25M9, complete genome	18790-18825	11	0.694
CP026613_11	11.19\|2360306\|36\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2360306-2360341	36	MN693020	Marine virus AFVG_117M64, complete genome	41144-41179	11	0.694
CP026613_9	9.2\|2198391\|37\|CP026613\|CRISPRCasFinder,CRT,PILER-CR	2198391-2198427	37	HG796590	Uncultured bacterium plasmid pRGI01759	395-431	12	0.676

1. spacer 2.1|150198|29|CP026613|CRISPRCasFinder matches to NZ_CP033215 (Clostridioides difficile strain 12038 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgtaataagttaaagcaatatgaatcaac	CRISPR spacer
tgtaataagttaaagcaatatgaatcaac	Protospacer
*****************************

2. spacer 6.2|1244905|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_MG266000 (Clostridioides difficile strain 7032985 plasmid pCD-ISS1, complete sequence) position: , mismatch: 0, identity: 1.0

ataatagcagatatgatgtttaataacggaagtataag	CRISPR spacer
ataatagcagatatgatgtttaataacggaagtataag	Protospacer
**************************************

3. spacer 6.3|1244972|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_008226 (Clostridioides difficile 630 plasmid pCD630, complete sequence) position: , mismatch: 0, identity: 1.0

ctgaatgaacctaaggtagttgaacagattgaaaagac	CRISPR spacer
ctgaatgaacctaaggtagttgaacagattgaaaagac	Protospacer
**************************************

4. spacer 6.3|1244972|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016319 (Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence) position: , mismatch: 0, identity: 1.0

ctgaatgaacctaaggtagttgaacagattgaaaagac	CRISPR spacer
ctgaatgaacctaaggtagttgaacagattgaaaagac	Protospacer
**************************************

5. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

6. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

7. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

8. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

9. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

10. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

11. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

12. spacer 8.3|1746044|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 0, identity: 1.0

ttatttcttaaccagtcaaataatctattttgtcctg	CRISPR spacer
ttatttcttaaccagtcaaataatctattttgtcctg	Protospacer
*************************************

13. spacer 8.7|1746307|36|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to GU949551 (Clostridium phage phiCD6356, complete genome) position: , mismatch: 0, identity: 1.0

tgaagggttataaaaaaaataatagcgaaaagggcg	CRISPR spacer
tgaagggttataaaaaaaataatagcgaaaagggcg	Protospacer
************************************

14. spacer 9.1|2198325|37|CP026613|CRISPRCasFinder,CRT matches to NZ_MF547664 (Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence) position: , mismatch: 0, identity: 1.0

gtaattttggaaaaaataattacagaggtaatacaac	CRISPR spacer
gtaattttggaaaaaataattacagaggtaatacaac	Protospacer
*************************************

15. spacer 9.5|2198589|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 0, identity: 1.0

tcattgatgctaacttaagtattccttgtttttgtga	CRISPR spacer
tcattgatgctaacttaagtattccttgtttttgtga	Protospacer
*************************************

16. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 0, identity: 1.0

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatccttcatgtgcttagctcttttatatttttt	Protospacer
************************************

17. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatccagaaacttataaacctgctccagattc	Protospacer
**************************************

18. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatccagaaacttataaacctgctccagattc	Protospacer
**************************************

19. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatccagaaacttataaacctgctccagattc	Protospacer
**************************************

20. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 0, identity: 1.0

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatccagaaacttataaacctgctccagattc	Protospacer
**************************************

21. spacer 9.18|2199447|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 0, identity: 1.0

ggatatgttgaaggaacacatatgttgcaacaaacca	CRISPR spacer
ggatatgttgaaggaacacatatgttgcaacaaacca	Protospacer
*************************************

22. spacer 9.18|2199447|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 0, identity: 1.0

ggatatgttgaaggaacacatatgttgcaacaaacca	CRISPR spacer
ggatatgttgaaggaacacatatgttgcaacaaacca	Protospacer
*************************************

23. spacer 9.20|2199579|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

gtttttctttattagataaaagttctccgtcgaatct	CRISPR spacer
gtttttctttattagataaaagttctccgtcgaatct	Protospacer
*************************************

24. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 0, identity: 1.0

aatcattccttttgtttcatctttaagttttacgac	CRISPR spacer
aatcattccttttgtttcatctttaagttttacgac	Protospacer
************************************

25. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 0, identity: 1.0

aatcattccttttgtttcatctttaagttttacgac	CRISPR spacer
aatcattccttttgtttcatctttaagttttacgac	Protospacer
************************************

26. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 0, identity: 1.0

aatcattccttttgtttcatctttaagttttacgac	CRISPR spacer
aatcattccttttgtttcatctttaagttttacgac	Protospacer
************************************

27. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

aatcattccttttgtttcatctttaagttttacgac	CRISPR spacer
aatcattccttttgtttcatctttaagttttacgac	Protospacer
************************************

28. spacer 9.25|2199909|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_008226 (Clostridioides difficile 630 plasmid pCD630, complete sequence) position: , mismatch: 0, identity: 1.0

gagattttcatatagccatagactgttttagttttt	CRISPR spacer
gagattttcatatagccatagactgttttagttttt	Protospacer
************************************

29. spacer 9.25|2199909|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016319 (Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence) position: , mismatch: 0, identity: 1.0

gagattttcatatagccatagactgttttagttttt	CRISPR spacer
gagattttcatatagccatagactgttttagttttt	Protospacer
************************************

30. spacer 9.28|2200105|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 0, identity: 1.0

tcctaaaccttctatcttctaaactctcattactttt	CRISPR spacer
tcctaaaccttctatcttctaaactctcattactttt	Protospacer
*************************************

31. spacer 9.28|2200105|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 0, identity: 1.0

tcctaaaccttctatcttctaaactctcattactttt	CRISPR spacer
tcctaaaccttctatcttctaaactctcattactttt	Protospacer
*************************************

32. spacer 9.28|2200105|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 0, identity: 1.0

tcctaaaccttctatcttctaaactctcattactttt	CRISPR spacer
tcctaaaccttctatcttctaaactctcattactttt	Protospacer
*************************************

33. spacer 9.29|2200171|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 0, identity: 1.0

atgataataatgtagtgaaacgaatagcaaaagagtt	CRISPR spacer
atgataataatgtagtgaaacgaatagcaaaagagtt	Protospacer
*************************************

34. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggttataatga	Protospacer
*************************************

35. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 0, identity: 1.0

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggttataatga	Protospacer
*************************************

36. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggttataatga	Protospacer
*************************************

37. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 0, identity: 1.0

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggttataatga	Protospacer
*************************************

38. spacer 9.35|2200569|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

tgtttgaacatgactttgaacatgtttgtctttctt	CRISPR spacer
tgtttgaacatgactttgaacatgtttgtctttctt	Protospacer
************************************

39. spacer 9.35|2200569|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

tgtttgaacatgactttgaacatgtttgtctttctt	CRISPR spacer
tgtttgaacatgactttgaacatgtttgtctttctt	Protospacer
************************************

40. spacer 9.35|2200569|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 0, identity: 1.0

tgtttgaacatgactttgaacatgtttgtctttctt	CRISPR spacer
tgtttgaacatgactttgaacatgtttgtctttctt	Protospacer
************************************

41. spacer 9.39|2200832|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 0, identity: 1.0

ttaattgattgttgagtaaatcctaattcttttattt	CRISPR spacer
ttaattgattgttgagtaaatcctaattcttttattt	Protospacer
*************************************

42. spacer 9.39|2200832|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 0, identity: 1.0

ttaattgattgttgagtaaatcctaattcttttattt	CRISPR spacer
ttaattgattgttgagtaaatcctaattcttttattt	Protospacer
*************************************

43. spacer 9.39|2200832|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 0, identity: 1.0

ttaattgattgttgagtaaatcctaattcttttattt	CRISPR spacer
ttaattgattgttgagtaaatcctaattcttttattt	Protospacer
*************************************

44. spacer 9.39|2200832|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 0, identity: 1.0

ttaattgattgttgagtaaatcctaattcttttattt	CRISPR spacer
ttaattgattgttgagtaaatcctaattcttttattt	Protospacer
*************************************

45. spacer 9.39|2200832|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 0, identity: 1.0

ttaattgattgttgagtaaatcctaattcttttattt	CRISPR spacer
ttaattgattgttgagtaaatcctaattcttttattt	Protospacer
*************************************

46. spacer 9.43|2201096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 0, identity: 1.0

gctcctcacctcttaatacgccagaactcaaccct	CRISPR spacer
gctcctcacctcttaatacgccagaactcaaccct	Protospacer
***********************************

47. spacer 10.7|2248532|36|CP026613|CRISPRCasFinder,CRT matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

48. spacer 10.7|2248532|36|CP026613|CRISPRCasFinder,CRT matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

49. spacer 10.7|2248532|36|CP026613|CRISPRCasFinder,CRT matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

50. spacer 10.19|2248533|36|CP026613|PILER-CR matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

51. spacer 10.19|2248533|36|CP026613|PILER-CR matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

52. spacer 10.19|2248533|36|CP026613|PILER-CR matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtgctattaa	Protospacer
************************************

53. spacer 11.3|2359252|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

ggtattagcaaatgtggaacaagtaattaagttagc	CRISPR spacer
ggtattagcaaatgtggaacaagtaattaagttagc	Protospacer
************************************

54. spacer 11.3|2359252|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 0, identity: 1.0

ggtattagcaaatgtggaacaagtaattaagttagc	CRISPR spacer
ggtattagcaaatgtggaacaagtaattaagttagc	Protospacer
************************************

55. spacer 11.3|2359252|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 0, identity: 1.0

ggtattagcaaatgtggaacaagtaattaagttagc	CRISPR spacer
ggtattagcaaatgtggaacaagtaattaagttagc	Protospacer
************************************

56. spacer 11.9|2359646|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to KU057941 (Clostridium phage CDSH1, complete genome) position: , mismatch: 0, identity: 1.0

tagatacccaaaaaccagctagaggggcatctttga	CRISPR spacer
tagatacccaaaaaccagctagaggggcatctttga	Protospacer
************************************

57. spacer 11.9|2359646|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028905 (Clostridium phage phiCD111, complete genome) position: , mismatch: 0, identity: 1.0

tagatacccaaaaaccagctagaggggcatctttga	CRISPR spacer
tagatacccaaaaaccagctagaggggcatctttga	Protospacer
************************************

58. spacer 11.9|2359646|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HM568888 (Clostridium phage phiCD38-2, complete genome) position: , mismatch: 0, identity: 1.0

tagatacccaaaaaccagctagaggggcatctttga	CRISPR spacer
tagatacccaaaaaccagctagaggggcatctttga	Protospacer
************************************

59. spacer 11.9|2359646|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028958 (Clostridium phage phiCD146, complete genome) position: , mismatch: 0, identity: 1.0

tagatacccaaaaaccagctagaggggcatctttga	CRISPR spacer
tagatacccaaaaaccagctagaggggcatctttga	Protospacer
************************************

60. spacer 11.9|2359646|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN881738 (Escherichia phage slur17, complete genome) position: , mismatch: 0, identity: 1.0

tagatacccaaaaaccagctagaggggcatctttga	CRISPR spacer
tagatacccaaaaaccagctagaggggcatctttga	Protospacer
************************************

61. spacer 11.22|2360505|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctactaaaaatactaaattagatgctaagttcaata	CRISPR spacer
ctactaaaaatactaaattagatgctaagttcaata	Protospacer
************************************

62. spacer 11.23|2360571|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caactattgttgaattagatagtgctttaagagata	CRISPR spacer
caactattgttgaattagatagtgctttaagagata	Protospacer
************************************

63. spacer 11.23|2360571|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caactattgttgaattagatagtgctttaagagata	CRISPR spacer
caactattgttgaattagatagtgctttaagagata	Protospacer
************************************

64. spacer 11.23|2360571|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 0, identity: 1.0

caactattgttgaattagatagtgctttaagagata	CRISPR spacer
caactattgttgaattagatagtgctttaagagata	Protospacer
************************************

65. spacer 11.23|2360571|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 0, identity: 1.0

caactattgttgaattagatagtgctttaagagata	CRISPR spacer
caactattgttgaattagatagtgctttaagagata	Protospacer
************************************

66. spacer 11.24|2360637|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aatggtatggtaataagattaaagattggataatcc	CRISPR spacer
aatggtatggtaataagattaaagattggataatcc	Protospacer
************************************

67. spacer 11.24|2360637|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 0, identity: 1.0

aatggtatggtaataagattaaagattggataatcc	CRISPR spacer
aatggtatggtaataagattaaagattggataatcc	Protospacer
************************************

68. spacer 11.24|2360637|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 0, identity: 1.0

aatggtatggtaataagattaaagattggataatcc	CRISPR spacer
aatggtatggtaataagattaaagattggataatcc	Protospacer
************************************

69. spacer 11.30|2361030|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acagactggtgacccagatataactaaacttcaaaa	CRISPR spacer
acagactggtgacccagatataactaaacttcaaaa	Protospacer
************************************

70. spacer 11.30|2361030|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagactggtgacccagatataactaaacttcaaaa	CRISPR spacer
acagactggtgacccagatataactaaacttcaaaa	Protospacer
************************************

71. spacer 11.30|2361030|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 0, identity: 1.0

acagactggtgacccagatataactaaacttcaaaa	CRISPR spacer
acagactggtgacccagatataactaaacttcaaaa	Protospacer
************************************

72. spacer 11.30|2361030|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 0, identity: 1.0

acagactggtgacccagatataactaaacttcaaaa	CRISPR spacer
acagactggtgacccagatataactaaacttcaaaa	Protospacer
************************************

73. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

74. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

75. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

76. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

77. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

78. spacer 11.34|2361293|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgaagacgatattttccaatagaaggattaata	CRISPR spacer
tcttgaagacgatattttccaatagaaggattaata	Protospacer
************************************

79. spacer 15.3|3312391|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cattgcatataagataagctgcattgattttttaggt	CRISPR spacer
cattgcatataagataagctgcattgattttttaggt	Protospacer
*************************************

80. spacer 15.3|3312391|37|CP026613|CRISPRCasFinder,CRT matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 0, identity: 1.0

cattgcatataagataagctgcattgattttttaggt	CRISPR spacer
cattgcatataagataagctgcattgattttttaggt	Protospacer
*************************************

81. spacer 15.3|3312391|37|CP026613|CRISPRCasFinder,CRT matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 0, identity: 1.0

cattgcatataagataagctgcattgattttttaggt	CRISPR spacer
cattgcatataagataagctgcattgattttttaggt	Protospacer
*************************************

82. spacer 15.3|3312391|37|CP026613|CRISPRCasFinder,CRT matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 0, identity: 1.0

cattgcatataagataagctgcattgattttttaggt	CRISPR spacer
cattgcatataagataagctgcattgattttttaggt	Protospacer
*************************************

83. spacer 15.4|3312457|36|CP026613|CRISPRCasFinder,CRT matches to NC_028905 (Clostridium phage phiCD111, complete genome) position: , mismatch: 0, identity: 1.0

ttgcattgtaaactaaaatgctttattctatattta	CRISPR spacer
ttgcattgtaaactaaaatgctttattctatattta	Protospacer
************************************

84. spacer 15.16|3313238|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
ttatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
*************************************

85. spacer 15.16|3313238|37|CP026613|CRISPRCasFinder,CRT matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 0, identity: 1.0

ttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
ttatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
*************************************

86. spacer 15.16|3313238|37|CP026613|CRISPRCasFinder,CRT matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 0, identity: 1.0

ttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
ttatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
*************************************

87. spacer 15.16|3313238|37|CP026613|CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 0, identity: 1.0

ttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
ttatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
*************************************

88. spacer 15.19|3313438|36|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 0, identity: 1.0

ctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
ctatattgaaatttattatgccttcattttaccatt	Protospacer
************************************

89. spacer 15.19|3313438|36|CP026613|CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 0, identity: 1.0

ctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
ctatattgaaatttattatgccttcattttaccatt	Protospacer
************************************

90. spacer 15.19|3313438|36|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 0, identity: 1.0

ctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
ctatattgaaatttattatgccttcattttaccatt	Protospacer
************************************

91. spacer 15.19|3313438|36|CP026613|CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 0, identity: 1.0

ctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
ctatattgaaatttattatgccttcattttaccatt	Protospacer
************************************

92. spacer 15.19|3313438|36|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 0, identity: 1.0

ctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
ctatattgaaatttattatgccttcattttaccatt	Protospacer
************************************

93. spacer 15.20|3313503|36|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 0, identity: 1.0

ctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
ctgctttacctgcctttccctggtctcttgatactc	Protospacer
************************************

94. spacer 15.20|3313503|36|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 0, identity: 1.0

ctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
ctgctttacctgcctttccctggtctcttgatactc	Protospacer
************************************

95. spacer 15.20|3313503|36|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 0, identity: 1.0

ctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
ctgctttacctgcctttccctggtctcttgatactc	Protospacer
************************************

96. spacer 15.20|3313503|36|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

ctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
ctgctttacctgcctttccctggtctcttgatactc	Protospacer
************************************

97. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

98. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

99. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

100. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

101. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

102. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

103. spacer 15.21|3313568|36|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 0, identity: 1.0

ttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
ttggagaaatggcaagacttacggagtttggagtta	Protospacer
************************************

104. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 0, identity: 1.0

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatattcttctttttcatcaaa	Protospacer
*************************************

105. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 0, identity: 1.0

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttgggactaaaaaagtagaaacagtttt	Protospacer
************************************

106. spacer 15.27|3313963|34|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
atgctacagcagaaaaagttgtaagtataagcaa	Protospacer
**********************************

107. spacer 15.27|3313963|34|CP026613|CRISPRCasFinder,CRT matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 0, identity: 1.0

atgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
atgctacagcagaaaaagttgtaagtataagcaa	Protospacer
**********************************

108. spacer 15.27|3313963|34|CP026613|CRISPRCasFinder,CRT matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 0, identity: 1.0

atgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
atgctacagcagaaaaagttgtaagtataagcaa	Protospacer
**********************************

109. spacer 16.21|3638792|20|CP026613|CRT matches to MN694697 (Marine virus AFVG_250M792, complete genome) position: , mismatch: 0, identity: 1.0

ctcctgttgctcctgtgttt	CRISPR spacer
ctcctgttgctcctgtgttt	Protospacer
********************

110. spacer 6.3|1244972|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_MG266000 (Clostridioides difficile strain 7032985 plasmid pCD-ISS1, complete sequence) position: , mismatch: 1, identity: 0.974

ctgaatgaacctaaggtagttgaacagattgaaaagac	CRISPR spacer
ctaaatgaacctaaggtagttgaacagattgaaaagac	Protospacer
**.***********************************

111. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 1, identity: 0.973

cacg-aaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
-acgaaaaaaatcagaaggggaggggggttatttaaaa	Protospacer
 *** *********************************

112. spacer 9.13|2199117|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.973

tttttgagtatggagataaagtaaaaattatacttcc	CRISPR spacer
tttttgaatatggagataaagtaaaaattatacttcc	Protospacer
*******.*****************************

113. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 1, identity: 0.972

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatctttcatgtgcttagctcttttatatttttt	Protospacer
******.*****************************

114. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccagattc	Protospacer
*********** **************************

115. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 1, identity: 0.974

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccagattc	Protospacer
*********** **************************

116. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccagattc	Protospacer
*********** **************************

117. spacer 9.23|2199777|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.973

aaaaagaaactactttgtatctttatgttggaataga	CRISPR spacer
aaaaagaaactactttatatctttatgttggaataga	Protospacer
****************.********************

118. spacer 9.23|2199777|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.973

aaaaagaaactactttgtatctttatgttggaataga	CRISPR spacer
aaaaagaaactactttatatctttatgttggaataga	Protospacer
****************.********************

119. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttgggggtataatga	Protospacer
**************************** ********

120. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggctggggttataatga	Protospacer
**********************.**************

121. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggctataatga	Protospacer
****************************.********

122. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggctggggttataatga	Protospacer
**********************.**************

123. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtggttggttggggttataatga	Protospacer
****************.********************

124. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttgggggtataatga	Protospacer
**************************** ********

125. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggctggggttataatga	Protospacer
**********************.**************

126. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttggggctataatga	Protospacer
****************************.********

127. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatctctgcaactgtagttggttggggttataatga	Protospacer
*****.*******************************

128. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggttgggggtataatga	Protospacer
**************************** ********

129. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 1, identity: 0.973

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtagttggctggggttataatga	Protospacer
**********************.**************

130. spacer 9.40|2200898|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.974

tagtttattgtgtgtaaattctgcttcaaaacttattt	CRISPR spacer
tagtttattatgtgtaaattctgcttcaaaacttattt	Protospacer
*********.****************************

131. spacer 9.40|2200898|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.974

tagtttattgtgtgtaaattctgcttcaaaacttattt	CRISPR spacer
tagtttattatgtgtaaattctgcttcaaaacttattt	Protospacer
*********.****************************

132. spacer 9.40|2200898|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.974

tagtttattgtgtgtaaattctgcttcaaaacttattt	CRISPR spacer
tagtttattatgtgtaaattctgcttcaaaacttattt	Protospacer
*********.****************************

133. spacer 9.41|2200965|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.972

tccactccaagaattaggaatagccttgctttcact	CRISPR spacer
tcaactccaagaattaggaatagccttgctttcact	Protospacer
** *********************************

134. spacer 9.41|2200965|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.972

tccactccaagaattaggaatagccttgctttcact	CRISPR spacer
tccactccgagaattaggaatagccttgctttcact	Protospacer
********.***************************

135. spacer 9.41|2200965|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.972

tccactccaagaattaggaatagccttgctttcact	CRISPR spacer
tccactccgagaattaggaatagccttgctttcact	Protospacer
********.***************************

136. spacer 9.41|2200965|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 1, identity: 0.972

tccactccaagaattaggaatagccttgctttcact	CRISPR spacer
tccactccgagaattaggaatagccttgctttcact	Protospacer
********.***************************

137. spacer 9.43|2201096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.971

gctcctcacctcttaatacgccagaactcaaccct	CRISPR spacer
gttcctcacctcttaatacgccagaactcaaccct	Protospacer
*.*********************************

138. spacer 9.43|2201096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.971

gctcctcacctcttaatacgccagaactcaaccct	CRISPR spacer
gttcctcacctcttaatacgccagaactcaaccct	Protospacer
*.*********************************

139. spacer 9.43|2201096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.971

gctcctcacctcttaatacgccagaactcaaccct	CRISPR spacer
gttcctcacctcttaatacgccagaactcaaccct	Protospacer
*.*********************************

140. spacer 10.7|2248532|36|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtactattaa	Protospacer
****************************.*******

141. spacer 10.7|2248532|36|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtactattaa	Protospacer
****************************.*******

142. spacer 10.9|2248662|36|CP026613|CRISPRCasFinder,CRT matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

143. spacer 10.9|2248662|36|CP026613|CRISPRCasFinder,CRT matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

144. spacer 10.9|2248662|36|CP026613|CRISPRCasFinder,CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

145. spacer 10.9|2248662|36|CP026613|CRISPRCasFinder,CRT matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

146. spacer 10.9|2248662|36|CP026613|CRISPRCasFinder,CRT matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

147. spacer 10.19|2248533|36|CP026613|PILER-CR matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtactattaa	Protospacer
****************************.*******

148. spacer 10.19|2248533|36|CP026613|PILER-CR matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

tgatagagaaacttgaaagcgaagatgtgctattaa	CRISPR spacer
tgatagagaaacttgaaagcgaagatgtactattaa	Protospacer
****************************.*******

149. spacer 10.21|2248663|36|CP026613|PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

150. spacer 10.21|2248663|36|CP026613|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

151. spacer 10.21|2248663|36|CP026613|PILER-CR matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

152. spacer 10.21|2248663|36|CP026613|PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

153. spacer 10.21|2248663|36|CP026613|PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 1, identity: 0.972

ttcactttgatttaactcatctcttttcacaccttt	CRISPR spacer
ttcgctttgatttaactcatctcttttcacaccttt	Protospacer
***.********************************

154. spacer 11.3|2359252|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.972

ggtattagcaaatgtggaacaagtaattaagttagc	CRISPR spacer
ggtattggcaaatgtggaacaagtaattaagttagc	Protospacer
******.*****************************

155. spacer 11.4|2359318|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF547664 (Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence) position: , mismatch: 1, identity: 0.972

ttttttccccctttaaattttaaaactaataattta	CRISPR spacer
tattttccccctttaaattttaaaactaataattta	Protospacer
* **********************************

156. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
tattacagatatagcacattctctcatcttcagact	Protospacer
********************* **************

157. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 1, identity: 0.972

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
tattacagatatagcacattctctcatcttcagact	Protospacer
********************* **************

158. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.972

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
tattacagatatagcacattctctcatcttcagact	Protospacer
********************* **************

159. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.972

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
tattacagatatagcacattctctcatcttcagact	Protospacer
********************* **************

160. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
tattacagatatagcacattctctcatcttcagact	Protospacer
********************* **************

161. spacer 11.18|2360240|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

actaaagaaaaagctaaaagtaaaaaagtagatgga	CRISPR spacer
attaaagaaaaagctaaaagtaaaaaagtagatgga	Protospacer
*.**********************************

162. spacer 11.18|2360240|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

actaaagaaaaagctaaaagtaaaaaagtagatgga	CRISPR spacer
attaaagaaaaagctaaaagtaaaaaagtagatgga	Protospacer
*.**********************************

163. spacer 11.18|2360240|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.972

actaaagaaaaagctaaaagtaaaaaagtagatgga	CRISPR spacer
attaaagaaaaagctaaaagtaaaaaagtagatgga	Protospacer
*.**********************************

164. spacer 11.18|2360240|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.972

actaaagaaaaagctaaaagtaaaaaagtagatgga	CRISPR spacer
attaaagaaaaagctaaaagtaaaaaagtagatgga	Protospacer
*.**********************************

165. spacer 11.20|2360372|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to GU949551 (Clostridium phage phiCD6356, complete genome) position: , mismatch: 1, identity: 0.972

aggggatattcagttgtcaatgtacacttttttcta	CRISPR spacer
aggggatattcagttgttaatgtacacttttttcta	Protospacer
*****************.******************

166. spacer 11.22|2360505|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

ctactaaaaatactaaattagatgctaagttcaata	CRISPR spacer
ctactaaaaatactaaattagatgctaagtttaata	Protospacer
*******************************.****

167. spacer 11.22|2360505|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.972

ctactaaaaatactaaattagatgctaagttcaata	CRISPR spacer
ctactaaaaatactaaattagatgctaagtttaata	Protospacer
*******************************.****

168. spacer 11.22|2360505|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.972

ctactaaaaatactaaattagatgctaagttcaata	CRISPR spacer
ctactaaaaatactaaattagatgctaagtttaata	Protospacer
*******************************.****

169. spacer 11.25|2360703|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

agtagagataattgctgaaatagaaaaagctaaaga	CRISPR spacer
agtagaaataattgctgaaatagaaaaagctaaaga	Protospacer
******.*****************************

170. spacer 11.25|2360703|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.972

agtagagataattgctgaaatagaaaaagctaaaga	CRISPR spacer
agtagaaataattgctgaaatagaaaaagctaaaga	Protospacer
******.*****************************

171. spacer 11.25|2360703|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.972

agtagagataattgctgaaatagaaaaagctaaaga	CRISPR spacer
agtagaaataattgctgaaatagaaaaagctaaaga	Protospacer
******.*****************************

172. spacer 11.25|2360703|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

agtagagataattgctgaaatagaaaaagctaaaga	CRISPR spacer
agtagaaataattgctgaaatagaaaaagctaaaga	Protospacer
******.*****************************

173. spacer 11.33|2361227|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

aaatgcagatgaacttgaaagagctacaaaactata	CRISPR spacer
aaatgcagatgaacttgagagagctacaaaactata	Protospacer
******************.*****************

174. spacer 11.39|2361623|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.972

aaacatttgatttggtgagccatctgacttaaacat	CRISPR spacer
aaacatttgatttggtgaaccatctgacttaaacat	Protospacer
******************.*****************

175. spacer 11.39|2361623|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

aaacatttgatttggtgagccatctgacttaaacat	CRISPR spacer
aaacatttgatttggtgaaccatctgacttaaacat	Protospacer
******************.*****************

176. spacer 11.39|2361623|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.972

aaacatttgatttggtgagccatctgacttaaacat	CRISPR spacer
aaacatttgatttggtgaaccatctgacttaaacat	Protospacer
******************.*****************

177. spacer 11.39|2361623|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.972

aaacatttgatttggtgagccatctgacttaaacat	CRISPR spacer
aaacatttgatttggtgaaccatctgacttaaacat	Protospacer
******************.*****************

178. spacer 15.3|3312391|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

cattgcatataagataagctgcattgattttttaggt	CRISPR spacer
cattgcatataagataagttgcattgattttttaggt	Protospacer
******************.******************

179. spacer 15.7|3312653|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

ttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
ttgcttatatttcttgcaacctgctcctataacataa	Protospacer
*********.***************************

180. spacer 15.7|3312653|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

ttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
ttgcttatatttcttgcaacctgctcctataacataa	Protospacer
*********.***************************

181. spacer 15.7|3312653|37|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

ttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
ttgcttatatttcttgcaacctgctcctataacataa	Protospacer
*********.***************************

182. spacer 15.7|3312653|37|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

ttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
ttgcttatatttcttgcaacctgctcctataacataa	Protospacer
*********.***************************

183. spacer 15.7|3312653|37|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 1, identity: 0.973

ttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
ttgcttatatttcttgcaacctgctcctataacataa	Protospacer
*********.***************************

184. spacer 15.11|3312914|36|CP026613|CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 1, identity: 0.972

aatcggagctaatttagaaattaaagagcttacaat	CRISPR spacer
aatcggagctaatttagaaatcaaagagcttacaat	Protospacer
*********************.**************

185. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to NC_008226 (Clostridioides difficile 630 plasmid pCD630, complete sequence) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

186. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP016319 (Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

187. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

188. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

189. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

190. spacer 15.22|3313633|37|CP026613|CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 1, identity: 0.973

ttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
ttgccacatccctcttatactcttctttttcatcaaa	Protospacer
*******************.*****************

191. spacer 15.24|3313765|38|CP026613|CRISPRCasFinder,CRT matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 1, identity: 0.974

agaaaatacaattacaggagttgtgaggatattttaga	CRISPR spacer
ggaaaatacaattacaggagttgtgaggatattttaga	Protospacer
.*************************************

192. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttgggactaaaaaagtagaaacaatttt	Protospacer
*******************************.****

193. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttgggactaaaaaagtagaaacaatttt	Protospacer
*******************************.****

194. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
************ ***********************

195. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
************ ***********************

196. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
************ ***********************

197. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
************ ***********************

198. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 1, identity: 0.972

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
************ ***********************

199. spacer 15.29|3314092|36|CP026613|CRISPRCasFinder,CRT matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.972

acttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
acttgatggtattaaactctctaatattatacaatt	Protospacer
******************************.*****

200. spacer 15.29|3314092|36|CP026613|CRISPRCasFinder,CRT matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 1, identity: 0.972

acttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
acttgatggtattaaactctctaatattatacaatt	Protospacer
******************************.*****

201. spacer 15.29|3314092|36|CP026613|CRISPRCasFinder,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.972

acttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
acttgatggtattaaactctctaatattatacaatt	Protospacer
******************************.*****

202. spacer 15.29|3314092|36|CP026613|CRISPRCasFinder,CRT matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.972

acttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
acttgatggtattaaactctctaatattatacaatt	Protospacer
******************************.*****

203. spacer 15.31|3314222|35|CP026613|CRISPRCasFinder,CRT matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 1, identity: 0.971

ctgtaaatagtatcgtgtttctctgtataaagaat	CRISPR spacer
ctataaatagtatcgtgtttctctgtataaagaat	Protospacer
**.********************************

204. spacer 15.35|3312391|38|CP026613|PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

ccattgcatataagataagctgcattgattttttaggt	CRISPR spacer
acattgcatataagataagctgcattgattttttaggt	Protospacer
 *************************************

205. spacer 15.35|3312391|38|CP026613|PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 1, identity: 0.974

ccattgcatataagataagctgcattgattttttaggt	CRISPR spacer
acattgcatataagataagctgcattgattttttaggt	Protospacer
 *************************************

206. spacer 15.35|3312391|38|CP026613|PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 1, identity: 0.974

ccattgcatataagataagctgcattgattttttaggt	CRISPR spacer
acattgcatataagataagctgcattgattttttaggt	Protospacer
 *************************************

207. spacer 15.35|3312391|38|CP026613|PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 1, identity: 0.974

ccattgcatataagataagctgcattgattttttaggt	CRISPR spacer
acattgcatataagataagctgcattgattttttaggt	Protospacer
 *************************************

208. spacer 15.36|3312457|37|CP026613|PILER-CR matches to NC_028905 (Clostridium phage phiCD111, complete genome) position: , mismatch: 1, identity: 0.973

cttgcattgtaaactaaaatgctttattctatattta	CRISPR spacer
gttgcattgtaaactaaaatgctttattctatattta	Protospacer
 ************************************

209. spacer 15.48|3313238|38|CP026613|PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

cttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
attatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
 *************************************

210. spacer 15.48|3313238|38|CP026613|PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 1, identity: 0.974

cttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
attatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
 *************************************

211. spacer 15.48|3313238|38|CP026613|PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 1, identity: 0.974

cttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
attatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
 *************************************

212. spacer 15.48|3313238|38|CP026613|PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 1, identity: 0.974

cttatcaatcttaagccaagtaccaggttgtctaccaa	CRISPR spacer
attatcaatcttaagccaagtaccaggttgtctaccaa	Protospacer
 *************************************

213. spacer 15.51|3313438|37|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

cctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
actatattgaaatttattatgccttcattttaccatt	Protospacer
 ************************************

214. spacer 15.51|3313438|37|CP026613|PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 1, identity: 0.973

cctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
actatattgaaatttattatgccttcattttaccatt	Protospacer
 ************************************

215. spacer 15.51|3313438|37|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

cctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
actatattgaaatttattatgccttcattttaccatt	Protospacer
 ************************************

216. spacer 15.51|3313438|37|CP026613|PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 1, identity: 0.973

cctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
actatattgaaatttattatgccttcattttaccatt	Protospacer
 ************************************

217. spacer 15.51|3313438|37|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 1, identity: 0.973

cctatattgaaatttattatgccttcattttaccatt	CRISPR spacer
actatattgaaatttattatgccttcattttaccatt	Protospacer
 ************************************

218. spacer 15.52|3313503|37|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

cctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
actgctttacctgcctttccctggtctcttgatactc	Protospacer
 ************************************

219. spacer 15.52|3313503|37|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

cctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
actgctttacctgcctttccctggtctcttgatactc	Protospacer
 ************************************

220. spacer 15.52|3313503|37|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 1, identity: 0.973

cctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
actgctttacctgcctttccctggtctcttgatactc	Protospacer
 ************************************

221. spacer 15.52|3313503|37|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 1, identity: 0.973

cctgctttacctgcctttccctggtctcttgatactc	CRISPR spacer
actgctttacctgcctttccctggtctcttgatactc	Protospacer
 ************************************

222. spacer 15.53|3313568|37|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

223. spacer 15.53|3313568|37|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

224. spacer 15.53|3313568|37|CP026613|PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

225. spacer 15.53|3313568|37|CP026613|PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

226. spacer 15.53|3313568|37|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

227. spacer 15.53|3313568|37|CP026613|PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

228. spacer 15.53|3313568|37|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 1, identity: 0.973

cttggagaaatggcaagacttacggagtttggagtta	CRISPR spacer
attggagaaatggcaagacttacggagtttggagtta	Protospacer
 ************************************

229. spacer 15.54|3313633|38|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 1, identity: 0.974

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatattcttctttttcatcaaa	Protospacer
 *************************************

230. spacer 15.56|3313765|39|CP026613|PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 1, identity: 0.974

cagaaaatacaattacaggagttgtgaggatattttaga	CRISPR spacer
cggaaaatacaattacaggagttgtgaggatattttaga	Protospacer
*.*************************************

231. spacer 15.58|3313898|37|CP026613|PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.973

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttgggactaaaaaagtagaaacagtttt	Protospacer
.************************************

232. spacer 15.59|3313963|35|CP026613|PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

catgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
aatgctacagcagaaaaagttgtaagtataagcaa	Protospacer
 **********************************

233. spacer 15.59|3313963|35|CP026613|PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 1, identity: 0.971

catgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
aatgctacagcagaaaaagttgtaagtataagcaa	Protospacer
 **********************************

234. spacer 15.59|3313963|35|CP026613|PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 1, identity: 0.971

catgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
aatgctacagcagaaaaagttgtaagtataagcaa	Protospacer
 **********************************

235. spacer 15.61|3314092|37|CP026613|PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 1, identity: 0.973

cacttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
cacttgatggtattaaactctctaatattatacaatt	Protospacer
*******************************.*****

236. spacer 15.61|3314092|37|CP026613|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 1, identity: 0.973

cacttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
cacttgatggtattaaactctctaatattatacaatt	Protospacer
*******************************.*****

237. spacer 15.61|3314092|37|CP026613|PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 1, identity: 0.973

cacttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
cacttgatggtattaaactctctaatattatacaatt	Protospacer
*******************************.*****

238. spacer 15.61|3314092|37|CP026613|PILER-CR matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 1, identity: 0.973

cacttgatggtattaaactctctaatattatgcaatt	CRISPR spacer
cacttgatggtattaaactctctaatattatacaatt	Protospacer
*******************************.*****

239. spacer 16.4|3637874|20|CP026613|CRT matches to MT952845 (Microbacterium phage GardenState, complete genome) position: , mismatch: 1, identity: 0.95

ctccggttgctcctgctact	CRISPR spacer
ctccggttgctcctgctaca	Protospacer
*******************

240. spacer 16.4|3637874|20|CP026613|CRT matches to MK880124 (Microbacterium phage IAmGroot, complete genome) position: , mismatch: 1, identity: 0.95

ctccggttgctcctgctact	CRISPR spacer
ctccggttgctcctgctaca	Protospacer
*******************

241. spacer 1.1|32284|38|CP026613|CRISPRCasFinder matches to NZ_CP033215 (Clostridioides difficile strain 12038 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.947

aagcaacagaataaactgaacgcatctgaagtttgttt	CRISPR spacer
aagcaacagaataaactgaacacatgtgaagtttgttt	Protospacer
*********************.*** ************

242. spacer 6.2|1244905|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_008226 (Clostridioides difficile 630 plasmid pCD630, complete sequence) position: , mismatch: 2, identity: 0.947

ataatagcagatatgatgtttaataacggaagtataag	CRISPR spacer
atgatagcagatataatgtttaataacggaagtataag	Protospacer
**.***********.***********************

243. spacer 6.2|1244905|38|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016319 (Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence) position: , mismatch: 2, identity: 0.947

ataatagcagatatgatgtttaataacggaagtataag	CRISPR spacer
atgatagcagatataatgtttaataacggaagtataag	Protospacer
**.***********.***********************

244. spacer 6.5|1245106|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

aaatttaatattgctggaaaaggagaaatggatattg	CRISPR spacer
aaatttaatattactggaaaaggagaaatggatatcg	Protospacer
************.**********************.*

245. spacer 6.5|1245106|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.946

aaatttaatattgctggaaaaggagaaatggatattg	CRISPR spacer
aaatttaatattactggaaaaggagaaatggatatcg	Protospacer
************.**********************.*

246. spacer 6.5|1245106|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

aaatttaatattgctggaaaaggagaaatggatattg	CRISPR spacer
aaatttaatattactggaaaaggagaaatggatatcg	Protospacer
************.**********************.*

247. spacer 6.5|1245106|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 2, identity: 0.946

aaatttaatattgctggaaaaggagaaatggatattg	CRISPR spacer
aaatttaatattactggaaaaggagaaatggatatcg	Protospacer
************.**********************.*

248. spacer 6.5|1245106|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.946

aaatttaatattgctggaaaaggagaaatggatattg	CRISPR spacer
aaatttaatattactggaaaaggagaaatggatatcg	Protospacer
************.**********************.*

249. spacer 8.2|1745978|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 2, identity: 0.946

gatgctaccttatttttatctaatccccaaataaact	CRISPR spacer
gatgctaccttatttccatctaatccccaaataaact	Protospacer
***************..********************

250. spacer 8.4|1746110|36|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 2, identity: 0.944

atcatagtttattaacacaggaaacgaggttagttc	CRISPR spacer
atcatagcttgttaacacaggaaacgaggttagttc	Protospacer
*******.**.*************************

251. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

252. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

253. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

254. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

255. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

256. spacer 8.8|1746372|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.946

cacgaaaaaatcagaaggggaggggggttatttaaaa	CRISPR spacer
catgaaaaaatcagaatgggaggggggttatttaaaa	Protospacer
**.************* ********************

257. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.946

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttgaaacttgaattatttcaaaaggctaaacatcaag	Protospacer
**.********************.*************

258. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 2, identity: 0.946

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttaaagcttgaattatttcaaaaagcgaaacatcaag	Protospacer
*****.******************** **********

259. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.946

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttgaaacttgaattatttcaaaaggctaaacatcaag	Protospacer
**.********************.*************

260. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.946

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttgaaacttgaattatttcaaaaggctaaacatcaag	Protospacer
**.********************.*************

261. spacer 9.8|2198788|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to KX905163 (Clostridioides phage phiSemix9P1, complete genome) position: , mismatch: 2, identity: 0.944

aagttctatatacaactgtgcaagttctgaattaat	CRISPR spacer
aagttctatatataactgtgcaagttctgaattaac	Protospacer
************.**********************.

262. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 2, identity: 0.944

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatctttcatgtgcttagctcttttgtatttttt	Protospacer
******.********************.********

263. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.944

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatctttcatgtgcttagctcttttgtatttttt	Protospacer
******.********************.********

264. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.944

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatctttcatgtgcttagctcttttgtatttttt	Protospacer
******.********************.********

265. spacer 9.16|2199315|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.944

attatccttcatgtgcttagctcttttatatttttt	CRISPR spacer
attatctttcatgtgcttagctcttttgtatttttt	Protospacer
******.********************.********

266. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.947

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccggattc	Protospacer
*********** ********************.*****

267. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.947

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccggattc	Protospacer
*********** ********************.*****

268. spacer 9.17|2199380|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.947

tctagctatccagaaacttataaacctgctccagattc	CRISPR spacer
tctagctatcccgaaacttataaacctgctccggattc	Protospacer
*********** ********************.*****

269. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN718463 (Clostridium phage phiCDKH01, complete genome) position: , mismatch: 2, identity: 0.946

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgttgttggctggggttataatga	Protospacer
**************** *****.**************

270. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 2, identity: 0.946

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgttgttggatggggttataatga	Protospacer
**************** ***** **************

271. spacer 9.40|2200898|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 2, identity: 0.947

tagtttattgtgtgtaaattctgcttcaaaacttattt	CRISPR spacer
taatttattgtgtgtaaactctgcttcaaaacttattt	Protospacer
**.***************.*******************

272. spacer 9.44|2201160|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 2, identity: 0.947

ttctttaggaatcatcagtatggatgaatatcagtcta	CRISPR spacer
ttctttaggaatcatcagcatggatgaatatcattcta	Protospacer
******************.************** ****

273. spacer 10.6|2248466|37|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

274. spacer 10.6|2248466|37|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

275. spacer 10.6|2248466|37|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

276. spacer 10.6|2248466|37|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

277. spacer 10.18|2248467|37|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

278. spacer 10.18|2248467|37|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

279. spacer 10.18|2248467|37|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

280. spacer 10.18|2248467|37|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.946

taaattttgtattcttgacattgacatccaatatata	CRISPR spacer
taaattttgtattcttgacattgatatctaatatata	Protospacer
************************.***.********

281. spacer 11.17|2360174|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 2, identity: 0.944

tattacagatatagcacattcgctcatcttcagact	CRISPR spacer
cattacagatataacacattcgctcatcttcagact	Protospacer
.************.**********************

282. spacer 11.33|2361227|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 2, identity: 0.944

aaatgcagatgaacttgaaagagctacaaaactata	CRISPR spacer
aaatgcagatgagcttgagagagctacaaaactata	Protospacer
************.*****.*****************

283. spacer 11.33|2361227|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 2, identity: 0.944

aaatgcagatgaacttgaaagagctacaaaactata	CRISPR spacer
aaatgcagatgagcttgagagagctacaaaactata	Protospacer
************.*****.*****************

284. spacer 11.33|2361227|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.944

aaatgcagatgaacttgaaagagctacaaaactata	CRISPR spacer
aaatgcagatgagcttgagagagctacaaaactata	Protospacer
************.*****.*****************

285. spacer 11.38|2361557|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 2, identity: 0.944

taatacaaataaagaagttataacagctacaataaa	CRISPR spacer
taatacaaataaagaagttatacaagctacaataaa	Protospacer
**********************  ************

286. spacer 11.38|2361557|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 2, identity: 0.944

taatacaaataaagaagttataacagctacaataaa	CRISPR spacer
taatacaaataaagaagttatacaagctacaataaa	Protospacer
**********************  ************

287. spacer 11.38|2361557|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.944

taatacaaataaagaagttataacagctacaataaa	CRISPR spacer
taatacaaataaagaagttatacaagctacaataaa	Protospacer
**********************  ************

288. spacer 15.6|3312587|37|CP026613|CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

acacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
acacatattgccttctcttaaatctccaaaatctata	Protospacer
***************.********************.

289. spacer 15.6|3312587|37|CP026613|CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

acacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
acacatattgccttctcttaaatctccaaaatctata	Protospacer
***************.********************.

290. spacer 15.6|3312587|37|CP026613|CRISPRCasFinder,CRT matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 2, identity: 0.946

acacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
acacatattgccttctcttaaatctccaaaatctata	Protospacer
***************.********************.

291. spacer 15.8|3312719|36|CP026613|CRISPRCasFinder,CRT matches to GU949551 (Clostridium phage phiCD6356, complete genome) position: , mismatch: 2, identity: 0.944

cttgctctgcttcgcttttactcattgtgtcaactg	CRISPR spacer
cttgctctgcttcgcttttactcattgtaacaactg	Protospacer
****************************. ******

292. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
****************.****************** *

293. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
****************.**************.*****

294. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
****************.****************** *

295. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
****************.****************** *

296. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
****************.****************** *

297. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
****************.**************.*****

298. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
****************.****************** *

299. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.946

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
****************.**************.*****

300. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 2, identity: 0.944

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttggtactaaaaaagtagaaacaatttt	Protospacer
************ ******************.****

301. spacer 15.26|3313898|36|CP026613|CRISPRCasFinder,CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 2, identity: 0.944

ggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
ggaattacttgagactaaaaaagtagaaacaatttt	Protospacer
***********.*******************.****

302. spacer 15.27|3313963|34|CP026613|CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 2, identity: 0.941

atgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
atgctacagcagaaaaaaatgtaagtataagcaa	Protospacer
*****************. ***************

303. spacer 15.30|3314157|36|CP026613|CRISPRCasFinder,CRT matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 2, identity: 0.944

tatatcaaagctggaaaatcaagagtacaaagatat	CRISPR spacer
tatatcaaaactagaaaatcaagagtacaaagatat	Protospacer
*********.**.***********************

304. spacer 15.30|3314157|36|CP026613|CRISPRCasFinder,CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 2, identity: 0.944

tatatcaaagctggaaaatcaagagtacaaagatat	CRISPR spacer
tatatcaaaactagaaaatcaagagtacaaagatat	Protospacer
*********.**.***********************

305. spacer 15.35|3312391|38|CP026613|PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.947

ccattgcatataagataagctgcattgattttttaggt	CRISPR spacer
acattgcatataagataagttgcattgattttttaggt	Protospacer
 ******************.******************

306. spacer 15.39|3312653|38|CP026613|PILER-CR matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.947

cttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
attgcttatatttcttgcaacctgctcctataacataa	Protospacer
 *********.***************************

307. spacer 15.39|3312653|38|CP026613|PILER-CR matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.947

cttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
attgcttatatttcttgcaacctgctcctataacataa	Protospacer
 *********.***************************

308. spacer 15.39|3312653|38|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.947

cttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
attgcttatatttcttgcaacctgctcctataacataa	Protospacer
 *********.***************************

309. spacer 15.39|3312653|38|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.947

cttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
attgcttatatttcttgcaacctgctcctataacataa	Protospacer
 *********.***************************

310. spacer 15.39|3312653|38|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 2, identity: 0.947

cttgcttatacttcttgcaacctgctcctataacataa	CRISPR spacer
attgcttatatttcttgcaacctgctcctataacataa	Protospacer
 *********.***************************

311. spacer 15.43|3312914|37|CP026613|PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 2, identity: 0.946

caatcggagctaatttagaaattaaagagcttacaat	CRISPR spacer
aaatcggagctaatttagaaatcaaagagcttacaat	Protospacer
 *********************.**************

312. spacer 15.54|3313633|38|CP026613|PILER-CR matches to NC_008226 (Clostridioides difficile 630 plasmid pCD630, complete sequence) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

313. spacer 15.54|3313633|38|CP026613|PILER-CR matches to NZ_CP016319 (Clostridioides difficile strain 630 delta erm plasmid pCD630, complete sequence) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

314. spacer 15.54|3313633|38|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

315. spacer 15.54|3313633|38|CP026613|PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

316. spacer 15.54|3313633|38|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

317. spacer 15.54|3313633|38|CP026613|PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 2, identity: 0.947

cttgccacatccctcttatattcttctttttcatcaaa	CRISPR spacer
gttgccacatccctcttatactcttctttttcatcaaa	Protospacer
 *******************.*****************

318. spacer 15.58|3313898|37|CP026613|PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttgggactaaaaaagtagaaacaatttt	Protospacer
.*******************************.****

319. spacer 15.58|3313898|37|CP026613|PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttgggactaaaaaagtagaaacaatttt	Protospacer
.*******************************.****

320. spacer 15.58|3313898|37|CP026613|PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
.************ ***********************

321. spacer 15.58|3313898|37|CP026613|PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
.************ ***********************

322. spacer 15.58|3313898|37|CP026613|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
.************ ***********************

323. spacer 15.58|3313898|37|CP026613|PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
.************ ***********************

324. spacer 15.58|3313898|37|CP026613|PILER-CR matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 2, identity: 0.946

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacagtttt	Protospacer
.************ ***********************

325. spacer 15.63|3314222|36|CP026613|PILER-CR matches to NC_048642 (Clostridium phage CDKM9, complete genome) position: , mismatch: 2, identity: 0.944

cctgtaaatagtatcgtgtttctctgtataaagaat	CRISPR spacer
tctataaatagtatcgtgtttctctgtataaagaat	Protospacer
.**.********************************

326. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.931

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctcctgttggc	Protospacer
********************** *****

327. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.931

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctcctgttggc	Protospacer
********************** *****

328. spacer 16.19|3638693|29|CP026613|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.931

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctccggtttaa	Protospacer
************************** .*

329. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 2, identity: 0.926

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggtcctgttggtcctgttgccccagt	Protospacer
** ********* **************

330. spacer 17.4|3755261|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 2, identity: 0.926

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggtcctgttggacctgttgccccagt	Protospacer
** *********.**************

331. spacer 17.4|3755261|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 2, identity: 0.926

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggtcctgttggtcctgttgccccagt	Protospacer
** ********* **************

332. spacer 17.4|3755261|27|CP026613|CRT matches to MN694423 (Marine virus AFVG_250M1001, complete genome) position: , mismatch: 2, identity: 0.926

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tgcccctgttgggccagttgccccagt	Protospacer
***.*********** ***********

333. spacer 17.9|3755522|24|CP026613|CRT matches to KT264821 (Gokushovirus WZ-2015a isolate 73Mky18, complete genome) position: , mismatch: 2, identity: 0.917

tgctcctgttactcctactccggt	CRISPR spacer
ggctccggttactcctactccggt	Protospacer
 ***** *****************

334. spacer 6.6|1245172|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_005326 ([Clostridium] difficile plasmid pCD6, complete sequence) position: , mismatch: 3, identity: 0.919

aatgctgaacttaaagtaatgatgctattttgggaca	CRISPR spacer
cgtgctgaacttaaagtaatgatgctattttgggata	Protospacer
 .*********************************.*

335. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to GU949551 (Clostridium phage phiCD6356, complete genome) position: , mismatch: 3, identity: 0.919

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
attttttctatatactcagatatttcacttttgtctt	Protospacer
* ************.*****************.****

336. spacer 9.26|2199974|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 3, identity: 0.914

tgcttgtgctgtaggtgttccttgtgctgtcatat	CRISPR spacer
ggcttgtgctgtaggtgtcccttgtgctgtcatgt	Protospacer
 *****************.**************.*

337. spacer 9.26|2199974|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 3, identity: 0.914

tgcttgtgctgtaggtgttccttgtgctgtcatat	CRISPR spacer
ggcttgtgctgtaggtgtcccttgtgctgtcatgt	Protospacer
 *****************.**************.*

338. spacer 9.26|2199974|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.914

tgcttgtgctgtaggtgttccttgtgctgtcatat	CRISPR spacer
ggcttgtgctgtaggtgtcccttgtgctgtcatgt	Protospacer
 *****************.**************.*

339. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

340. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

341. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

342. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

343. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

344. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

345. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

346. spacer 10.11|2248791|38|CP026613|CRISPRCasFinder,CRT matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

347. spacer 10.23|2248792|38|CP026613|PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

348. spacer 10.23|2248792|38|CP026613|PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

349. spacer 10.23|2248792|38|CP026613|PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

350. spacer 10.23|2248792|38|CP026613|PILER-CR matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

351. spacer 10.23|2248792|38|CP026613|PILER-CR matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

352. spacer 10.23|2248792|38|CP026613|PILER-CR matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

353. spacer 10.23|2248792|38|CP026613|PILER-CR matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

354. spacer 10.23|2248792|38|CP026613|PILER-CR matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 3, identity: 0.921

ctgtatatttacaagttttatataaa---tattagtttcca	CRISPR spacer
ctgtatatttacaagttttatataaacattattagttt---	Protospacer
**************************   *********

355. spacer 11.16|2360107|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.919

-taagttatttttgtacattacgatttattatatttaa	CRISPR spacer
ataagtta-ttttgtacattatgatttcttatatttaa	Protospacer
 ******* ************.***** **********

356. spacer 11.16|2360107|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 3, identity: 0.919

-taagttatttttgtacattacgatttattatatttaa	CRISPR spacer
ataagtta-ttttgtacattatgatttcttatatttaa	Protospacer
 ******* ************.***** **********

357. spacer 11.16|2360107|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 3, identity: 0.919

-taagttatttttgtacattacgatttattatatttaa	CRISPR spacer
ataagtta-ttttgtacattatgatttcttatatttaa	Protospacer
 ******* ************.***** **********

358. spacer 11.20|2360372|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 3, identity: 0.917

aggggatattcagttgtcaatgtacacttttttcta	CRISPR spacer
gaggaatattcagttgtcaatgtacacttttttcta	Protospacer
..**.*******************************

359. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

360. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

361. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

362. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

363. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

364. spacer 15.14|3313109|35|CP026613|CRISPRCasFinder,CRT matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 3, identity: 0.914

tgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
tgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
*****.********.*******************.

365. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 3, identity: 0.919

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaagatgag	Protospacer
****************.**************.*** *

366. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 3, identity: 0.919

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tagaagatagaagaagtaatataaaagcaaagatgag	Protospacer
****************.**************.*** *

367. spacer 15.38|3312587|38|CP026613|PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

cacacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
tacacatattgccttctcttaaatctccaaaatctata	Protospacer
.***************.********************.

368. spacer 15.38|3312587|38|CP026613|PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

cacacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
tacacatattgccttctcttaaatctccaaaatctata	Protospacer
.***************.********************.

369. spacer 15.38|3312587|38|CP026613|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 3, identity: 0.921

cacacatattgccttcccttaaatctccaaaatctatg	CRISPR spacer
tacacatattgccttctcttaaatctccaaaatctata	Protospacer
.***************.********************.

370. spacer 15.40|3312719|37|CP026613|PILER-CR matches to GU949551 (Clostridium phage phiCD6356, complete genome) position: , mismatch: 3, identity: 0.919

tcttgctctgcttcgcttttactcattgtgtcaactg	CRISPR spacer
gcttgctctgcttcgcttttactcattgtaacaactg	Protospacer
 ****************************. ******

371. spacer 15.46|3313109|36|CP026613|PILER-CR matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

372. spacer 15.46|3313109|36|CP026613|PILER-CR matches to NZ_CP029155 (Clostridioides difficile strain CD161 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

373. spacer 15.46|3313109|36|CP026613|PILER-CR matches to MF547662 (Clostridioides phage LIBA6276, complete genome) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

374. spacer 15.46|3313109|36|CP026613|PILER-CR matches to MF547663 (Clostridioides phage LIBA2945, complete genome) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

375. spacer 15.46|3313109|36|CP026613|PILER-CR matches to CP011970 (Peptoclostridium phage phiCDIF1296T strain DSM 1296, complete sequence) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

376. spacer 15.46|3313109|36|CP026613|PILER-CR matches to LN681537 (Clostridium phage phiCD211, complete genome) position: , mismatch: 3, identity: 0.917

ctgtcagtagaagctatttttgaaggtattttatgc	CRISPR spacer
ctgtcaatagaagctgtttttgaaggtattttatgt	Protospacer
******.********.*******************.

377. spacer 15.57|3313832|38|CP026613|PILER-CR matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
 ****************.****************** *

378. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NC_048665 (Clostridium phage phiCDHM14, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
 ****************.**************.*****

379. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
 ****************.****************** *

380. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
 ****************.****************** *

381. spacer 15.57|3313832|38|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
 ****************.****************** *

382. spacer 15.57|3313832|38|CP026613|PILER-CR matches to HG796225 (Clostridium phage phiCDHM13 complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
 ****************.**************.*****

383. spacer 15.57|3313832|38|CP026613|PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaaaatgag	Protospacer
 ****************.****************** *

384. spacer 15.57|3313832|38|CP026613|PILER-CR matches to HG798901 (Clostridium phage phiCDHM11 complete genome) position: , mismatch: 3, identity: 0.921

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaagatgcg	Protospacer
 ****************.**************.*****

385. spacer 15.58|3313898|37|CP026613|PILER-CR matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.919

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttggtactaaaaaagtagaaacaatttt	Protospacer
.************ ******************.****

386. spacer 15.58|3313898|37|CP026613|PILER-CR matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 3, identity: 0.919

cggaattacttgggactaaaaaagtagaaacagtttt	CRISPR spacer
tggaattacttgagactaaaaaagtagaaacaatttt	Protospacer
.***********.*******************.****

387. spacer 15.59|3313963|35|CP026613|PILER-CR matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 3, identity: 0.914

catgctacagcagaaaaagttgtaagtataagcaa	CRISPR spacer
aatgctacagcagaaaaaaatgtaagtataagcaa	Protospacer
 *****************. ***************

388. spacer 15.62|3314157|37|CP026613|PILER-CR matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 3, identity: 0.919

ctatatcaaagctggaaaatcaagagtacaaagatat	CRISPR spacer
atatatcaaaactagaaaatcaagagtacaaagatat	Protospacer
 *********.**.***********************

389. spacer 15.62|3314157|37|CP026613|PILER-CR matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 3, identity: 0.919

ctatatcaaagctggaaaatcaagagtacaaagatat	CRISPR spacer
atatatcaaaactagaaaatcaagagtacaaagatat	Protospacer
 *********.**.***********************

390. spacer 16.13|3638387|29|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 3, identity: 0.897

gacctgtagaacctgttactccatttgct	CRISPR spacer
gtcctgtagaacctgttgctccagttgct	Protospacer
* ***************.***** *****

391. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.897

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttggc	Protospacer
*************.******** *****

392. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.897

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttggc	Protospacer
*************.******** *****

393. spacer 16.19|3638693|29|CP026613|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 3, identity: 0.897

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctcccgttgct	Protospacer
********************** ****

394. spacer 16.19|3638693|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.897

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ccccggttgctcccgttgctccggttggt	Protospacer
*.** ***********************

395. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggtcctgttggacctgttgccccaat	Protospacer
** *********.************.*

396. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctgttggacctgt	Protospacer
**  *****************.*****

397. spacer 17.6|3755351|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 3, identity: 0.889

atttcctgttgctcctgttggacctgt	CRISPR spacer
cgttcctgtttctcctgttggacctgt	Protospacer
  ******** ****************

398. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.889

atttcctgttgctcctgttggacctgt	CRISPR spacer
aattccagttcctcctgttggacctgt	Protospacer
* **** *** ****************

399. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

atttcctgttgctcctgttggacctgt	CRISPR spacer
aattccagttcctcctgttggacctgt	Protospacer
* **** *** ****************

400. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 3, identity: 0.889

atttcctgttgctcctgttggacctgt	CRISPR spacer
aattccagttcctcctgttggacctgt	Protospacer
* **** *** ****************

401. spacer 17.13|3755699|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 3, identity: 0.889

tggacctgttgggcctgttactccatc	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 ** ***************.*******

402. spacer 17.13|3755699|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 3, identity: 0.889

tggacctgttgggcctgttactccatc	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 ** ***************.*******

403. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 4, identity: 0.892

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
cttaaacttgaactatttcaaaaagccaaacatcaag	Protospacer
.* *********.*************.**********

404. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 4, identity: 0.892

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttgaggcttgaattatttcagaaagctaaacatcaag	Protospacer
**.*..**************.****************

405. spacer 8.9|1746438|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LN681538 (Clostridium phage phiCD481-1, complete genome) position: , mismatch: 4, identity: 0.892

ttaaaacttgaattatttcaaaaagctaaacatcaag	CRISPR spacer
ttgaggcttgaattatttcagaaagctaaacatcaag	Protospacer
**.*..**************.****************

406. spacer 8.10|1746504|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 4, identity: 0.892

tttaattgcccttcatagaatattatttcaccttctt	CRISPR spacer
ttcgattgtccttcatagaatattatttcgccttctt	Protospacer
**..****.********************.*******

407. spacer 15.57|3313832|38|CP026613|PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 4, identity: 0.895

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaagatgag	Protospacer
 ****************.**************.*** *

408. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NC_028838 (Clostridium phage phiCD506, complete genome) position: , mismatch: 4, identity: 0.895

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
atagaagatagaagaagtaatataaaagcaaagatgag	Protospacer
 ****************.**************.*** *

409. spacer 16.15|3638495|29|CP026613|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 4, identity: 0.862

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cacctgttgctcctgttgctcccatatta	Protospacer
 ************ *********.****

410. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttgct	Protospacer
*************.******** ****

411. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

412. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttgct	Protospacer
*************.******** ****

413. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

414. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

415. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

416. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

417. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttgct	Protospacer
*************.******** ****

418. spacer 16.19|3638693|29|CP026613|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgcttccgttgctccgattgct	Protospacer
***********.***********.***

419. spacer 16.19|3638693|29|CP026613|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctccggttgctcccgttgctccgattgct	Protospacer
**** ******************.***

420. spacer 16.19|3638693|29|CP026613|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cttccgttgctcccgttgctcccgttgct	Protospacer
**.******************* ****

421. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctccggtcacc	Protospacer
*************************..

422. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

423. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgcacccgttgctccgattgct	Protospacer
********** ************.***

424. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgggccggttgct	Protospacer
******************  *******

425. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

426. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttgct	Protospacer
*************.******** ****

427. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
****.***************** ****

428. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcctgttgct	Protospacer
*************.******** ****

429. spacer 16.19|3638693|29|CP026613|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctcctatagaa	Protospacer
********************** .* *.*

430. spacer 16.19|3638693|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctccagttgctccggttgctccggttgcc	Protospacer
**** ******** *************

431. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttgctcccgttgctcccgttgtt	Protospacer
 ********************* ****

432. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 4, identity: 0.862

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttgctcccgttgctcccgttgtt	Protospacer
 ********************* ****

433. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tggtcctgttggacctgttgccccaat	Protospacer
** *********.************ .

434. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tggtcctgttggtcctgttgccccagt	Protospacer
** ********* ************ .

435. spacer 17.3|3755216|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tggtcctgttggacctgttgccccagt	Protospacer
** *********.************ .

436. spacer 17.3|3755216|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tggtcctgttggtcctgttgccccagt	Protospacer
** ********* ************ .

437. spacer 17.3|3755216|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 * .*****************.*****

438. spacer 17.3|3755216|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 * .*****************.*****

439. spacer 17.3|3755216|27|CP026613|CRT matches to MN694423 (Marine virus AFVG_250M1001, complete genome) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tgcccctgttgggccagttgccccagt	Protospacer
***.*********** ********* .

440. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gggtcctgttgggcctgttgggccagt	Protospacer
 * *****************  *****

441. spacer 17.4|3755261|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gggtcctgttgggccagttggcccagt	Protospacer
 * ************ **** ******

442. spacer 17.4|3755261|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gggtcctgttgggccagttggcccagt	Protospacer
 * ************ **** ******

443. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tattcctgttgggcctgttgctcctgt	Protospacer
*..******************.** **

444. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tattcctgttgggccggttggcccagt	Protospacer
*..************ **** ******

445. spacer 17.4|3755261|27|CP026613|CRT matches to JQ015307 (Pectobacterium phage phiTE, complete genome) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggacctgctgggcctgttgcaccagt	Protospacer
**  ****.************ *****

446. spacer 17.4|3755261|27|CP026613|CRT matches to KY514263 (Pectobacterium phage vB_PatM_CB7, complete genome) position: , mismatch: 4, identity: 0.852

tgctcctgttgggcctgttgccccagt	CRISPR spacer
tggacctgctgggcctgttgcaccagt	Protospacer
**  ****.************ *****

447. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgcccctgttggtcctgttgggccacc	Protospacer
************ ***********  .

448. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtcctgttggacctgttggacctgt	Protospacer
 * .*****************.*****

449. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctgttggaccggt	Protospacer
**  *****************.** **

450. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
agcccctgtaggacctgttgggcctcc	Protospacer
 ******** *************** .

451. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gggacctgttggacctgttggacctgt	Protospacer
 *  *****************.*****

452. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gggccctgttggcccggttgggcctgt	Protospacer
 * ********* ** ***********

453. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
cggtcctgttggaccagttgggcctgt	Protospacer
.* .*********** ***********

454. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggacctgttgaacctgt	Protospacer
** .****************..*****

455. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

456. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

457. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

458. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

459. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

460. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

461. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

462. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

463. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

464. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

465. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttgaacctgttggtcctgt	Protospacer
**  *******.********* *****

466. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
**  ******** ******** *****

467. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttgaacctgttggtcctgt	Protospacer
** .*******.********* *****

468. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
**  ******** ******** *****

469. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

470. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

471. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

472. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttgaacctgttggtcctgt	Protospacer
** .*******.********* *****

473. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
**  ******** ******** *****

474. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

475. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

476. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

477. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttgaacctgttggtcctgt	Protospacer
**  *******.********* *****

478. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttgaacctgttggtcctgt	Protospacer
** .*******.********* *****

479. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
**  ******** ******** *****

480. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

481. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

482. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

483. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

484. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

485. spacer 17.5|3755306|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggccctgttggtcctgt	Protospacer
** .******** ******** *****

486. spacer 17.5|3755306|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggccctgttggtcctgt	Protospacer
** .******** ******** *****

487. spacer 17.5|3755306|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggccctgttggtcctgt	Protospacer
** .******** ******** *****

488. spacer 17.5|3755306|27|CP026613|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggaccggttgggcctgttgggcctgt	Protospacer
**  ** *****.**************

489. spacer 17.5|3755306|27|CP026613|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggaccggttggaccggttgggcctgt	Protospacer
**  ** ******** ***********

490. spacer 17.5|3755306|27|CP026613|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
ttctcccgttggaccggttgggcctgt	Protospacer
* *.**.******** ***********

491. spacer 17.5|3755306|27|CP026613|CRT matches to MN693183 (Marine virus AFVG_25M360, complete genome) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggccctgttgggcctgttgggccttg	Protospacer
** *********.************

492. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctgttggacctgc	Protospacer
**  *****************.****.

493. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgctggacctgttggacctgt	Protospacer
**  ****.************.*****

494. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgggcttgttgggcctgttgggcctgt	Protospacer
**  *.******.**************

495. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tcctcctgttggacctgtggggccagt	Protospacer
* *.************** ***** **

496. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tcctcctgttggacctgtggggccagt	Protospacer
* *.************** ***** **

497. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

498. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tcctcctgttggacctgtggggccagt	Protospacer
* *.************** ***** **

499. spacer 17.5|3755306|27|CP026613|CRT matches to MT375529 (Pelagibacter phage Kolga EXVC01, complete genome) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tgggcctgttgcacctgttgggcctat	Protospacer
**  ******* *************.*

500. spacer 17.5|3755306|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggacctgt	Protospacer
** .******** ********.*****

501. spacer 17.5|3755306|27|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 4, identity: 0.852

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
** .******** ******** *****

502. spacer 17.6|3755351|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggacctgt	Protospacer
   ******** ***************

503. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
gattcctgttggtcctgttggtcctgt	Protospacer
. ********* ********* *****

504. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP011156 (Bacillus cereus strain HN001 plasmid pRML01, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctcctgttggaccagt	Protospacer
*   ******************** **

505. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggtcctgttgctcctgttgctcctgt	Protospacer
*  *****************  *****

506. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
agctcctgttggtcctgttggtcctgt	Protospacer
* .******** ********* *****

507. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggtcctgttggtcctgttggacccgt	Protospacer
*  ******** ************.**

508. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggtcctgttggtcctgttggtcctgt	Protospacer
*  ******** ********* *****

509. spacer 17.6|3755351|27|CP026613|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
agctcctgttgctcctgctggccctgt	Protospacer
* .**************.*** *****

510. spacer 17.6|3755351|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggtcctgttggacctgttggacctgt	Protospacer
*  ********  **************

511. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
agctcctgttgctcctgctggccctgt	Protospacer
* .**************.*** *****

512. spacer 17.6|3755351|27|CP026613|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
agctcctgttgctcctgctggccctgt	Protospacer
* .**************.*** *****

513. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

atttcctgttgctcctgttggacctgt	CRISPR spacer
ttctcctgttgctcctgttgctcctgt	Protospacer
 *.*****************  *****

514. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctgttgggcctgttactccatc	CRISPR spacer
tggacctgttggtcctgttactcccga	Protospacer
************ ***********

515. spacer 5.1|865326|25|CP026613|PILER-CR matches to NZ_CP040675 (Exiguobacterium mexicanum strain A-EM plasmid punnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

aaatagtgaatttggattggcaaga	CRISPR spacer
aaatagtgaatttagattggctcac	Protospacer
*************.*******  .

516. spacer 8.17|1746968|36|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 5, identity: 0.861

aaagaaaattgggtttttgattaagaacttgcgaat	CRISPR spacer
aagggcaattgggtttttgatgaagaacttgctaat	Protospacer
**.*. *************** ********** ***

517. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 5, identity: 0.861

aatcattccttttgtttcatctttaagttttacgac	CRISPR spacer
aatcattccttttgtttcatcttttaattttatagc	Protospacer
************************ *.*****...*

518. spacer 9.42|2201030|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 5, identity: 0.865

tctatgacctattggtgctaatccaagaccttctcca	CRISPR spacer
tttgtgtccaattggtgctaatccaagaccttctcct	Protospacer
*.*.** ** **************************

519. spacer 15.18|3313370|39|CP026613|CRISPRCasFinder,CRT matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.872

tataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
tatatgacttttcttctgatttagttttaaattgctttt	Protospacer
**** **************************.**..*.*

520. spacer 15.18|3313370|39|CP026613|CRISPRCasFinder,CRT matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 5, identity: 0.872

tataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
tatatgacttttcttctgatttagttttaaattgctttt	Protospacer
**** **************************.**..*.*

521. spacer 15.18|3313370|39|CP026613|CRISPRCasFinder,CRT matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.872

tataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
tatatgacttttcttctgatttagttttaaattgctttt	Protospacer
**** **************************.**..*.*

522. spacer 16.15|3638495|29|CP026613|CRT matches to MH617115 (Siphoviridae sp. isolate ctjh_2, complete genome) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cacctgttgcgccggttgatcccgtatcg	Protospacer
 ********* ******* ********.

523. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ggcctgttgctcctgttgctcccgtcgat	Protospacer
*.*********** ***********   *

524. spacer 16.15|3638495|29|CP026613|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
tacctgttgctccagttgctccagtaata	Protospacer
 ************.******** *** *

525. spacer 16.15|3638495|29|CP026613|CRT matches to MN693279 (Marine virus AFVG_25M346, complete genome) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gacctgttgctccagtagctcccgttgct	Protospacer
*************.** ********  .*

526. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

527. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

528. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

529. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

530. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

531. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttatt	Protospacer
* ******.********* ******  **

532. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcccgttgctcccgttgctcccgttgtt	Protospacer
* **.******** ***********  **

533. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 5, identity: 0.828

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcccgttgctcccgttgctcccgttgtt	Protospacer
* **.******** ***********  **

534. spacer 16.19|3638693|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cccctgttgctcccgttgctcccgttgct	Protospacer
*.**.***************** ****

535. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cccctgttgctcccgttgctcccgttgct	Protospacer
*.**.***************** ****

536. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ttcctgttgctcccgttgctccggttact	Protospacer
.***.*********************.

537. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgcacccgttgctccggttact	Protospacer
****.***** ***************.

538. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcccgttgctccttttaat	Protospacer
**********************  **..

539. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctccggctgctcccgttgctccggttact	Protospacer
**** *.*******************.

540. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgtttctcccgttgctccggttact	Protospacer
****.*** *****************.

541. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ttcccgtcgctcccgttgctcctgtttca	Protospacer
.******.************** ***  *

542. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

543. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ttccggttggtcccgttgctccggttgac	Protospacer
.*** **** *****************.

544. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

545. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

546. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ttccggttggtcccgttgctccggttgac	Protospacer
.*** **** *****************.

547. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

548. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

549. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttactccggttagt	Protospacer
 ******** *******.********.*

550. spacer 16.19|3638693|29|CP026613|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 5, identity: 0.828

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cgccggttgctcccgttgcgccggttgct	Protospacer
* ** ************** *******

551. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tgctcctgttgggcccgttgctcctgt	Protospacer
***************.*****.**  .

552. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tgctcctgttgggcccgttgctcctgt	Protospacer
***************.*****.**  .

553. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP021407 (Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccatc	CRISPR spacer
cgatcctgtttggcctgttgcccctgc	Protospacer
.* ******* *************  *

554. spacer 17.4|3755261|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccagt	CRISPR spacer
aggtcctgttgggcctgttgggccaga	Protospacer
 * *****************  ****

555. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP021407 (Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccagt	CRISPR spacer
cgatcctgtttggcctgttgcccctgc	Protospacer
.* ******* ************* *.

556. spacer 17.4|3755261|27|CP026613|CRT matches to MN693770 (Marine virus AFVG_250M115, complete genome) position: , mismatch: 5, identity: 0.815

tgctcctgttgggcctgttgccccagt	CRISPR spacer
aggccctgttggccctgttgacccagt	Protospacer
 * .******** ******* ******

557. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtcctgttggccctgttggtcctgt	Protospacer
 * .******** ******** *****

558. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtcctgttgggcctgttggtcctgt	Protospacer
 * .********.******** *****

559. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gggacctgttggacctgttggacctgg	Protospacer
 *  *****************.****

560. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gggtcctgttgggcctgttgggccagt	Protospacer
 * .********.*********** **

561. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
cgggcctgttggacctgttgagccagt	Protospacer
.*  ****************.*** **

562. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gggtccagttggaccagttgggcctgt	Protospacer
 * .** ******** ***********

563. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtcctgttggtcctgttggtcctgt	Protospacer
 * .******** ******** *****

564. spacer 17.5|3755306|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tagtcctgttggtcctgttggtcctgt	Protospacer
*. .******** ******** *****

565. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gaatcctgttggtcctgttgggcctgt	Protospacer
 . .******** **************

566. spacer 17.5|3755306|27|CP026613|CRT matches to MN693556 (Marine virus AFVG_25M429, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggccctgttggacctgttgggccgac	Protospacer
 * ********************* ..

567. spacer 17.5|3755306|27|CP026613|CRT matches to MN693156 (Marine virus AFVG_25M428, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggccctgttggacctgttgggccgac	Protospacer
 * ********************* ..

568. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_KU950310 (Pseudomonas syringae pv. actinidiae strain SR198 plasmid pMG2_SR198, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tcttcctgttgcacctgttgtgcctgt	Protospacer
* ..******* ******** ******

569. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_KX009059 (Pseudomonas syringae pv. actinidiae strain RT685 plasmid pMG1_RT685, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tcttcctgttgcacctgttgtgcctgt	Protospacer
* ..******* ******** ******

570. spacer 17.5|3755306|27|CP026613|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctggtgggcctcc	Protospacer
**  ************* ******* .

571. spacer 17.5|3755306|27|CP026613|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctggtgggcctcc	Protospacer
**  ************* ******* .

572. spacer 17.5|3755306|27|CP026613|CRT matches to MN694558 (Marine virus AFVG_250M9, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
agaacctgttggccctgtagggcctgt	Protospacer
 *  ******** ***** ********

573. spacer 17.5|3755306|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtccagtaggacctgttgggcctgt	Protospacer
 * .** ** *****************

574. spacer 17.5|3755306|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
aggtccagtaggacctgttgggcctgt	Protospacer
 * .** ** *****************

575. spacer 17.5|3755306|27|CP026613|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctggtgggcctcc	Protospacer
**  ************* ******* .

576. spacer 17.5|3755306|27|CP026613|CRT matches to MN694640 (Marine virus AFVG_250M10, complete genome) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
agaacctgttggccctgtagggcctgt	Protospacer
 *  ******** ***** ********

577. spacer 17.5|3755306|27|CP026613|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 5, identity: 0.815

tgcccctgttggacctgttgggcctgt	CRISPR spacer
tggacctgttggacctggtgggcctcc	Protospacer
**  ************* ******* .

578. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

579. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttggtcctgttggacctgt	Protospacer
   .******* ***************

580. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgt	Protospacer
    ***********.***********

581. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tactcccgttgctcctgttagacctgt	Protospacer
  .***.************.*******

582. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
gggtcctgttgctcctgtgggtcctgt	Protospacer
.  *************** ** *****

583. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

584. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttgctcctgttgcccctgt	Protospacer
   *****************  *****

585. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
gggtcctgttggtcctgttggaccagt	Protospacer
.  ******** ************ **

586. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

587. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

588. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

589. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

590. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

591. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

592. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

593. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

594. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

595. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

596. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttgaacctgt	Protospacer
   ******** ********.******

597. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttgaacctgt	Protospacer
   ******** ********.******

598. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

599. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

600. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

601. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggacccgt	Protospacer
   ******** ************.**

602. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttgaacctgt	Protospacer
   ******** ********.******

603. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

604. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tagtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

605. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

606. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

607. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttgaacctgt	Protospacer
   ******** ********.******

608. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

609. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

610. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

611. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

612. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

613. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgtccctgttggtcctgttggtcctgt	Protospacer
  *.******* ********* *****

614. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttggccccgt	Protospacer
  .****************** **.**

615. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
cactcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

616. spacer 17.6|3755351|27|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggtcctgt	Protospacer
   ******** ********* *****

617. spacer 17.6|3755351|27|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
cactcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

618. spacer 17.6|3755351|27|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttggccccgt	Protospacer
  .****************** **.**

619. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttgctcctggtggtcctgt	Protospacer
   ************** *** *****

620. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaatcctgttggtcctgttgggcctgt	Protospacer
.  ******** *********.*****

621. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

622. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

623. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

624. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

625. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

626. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

627. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

628. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

629. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

630. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

631. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

632. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

633. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

634. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

635. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

636. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

637. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tactcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

638. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

639. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

640. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

641. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

642. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

643. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

644. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

645. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

646. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

647. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgt	Protospacer
  .*****************  *****

648. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
ttctcctgttgctcctgttgctcctgc	Protospacer
 *.*****************  ****.

649. spacer 17.6|3755351|27|CP026613|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
gcctcctgttgctcctgttgctcctgt	Protospacer
...*****************  *****

650. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

651. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

652. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

653. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

654. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

655. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

656. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

657. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

658. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

659. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

660. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

661. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

662. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

663. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

664. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

665. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

666. spacer 17.6|3755351|27|CP026613|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgtcgctcctgtaggacctgt	Protospacer
*   *****.******** ********

667. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

668. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

669. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

670. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

671. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

672. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

673. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

674. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

675. spacer 17.6|3755351|27|CP026613|CRT matches to LT598654 (Phage NCTB genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgtttctcctgtaggacctgt	Protospacer
*   ****** ******* ********

676. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

677. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

678. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

679. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

680. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

681. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

682. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

683. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

684. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

685. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

686. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

687. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

688. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

689. spacer 17.6|3755351|27|CP026613|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
tatacctgttgctcccgttggaccggt	Protospacer
  * ***********.******** **

690. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

691. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

692. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

693. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

694. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

695. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

696. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

697. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

698. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

699. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

700. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

701. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

702. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

703. spacer 17.6|3755351|27|CP026613|CRT matches to NC_022111 (Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
cttatctgttgcttctgttggacctgc	Protospacer
 ** .********.************.

704. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

705. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

706. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccagtaggacctgt	Protospacer
*   *********** ** ********

707. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

708. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

709. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

710. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agggcctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

711. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
aggacctgttgctccggtaggacctgt	Protospacer
*   *********** ** ********

712. spacer 17.6|3755351|27|CP026613|CRT matches to AP014445 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C39-MedDCM-OCT-S35-C62, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
ttcttctgttgctcctgttgcacctgg	Protospacer
 *.*.*************** *****

713. spacer 17.6|3755351|27|CP026613|CRT matches to MN693279 (Marine virus AFVG_25M346, complete genome) position: , mismatch: 5, identity: 0.815

atttcctgttgctcctgttggacctgt	CRISPR spacer
agctcccgttgctcctgttggaccagc	Protospacer
* .***.***************** *.

714. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.861

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgcaccagc	Protospacer
  .************************** *** **

715. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.861

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
aggtcctgttgctcctgttgctcctgttgctcctgt	Protospacer
*  **************************  ****.

716. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.861

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgc	Protospacer
  .**************************  *****

717. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.861

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
ttctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
 *.**************************  ****.

718. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
tggacctgttggtcccgttactcccga	Protospacer
************ **.********

719. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
tggacctgttggtcccgttactcccga	Protospacer
************ **.********

720. spacer 17.13|3755699|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
aggacctgttgggcctgttgcgccttg	Protospacer
 ******************.* ** *

721. spacer 17.13|3755699|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
aggacctgttgggcctgttgcgccttg	Protospacer
 ******************.* ** *

722. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
tggaccagttgggcctgttcctcctgt	Protospacer
****** ************ ****  .

723. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctgttgggcctgttactccatc	CRISPR spacer
tggacctgctgggcctgctactcctgg	Protospacer
********.********.******

724. spacer 2.1|150198|29|CP026613|CRISPRCasFinder matches to KY971610 (Pseudomonas phage PspYZU05, complete genome) position: , mismatch: 6, identity: 0.793

tgtaataagttaaagcaatatgaatcaac	CRISPR spacer
tacgataagttacagcaatacgaatcatc	Protospacer
*...******** *******.****** *

725. spacer 5.3|865325|30|CP026613|CRISPRCasFinder matches to NZ_CP040675 (Exiguobacterium mexicanum strain A-EM plasmid punnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaatagtgaatttggattggc-----aagagtga	CRISPR spacer
gaaatagtgaatttagattggctcactaag-----	Protospacer
**************.*******     ***

726. spacer 9.31|2200305|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 6, identity: 0.838

aaatccctgcaactgtagttggttggggttataatga	CRISPR spacer
aaatccctgcaactgtgcttggttggggttatggttc	Protospacer
****************. **************..*

727. spacer 15.9|3312784|36|CP026613|CRISPRCasFinder,CRT matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 6, identity: 0.833

actacaataatagtgccttttagcaaaatttactag	CRISPR spacer
actacaataatagtaccttttaacaaaatttgcctc	Protospacer
**************.*******.********.*.

728. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.838

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
* ** . ************************.*** *

729. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 6, identity: 0.838

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
* ** . ************************.*** *

730. spacer 15.25|3313832|37|CP026613|CRISPRCasFinder,CRT matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.838

tagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
tcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
* ** . ************************.*** *

731. spacer 15.50|3313370|40|CP026613|PILER-CR matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.85

ctataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
ttatatgacttttcttctgatttagttttaaattgctttt	Protospacer
.**** **************************.**..*.*

732. spacer 15.50|3313370|40|CP026613|PILER-CR matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 6, identity: 0.85

ctataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
ttatatgacttttcttctgatttagttttaaattgctttt	Protospacer
.**** **************************.**..*.*

733. spacer 15.50|3313370|40|CP026613|PILER-CR matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.85

ctataagacttttcttctgatttagttttaaactgtctct	CRISPR spacer
ttatatgacttttcttctgatttagttttaaattgctttt	Protospacer
.**** **************************.**..*.*

734. spacer 16.11|3638261|29|CP026613|CRT matches to MH920640 (Synechoccus phage S-E7, complete genome) position: , mismatch: 6, identity: 0.793

gacctacctctccatctgctccagttgga	CRISPR spacer
gtgcaacctctccctctgctctagttggg	Protospacer
*  * ******** *******.******.

735. spacer 16.11|3638261|29|CP026613|CRT matches to MH920639 (Synechoccus phage S-P4, partial genome) position: , mismatch: 6, identity: 0.793

gacctacctctccatctgctccagttgga	CRISPR spacer
gtgcaacctctccctctgctctagttggg	Protospacer
*  * ******** *******.******.

736. spacer 16.11|3638261|29|CP026613|CRT matches to HQ634189 (Cyanophage Syn30 genomic sequence) position: , mismatch: 6, identity: 0.793

gacctacctctccatctgctccagttgga	CRISPR spacer
gtgcaacctctccctctgctctagttggg	Protospacer
*  * ******** *******.******.

737. spacer 16.13|3638387|29|CP026613|CRT matches to MN693469 (Marine virus AFVG_25M404, complete genome) position: , mismatch: 6, identity: 0.793

gacctgtagaacctgttactccatttgct	CRISPR spacer
aagctgtagaacctgttactacatatgaa	Protospacer
.* ***************** *** **

738. spacer 16.13|3638387|29|CP026613|CRT matches to MN103543 (Pseudomonas phage vB_PaeM_PS119XW, complete genome) position: , mismatch: 6, identity: 0.793

gacctgtagaacctgttactccatttgct	CRISPR spacer
aaccggtagaacctgttactcctgttatt	Protospacer
.*** *****************  **..*

739. spacer 16.13|3638387|29|CP026613|CRT matches to MK599315 (Pseudomonas phage PA1C, complete genome) position: , mismatch: 6, identity: 0.793

gacctgtagaacctgttactccatttgct	CRISPR spacer
aaccggtagaacctgttactcctgttatt	Protospacer
.*** *****************  **..*

740. spacer 16.15|3638495|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgccccggttgctcccgttgct	Protospacer
  ********.**************  .*

741. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gacctgttgctcccgtttctcccgttgga	Protospacer
************* *** *******

742. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gacctgttgctcccgtttctcccgttgga	Protospacer
************* *** *******

743. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

744. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

745. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

746. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

747. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

748. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

749. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

750. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

751. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccctgttgctcccgttgctcccgttgct	Protospacer
  *********** ***********  .*

752. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccctgttgctcccgttgctcccgttgct	Protospacer
  *********** ***********  .*

753. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

754. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

755. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

756. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttact	Protospacer
  *********** ***********  .*

757. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gacctgttgctcccgtttctcccgttgga	Protospacer
************* *** *******

758. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttgct	Protospacer
  *********** ***********  .*

759. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccctgttgctccggttgctcccattgct	Protospacer
  *********************.*  .*

760. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttgct	Protospacer
  *********** ***********  .*

761. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgttgct	Protospacer
  *********** ***********  .*

762. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
tacctgttgctccggtcgctccggttgct	Protospacer
 ***************.***** **  .*

763. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gccctgttgctcctgttgctcctgttgct	Protospacer
* *********** ********.**  .*

764. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gccctgttgctcctgttgctcctgttgct	Protospacer
* *********** ********.**  .*

765. spacer 16.15|3638495|29|CP026613|CRT matches to MN855854 (Siphoviridae sp. isolate 269, complete genome) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cacctgttgctccggtggctcctgtgatg	Protospacer
 *************** *****.**. *

766. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

767. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

768. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

769. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttgctcctgttgctcctgttgct	Protospacer
* *********** ********.**  .*

770. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

771. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

772. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

773. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

774. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

775. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

776. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

777. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

778. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

779. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

780. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

781. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

782. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

783. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

784. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

785. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.793

gacctgttgctccggttgctcccgtattt	CRISPR spacer
gtcctgttactccggttggtcccgttact	Protospacer
* ******.********* ******  .*

786. spacer 16.17|3638594|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

ttccatttgctcccgttgctcctttgttt	CRISPR spacer
ctcccgttgctcccgttgctccttttaat	Protospacer
.***  *******************   *

787. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcccgttgctcctgttgctcccattact	Protospacer
*************.******** .**.

788. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
aacctgttgctcccgttggtccggttaca	Protospacer
  **.************* *******. *

789. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cacccgttgcacccgttgcaccggtcgcg	Protospacer
* ******** ******** *****.* .

790. spacer 17.3|3755216|27|CP026613|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccatc	CRISPR spacer
tattcctgttgggcctgttgctcctgt	Protospacer
*..******************.**  .

791. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP023318 (Bacillus megaterium strain A plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

792. spacer 17.4|3755261|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 * .*****************.*** .

793. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

794. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

795. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

796. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

797. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

798. spacer 17.4|3755261|27|CP026613|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
gttccctgtagggcctgtggccccagt	Protospacer
  ..***** ******** ********

799. spacer 17.4|3755261|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 6, identity: 0.778

tgctcctgttgggcctgttgccccagt	CRISPR spacer
aggccctgttgggcctgttgctccatc	Protospacer
 * .*****************.*** .

800. spacer 17.5|3755306|27|CP026613|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

tgcccctgttggacctgttgggcctgt	CRISPR spacer
cggtcctgtaggacctgttgggccttg	Protospacer
.* .***** ***************

801. spacer 17.5|3755306|27|CP026613|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 6, identity: 0.778

tgcccctgttggacctgttgggcctgt	CRISPR spacer
gattcctgttggtcctgttggtcctgt	Protospacer
 ...******** ******** *****

802. spacer 17.5|3755306|27|CP026613|CRT matches to MN856005 (Myoviridae sp. isolate 302, complete genome) position: , mismatch: 6, identity: 0.778

tgcccctgttggacctgttgggcctgt	CRISPR spacer
ctcttttgttggacctgttgggactgt	Protospacer
. *...**************** ****

803. spacer 17.5|3755306|27|CP026613|CRT matches to MH629685 (Synechococcus virus S-PRM1, complete genome) position: , mismatch: 6, identity: 0.778

tgcccctgttggacctgttgggcctgt	CRISPR spacer
ctgaccttttggaccagttgggcctgt	Protospacer
.   *** ******* ***********

804. spacer 17.6|3755351|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttggtcctgttggccctgt	Protospacer
   .******* ********* *****

805. spacer 17.6|3755351|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttggtcctgttggccctgt	Protospacer
   .******* ********* *****

806. spacer 17.6|3755351|27|CP026613|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttggtcctgttggccctgt	Protospacer
   .******* ********* *****

807. spacer 17.6|3755351|27|CP026613|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cggtcctgttggtcctgttggccctgc	Protospacer
   ******** ********* ****.

808. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

809. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

810. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

811. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

812. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

813. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

814. spacer 17.6|3755351|27|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcccgttggacctgg	Protospacer
    ***********.**********

815. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgcaccagc	Protospacer
  .***************** *** *.

816. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttggacctgttggacctgt	Protospacer
    *******  **************

817. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gggacctgttggacctgttggacctgt	Protospacer
.   *******  **************

818. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgtaggacctgc	Protospacer
   ******** ****** *******.

819. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
    ******* ********* *****

820. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
    ******* ********* *****

821. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
    ******* ********* *****

822. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgaacctgttggtcctgttgaacctgt	Protospacer
    ******* ********.******

823. spacer 17.6|3755351|27|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgaacctgttggtcctgttggtcctgt	Protospacer
    ******* ********* *****

824. spacer 17.6|3755351|27|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttggtcctgttggaccact	Protospacer
   ******** ************  *

825. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cagacctgttgctcccgttggacctat	Protospacer
    ***********.*********.*

826. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cagacctgttgctcccgttggacctat	Protospacer
    ***********.*********.*

827. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cgaacctgttgctcccgttggacctat	Protospacer
    ***********.*********.*

828. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cagacctgttgctcccgttggacctat	Protospacer
    ***********.*********.*

829. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cagacctgttgctcccgttggacctat	Protospacer
    ***********.*********.*

830. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttgctcctgttgctcctgt	Protospacer
   .****************  *****

831. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggccctgttgctcctgttgctcctgt	Protospacer
   .****************  *****

832. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgctcctgttgctcctgttgctcctgc	Protospacer
  .*****************  ****.

833. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

834. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

835. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

836. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

837. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

838. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

839. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

840. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

841. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccggtaggacctgt	Protospacer
.   *********** ** ********

842. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccggtaggacctgt	Protospacer
.   *********** ** ********

843. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

844. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

845. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccggtaggacctgt	Protospacer
.   *********** ** ********

846. spacer 17.6|3755351|27|CP026613|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccggtaggacctgt	Protospacer
.   *********** ** ********

847. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
gaaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

848. spacer 17.6|3755351|27|CP026613|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
ggaacctgttgctccagtaggacctgt	Protospacer
.   *********** ** ********

849. spacer 17.6|3755351|27|CP026613|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
cggtcctgttggtcctgttggtcctgc	Protospacer
   ******** ********* ****.

850. spacer 17.6|3755351|27|CP026613|CRT matches to AP013524 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tgcgcctgctgctcctgttgcacctgt	Protospacer
  . ****.*********** ******

851. spacer 17.6|3755351|27|CP026613|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 6, identity: 0.778

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggtcctgttgctccagttggtcctgg	Protospacer
   ************ ***** ****

852. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

853. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

854. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

855. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

856. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

857. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

858. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

859. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

860. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

861. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

862. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

863. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

864. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

865. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

866. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tactcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

867. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

868. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

869. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

870. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

871. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

872. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

873. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

874. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctgt	Protospacer
  .**************************  ****.

875. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctcc	Protospacer
  .**************************  *** *

876. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcctcc	Protospacer
  .**************************  *** *

877. spacer 17.7|3755396|36|CP026613|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 6, identity: 0.833

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
agctcctgttgctcctgttgctccttttgcaccaac	Protospacer
* .********************** *** *** .*

878. spacer 17.10|3755564|27|CP026613|CRT matches to NC_041884 (Acinetobacter phage vB_AbaM_ME3, complete genome) position: , mismatch: 6, identity: 0.778

tgggcctgttactccatctgctccagt	CRISPR spacer
tattattggtactccatctgctccagt	Protospacer
*.   .** ******************

879. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctgttgggcctgttactccatc	CRISPR spacer
aggacctgttggtcctgttacaccgat	Protospacer
 *********** ******** **. .

880. spacer 17.13|3755699|27|CP026613|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctgttgggcctgttactccatc	CRISPR spacer
gggtcctgttgggcctgttacacctat	Protospacer
 ** ***************** **  .

881. spacer 17.14|3755744|27|CP026613|CRT matches to NC_049930 (Enterococcus phage vB_EfaP_Zip, complete genome) position: , mismatch: 6, identity: 0.778

tactcctgttggacctattaaccctgt	CRISPR spacer
tactcctgttggaactattaaaagagc	Protospacer
************* *******    *.

882. spacer 4.1|864995|30|CP026613|CRISPRCasFinder matches to NZ_CP015323 (Bacillus filamentosus strain Hbe603 plasmid pBEH1, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaaaatggattgaatttaatatacataa	CRISPR spacer
taaaaaatagattgaatttaatgtctaaac	Protospacer
 *******.*************.* .* *

883. spacer 4.1|864995|30|CP026613|CRISPRCasFinder matches to NC_025171 (Acinetobacter sp. M131 plasmid pM131-5, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaaaatggattgaatttaatatacataa	CRISPR spacer
gaaaaaatagagtgaatttaataaaaaatg	Protospacer
********.** *********** * *  .

884. spacer 4.2|865061|30|CP026613|CRISPRCasFinder matches to NC_015426 (Clostridium botulinum BKT015925 plasmid p2BKT015925, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaattgcaatgcaataaaatgtgttc	CRISPR spacer
ctactaattgtaatgcaataaaatgtgtta	Protospacer
     *****.******************

885. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043618 (Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.811

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
aaagtttttatatattcatatatttcacttttatttg	Protospacer
*.  ***.********** ***************.*

886. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043618 (Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.811

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
aaagtttttatatattcatatatttcacttttatttg	Protospacer
*.  ***.********** ***************.*

887. spacer 9.3|2198457|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013206 (Paenibacillus sp. IHB B 3084 plasmid pHD03, complete sequence) position: , mismatch: 7, identity: 0.811

aaggctatacaggatgataatttaaaagaaaacttca-	CRISPR spacer
agagctatacaggatgatgatttaaatg-aattttcat	Protospacer
*..***************.******* * ** .****

888. spacer 11.31|2361096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN855865 (Myoviridae sp. isolate 346, complete genome) position: , mismatch: 7, identity: 0.8

-cagctatgtaaaactcttttttaccattataaaat	CRISPR spacer
gcaataata-aaaacgcttttttaccattatcaaat	Protospacer
 **.. **. ***** *************** ****

889. spacer 15.41|3312784|37|CP026613|PILER-CR matches to MK473382 (Clostridium phage JD032, complete genome) position: , mismatch: 7, identity: 0.811

cactacaataatagtgccttttagcaaaatttactag	CRISPR spacer
tactacaataatagtaccttttaacaaaatttgcctc	Protospacer
.**************.*******.********.*.

890. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.816

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
ttcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
.* ** . ************************.*** *

891. spacer 15.57|3313832|38|CP026613|PILER-CR matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 7, identity: 0.816

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
ttcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
.* ** . ************************.*** *

892. spacer 15.57|3313832|38|CP026613|PILER-CR matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.816

ctagaagatagaagaagcaatataaaagcaaaaatgcg	CRISPR spacer
ttcgatactagaagaagcaatataaaagcaaagatgag	Protospacer
.* ** . ************************.*** *

893. spacer 16.11|3638261|29|CP026613|CRT matches to NC_015059 (Granulicella tundricola MP5ACTX9 plasmid pACIX904, complete sequence) position: , mismatch: 7, identity: 0.759

gacctacctctccatctgctccagttgga	CRISPR spacer
tacctacctctccacctgctccaacaaca	Protospacer
 *************.********.. . *

894. spacer 16.13|3638387|29|CP026613|CRT matches to MN693834 (Marine virus AFVG_250M755, complete genome) position: , mismatch: 7, identity: 0.759

gacctgtagaacctgttactccatttgct	CRISPR spacer
cataagtagcacctgttcctccatttgcc	Protospacer
 *.  **** ******* **********.

895. spacer 16.13|3638387|29|CP026613|CRT matches to MN694396 (Marine virus AFVG_250M754, complete genome) position: , mismatch: 7, identity: 0.759

gacctgtagaacctgttactccatttgct	CRISPR spacer
cataagtagcacctgttcctccatttgcc	Protospacer
 *.  **** ******* **********.

896. spacer 16.13|3638387|29|CP026613|CRT matches to MN694618 (Marine virus AFVG_250M753, complete genome) position: , mismatch: 7, identity: 0.759

gacctgtagaacctgttactccatttgct	CRISPR spacer
cataagtagcacctgttcctccatttgcc	Protospacer
 *.  **** ******* **********.

897. spacer 16.13|3638387|29|CP026613|CRT matches to MT254578 (Bacillus phage Izhevsk, complete genome) position: , mismatch: 7, identity: 0.759

gacctgtagaacctgttactccatttgct	CRISPR spacer
tattattataacctgtaactccatttgct	Protospacer
 *..  ** ******* ************

898. spacer 16.14|3638441|29|CP026613|CRT matches to MN693124 (Marine virus AFVG_25M44, complete genome) position: , mismatch: 7, identity: 0.759

gacctgttattccatttgctccagttgcc	CRISPR spacer
ttcctgttattccatttactccatttaat	Protospacer
  ***************.***** **. .

899. spacer 16.14|3638441|29|CP026613|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 7, identity: 0.759

gacctgttattccatttgctccagttgcc	CRISPR spacer
ctgctctaattccatttgctccagttggt	Protospacer
   ** * ******************* .

900. spacer 16.14|3638441|29|CP026613|CRT matches to NZ_CP010611 (Phaeobacter inhibens strain P92 plasmid pP92_a, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttattccatttgctccagttgcc	CRISPR spacer
gaccagttattccagttgctccatgagtt	Protospacer
**** ********* ********   *..

901. spacer 16.14|3638441|29|CP026613|CRT matches to NZ_CP010716 (Phaeobacter piscinae strain P18 plasmid pP18_a, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttattccatttgctccagttgcc	CRISPR spacer
gaccagttattccagttgctccatgagtt	Protospacer
**** ********* ********   *..

902. spacer 16.14|3638441|29|CP026613|CRT matches to NZ_CP010662 (Phaeobacter inhibens strain P74 plasmid pP74_a, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttattccatttgctccagttgcc	CRISPR spacer
gaccagttattccagttgctccatgagtt	Protospacer
**** ********* ********   *..

903. spacer 16.15|3638495|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgccccggttgctccggttgct	Protospacer
  ********.*********** **  .*

904. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
accctgttgcaccggttgatcccgttact	Protospacer
. ******** ******* ******  .*

905. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgtcggc	Protospacer
  *********** ***********   .

906. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

907. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

908. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

909. spacer 16.15|3638495|29|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

910. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
accctgttgcaccggttgatcccgttact	Protospacer
. ******** ******* ******  .*

911. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcccgtcggc	Protospacer
  *********** ***********   .

912. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

913. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

914. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

915. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ttcctgttgctccggttactcccgttaca	Protospacer
  ***************.*******  .

916. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

917. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

918. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

919. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

920. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

921. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

922. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

923. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

924. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

925. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

926. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

927. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctccagttgctcctgtcact	Protospacer
  ***********.********.**  .*

928. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cacccgttgctccgattgctcccgctgct	Protospacer
 ***.*********.*********.  .*

929. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgctgctcccgttgct	Protospacer
  *********** *.*********  .*

930. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccctgttactccggctgctcccgttgct	Protospacer
  ******.******.*********  .*

931. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgtcgctcccgttgctcccgttgct	Protospacer
  *****.***** ***********  .*

932. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccccgttgctccggctgctcccgttgct	Protospacer
  **.**********.*********  .*

933. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcccgttgctccggttactcccgttgct	Protospacer
  **.************.*******  .*

934. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ttcctgttgctcccgttgctccggttact	Protospacer
  *********** ******** **  .*

935. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

936. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgtttctcctgttgctcccgttgct	Protospacer
  ****** **** ***********  .*

937. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

938. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

939. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

940. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

941. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

942. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

943. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

944. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

945. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

946. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

947. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

948. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

949. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

950. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

951. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

952. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

953. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

954. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

955. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcccgttgctcctgttgct	Protospacer
  *********** ********.**  .*

956. spacer 16.15|3638495|29|CP026613|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cggctgttgctccggttgctccggtggtc	Protospacer
 . ******************* **. *.

957. spacer 16.15|3638495|29|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
aacctgttgctccagttgctccagttgga	Protospacer
.************.******** **

958. spacer 16.15|3638495|29|CP026613|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgct	Protospacer
  *********** ********.**  .*

959. spacer 16.15|3638495|29|CP026613|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 7, identity: 0.759

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcccgttgctcccgttgctcccgttgct	Protospacer
  **.******** ***********  .*

960. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

961. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

962. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

963. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

964. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

965. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

966. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

967. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

968. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

969. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

970. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

971. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

972. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

973. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gtcccgttggtcccgttggtccggtatct	Protospacer
 ******** ******** ******

974. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cgcccgtagcacccgttgctccggtatcg	Protospacer
* ***** ** **************   .

975. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
cgcccgtagcacccgttgctccggtatcg	Protospacer
* ***** ** **************   .

976. spacer 17.6|3755351|27|CP026613|CRT matches to MN693226 (Marine virus AFVG_25M419, complete genome) position: , mismatch: 7, identity: 0.741

atttcctgttgctcctgttggacctgt	CRISPR spacer
tggacctgttgctcctgtaggacctac	Protospacer
    ************** ******..

977. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tggccctgttgctcctgttgctcctgttgctcctgt	Protospacer
   .*************************  ****.

978. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcctgttgctcctgttgctcccgt	Protospacer
  .**************************  **.*.

979. spacer 17.7|3755396|36|CP026613|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tggtcctgttggtcctgttggtcctgttggacccgt	Protospacer
   ******** ******** ************.*.

980. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttgctcctgttgctcctgttggccccgt	Protospacer
  .***.*********************** **.*.

981. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
cactcctgttgctcctgttgctcctgttgctcccgt	Protospacer
  .**************************  **.*.

982. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
cactcctgttgctcctgttgctcctgttgctcccgt	Protospacer
  .**************************  **.*.

983. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttgctcctgttgctcctgttggccccgt	Protospacer
  .***.*********************** **.*.

984. spacer 17.7|3755396|36|CP026613|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 7, identity: 0.806

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
gcctcctgttgctcctgttgctcctgttgctacggc	Protospacer
...**************************   * **

985. spacer 17.18|3755990|33|CP026613|CRT matches to MN693889 (Marine virus AFVG_250M624, complete genome) position: , mismatch: 7, identity: 0.788

-tggacctgttattcctattcctgttgctcctac	CRISPR spacer
atacatc-gttgttcctattcctgttgcgcctgc	Protospacer
 *. *.* ***.**************** ***.*

986. spacer 4.2|865061|30|CP026613|CRISPRCasFinder matches to NC_014663 (Acinetobacter phage Acj9, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaattgcaatgcaataaaatgtgttc	CRISPR spacer
gttgtcattgcaatgcaacaaaatttgttt	Protospacer
* ..  ************.***** ****.

987. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_041928 (Staphylococcus phage phiIBB-SEP1, complete genome) position: , mismatch: 8, identity: 0.784

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
acttgacctatataatcagatatttctcttttagttt	Protospacer
* **  .******* *********** ****** .**

988. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to KP027447 (Staphylococcus phage phiIPLA-C1C, complete genome) position: , mismatch: 8, identity: 0.784

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
acttgacctatataatcagatatttctcttttagttt	Protospacer
* **  .******* *********** ****** .**

989. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to MH321490 (Staphylococcus phage Quidividi, complete genome) position: , mismatch: 8, identity: 0.784

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
acttgacctatataatcagatatttctcttttagttt	Protospacer
* **  .******* *********** ****** .**

990. spacer 6.8|1245304|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to MF417868 (Uncultured Caudovirales phage clone 7AX_1, partial genome) position: , mismatch: 8, identity: 0.784

agtttttctatatattcagatatttcacttttatctt	CRISPR spacer
acttgacctatataatcagatatttctcttttagttt	Protospacer
* **  .******* *********** ****** .**

991. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to AP013453 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S28-C28) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
aaagtttgtttcttctttattatctaaaataa	Protospacer
  *.  *.***** *.****************

992. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

993. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

994. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

995. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

996. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

997. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

998. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

999. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1000. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1001. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1002. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1003. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1004. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1005. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1006. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1007. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1008. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1009. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1010. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NC_025146 (Clostridium botulinum plasmid pCB111 DNA, complete sequence, strain: 111) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
attttagatatctactttattatctaaaatta	Protospacer
 *   * ** *****.************** *

1011. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1012. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1013. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NC_012654 (Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
attttagatatctactttattatctaaaatta	Protospacer
 *   * ** *****.************** *

1014. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1015. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1016. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1017. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1018. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP031095 (Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
attttagatatctactttattatctaaaatta	Protospacer
 *   * ** *****.************** *

1019. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1020. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1021. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1022. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1023. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1024. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1025. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1026. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1027. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1028. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 8, identity: 0.75

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ataaattattcctaccttattatcaagggaaa	Protospacer
 **** ****.************* *... **

1029. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_013944 (Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK1, complete sequence) position: , mismatch: 8, identity: 0.778

aatcattccttttgtttcatctttaa----gttttacgac	CRISPR spacer
aatcattcctattgtttcatcttcaatgacattttg----	Protospacer
********** ************.**    .****.

1030. spacer 9.21|2199645|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_013945 (Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK3, complete sequence) position: , mismatch: 8, identity: 0.778

aatcattccttttgtttcatctttaa----gttttacgac	CRISPR spacer
aatcattcctattgtttcatcttcaatgacattttg----	Protospacer
********** ************.**    .****.

1031. spacer 11.4|2359318|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 8, identity: 0.778

------ttttttccccctttaaattttaaaactaataattta	CRISPR spacer
aataagtttt------ctttaaattttaaaaatattaattta	Protospacer
      ****      *************** ** *******

1032. spacer 11.4|2359318|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.778

------ttttttccccctttaaattttaaaactaataattta	CRISPR spacer
aataagtttt------ctttaaattttaaaaatattaattta	Protospacer
      ****      *************** ** *******

1033. spacer 11.14|2359975|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MH884511 (Exiguobacterium phage vB_EalM-132, complete genome) position: , mismatch: 8, identity: 0.778

tggtaaaatggctaagaaaaaagagctagaagaaaa	CRISPR spacer
agctgagatggctaggaaaaaagagcaagaagacat	Protospacer
 * *.*.*******.*********** ****** *

1034. spacer 11.31|2361096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_017736 (Helicobacter cetorum MIT 99-5656 plasmid pHCD, complete sequence) position: , mismatch: 8, identity: 0.771

cagctatgtaaaactcttttttaccattataaaat	CRISPR spacer
tagcattaaaaaactcttttttagcattaaaaaac	Protospacer
.***  *. ************** ***** ****.

1035. spacer 11.31|2361096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_017736 (Helicobacter cetorum MIT 99-5656 plasmid pHCD, complete sequence) position: , mismatch: 8, identity: 0.771

cagctatgtaaaactcttttttaccattataaaat	CRISPR spacer
tagcattaaaaaactcttttttagcattaaaaaac	Protospacer
.***  *. ************** ***** ****.

1036. spacer 16.13|3638387|29|CP026613|CRT matches to MN693487 (Marine virus AFVG_25M100, complete genome) position: , mismatch: 8, identity: 0.724

gacctgtagaacctgttactccatttgct	CRISPR spacer
ttattgtagaacctgttactccacttaaa	Protospacer
   .*******************.**.

1037. spacer 16.13|3638387|29|CP026613|CRT matches to MN694586 (Marine virus AFVG_250M370, complete genome) position: , mismatch: 8, identity: 0.724

gacctgtagaacctgttactccatttgct	CRISPR spacer
ttattgtagaacctgttactccacttaaa	Protospacer
   .*******************.**.

1038. spacer 16.13|3638387|29|CP026613|CRT matches to NC_016658 (Cyanophage NATL1A-7, complete genome) position: , mismatch: 8, identity: 0.724

gacctgtagaacctgttactccatttgct	CRISPR spacer
tttctgtagaacctgatacttcattttta	Protospacer
  .************ ****.***** .

1039. spacer 16.14|3638441|29|CP026613|CRT matches to MG592614 (Vibrio phage 1.248.O._10N.261.54.F1, partial genome) position: , mismatch: 8, identity: 0.724

gacctgttattccatttgctccagttgcc	CRISPR spacer
atgatgatattccatttgctccagtcggt	Protospacer
.   ** ******************.* .

1040. spacer 16.14|3638441|29|CP026613|CRT matches to MG592400 (Vibrio phage 1.016.O._10N.286.46.A11, partial genome) position: , mismatch: 8, identity: 0.724

gacctgttattccatttgctccagttgcc	CRISPR spacer
acgatgatattccatttgctccaattgga	Protospacer
.   ** ****************.***

1041. spacer 16.15|3638495|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctccagttgctccggttgctccggttgcc	Protospacer
  ** ***************** **  ..

1042. spacer 16.15|3638495|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgccccggttgctcctgttgcc	Protospacer
  ********.***********.**  ..

1043. spacer 16.15|3638495|29|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccctgttgccccggttgctcctgttgcc	Protospacer
  ********.***********.**  ..

1044. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctccggtcgctccggttgctcccgttgca	Protospacer
  ** **.*****************  .

1045. spacer 16.15|3638495|29|CP026613|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcctgttgctcctgttgctcctgttgca	Protospacer
  *********** ********.**  .

1046. spacer 16.15|3638495|29|CP026613|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
ctcccgttgcgccggttgctcccgttgcg	Protospacer
  **.***** **************  .

1047. spacer 16.15|3638495|29|CP026613|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 8, identity: 0.724

gacctgttgctccggttgctcccgtattt	CRISPR spacer
cccccgttgcgccggttgctcccgttgcg	Protospacer
  **.***** **************  .

1048. spacer 16.19|3638693|29|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.724

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
ctcctgttgctcccgttgctcctaaaaat	Protospacer
****.***************** .  ..

1049. spacer 16.19|3638693|29|CP026613|CRT matches to LR606152 (Rhizobium sp. Q54 genome assembly, plasmid: 9) position: , mismatch: 8, identity: 0.724

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
gctccgttgctcccgttgatctggttcct	Protospacer
 ..*************** **.****

1050. spacer 16.19|3638693|29|CP026613|CRT matches to NC_010627 (Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence) position: , mismatch: 8, identity: 0.724

ctcccgttgctcccgttgctccggttgga	CRISPR spacer
acaccgttgcgcccgtcgctccggttctc	Protospacer
 . ******* *****.*********

1051. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
ttctcctgttgctcccgttgctcctgttgctcccat	Protospacer
 *.************.*************  **...

1052. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tactcccgttgctcctgttgctcctgttgctcccgt	Protospacer
  .***.**********************  **.*.

1053. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tactcctgttactcctgttgctcctgttgctcccgt	Protospacer
  .*******.******************  **.*.

1054. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttgctcctgttgctcctgttgctcccgt	Protospacer
  .***.**********************  **.*.

1055. spacer 17.7|3755396|36|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tggtcctgttggtcctgttggtcctgttggaccact	Protospacer
   ******** ******** ************  .

1056. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttgctcctgttgctcctgttgctcccgt	Protospacer
  .***.**********************  **.*.

1057. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttgctcctgttgctcctgttgctcccgt	Protospacer
  .***.**********************  **.*.

1058. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tactcctgttactcctgttgctcctgttgctcccgt	Protospacer
  .*******.******************  **.*.

1059. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.778

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tattcctgttgggcctgttgctcctgttgctcccgt	Protospacer
  *********  ****************  **.*.

1060. spacer 17.10|3755564|27|CP026613|CRT matches to NC_014663 (Acinetobacter phage Acj9, complete genome) position: , mismatch: 8, identity: 0.704

tgggcctgttactccatctgctccagt	CRISPR spacer
aactattgttactccatctgctccatc	Protospacer
 .   .******************* .

1061. spacer 17.18|3755990|33|CP026613|CRT matches to CP024691 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-7-9K, complete sequence) position: , mismatch: 8, identity: 0.758

tggacctgttattcctattcctgttgctcctac	CRISPR spacer
tggacctgttacacctattcctgtgccaccggg	Protospacer
***********. ***********  * ** .

1062. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 9, identity: 0.719

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
ctaaaacatttctacctaattattattatcat	Protospacer
******.********** *****.   * .*

1063. spacer 7.1|1581116|32|CP026613|CRISPRCasFinder matches to NC_019763 (Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence) position: , mismatch: 9, identity: 0.719

ctaaaatatttctaccttattatctaaaataa	CRISPR spacer
tgaaaatatttctaagttattatctcacgaag	Protospacer
. ************  ********* * . *.

1064. spacer 8.6|1746241|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR215006 (Mycoplasma conjunctivae strain NCTC10147 plasmid 10) position: , mismatch: 9, identity: 0.757

tattaattgcttatctattaattcttttaatttttca	CRISPR spacer
tgattttattttaactattaattcatttaatttttca	Protospacer
*. *  *  .*** ********** ************

1065. spacer 8.6|1746241|37|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to LR214957 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 3) position: , mismatch: 9, identity: 0.757

tattaattgcttatctattaattcttttaatttttca	CRISPR spacer
tgattttattttaactattaattcatttaatttttca	Protospacer
*. *  *  .*** ********** ************

1066. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MG065657 (UNVERIFIED: Campylobacter phage C4, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1067. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MG065649 (UNVERIFIED: Campylobacter phage A143, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1068. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to KC710998 (Shigella phage pSf-1, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1069. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_049821 (Salmonella phage slyngel, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1070. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MK373798 (Escherichia phage vB_EcoS_G29-2, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1071. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MG065681 (UNVERIFIED: Campylobacter phage A139, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1072. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MG065680 (UNVERIFIED: Campylobacter phage A113, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1073. spacer 9.7|2198721|38|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MG065643 (UNVERIFIED: Campylobacter phage E6, complete genome) position: , mismatch: 9, identity: 0.763

ttaatgatgaaggaaaagaatatgtagtatatgaatat	CRISPR spacer
ttaatgatgaaggtgaagaatatgtagatcgtcaaatt	Protospacer
************* .************  ..* **  *

1074. spacer 11.6|2359450|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MT774406 (CrAssphage cr124_1, complete genome) position: , mismatch: 9, identity: 0.743

ctactcaaacaaggtaatcatgtacataacataga	CRISPR spacer
catctttaacaagctaatcatgtacataatatcct	Protospacer
*  **. ****** ***************.**

1075. spacer 11.26|2360769|34|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_015851 (Acidithiobacillus caldus SM-1 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.735

cttttgataataaaagaacatcagttagatttga	CRISPR spacer
attcgtccaataaaagaccttcagttagatttgt	Protospacer
 **.   .********* * *************

1076. spacer 11.26|2360769|34|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP005987 (Acidithiobacillus caldus ATCC 51756 plasmid megap mpAca1.1, complete sequence) position: , mismatch: 9, identity: 0.735

cttttgataataaaagaacatcagttagatttga	CRISPR spacer
attcgtccaataaaagaccttcagttagatttgt	Protospacer
 **.   .********* * *************

1077. spacer 11.26|2360769|34|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026329 (Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.735

cttttgataataaaagaacatcagttagatttga	CRISPR spacer
attcgtccaataaaagaccttcagttagatttgt	Protospacer
 **.   .********* * *************

1078. spacer 16.13|3638387|29|CP026613|CRT matches to MN694774 (Marine virus AFVG_250M941, complete genome) position: , mismatch: 9, identity: 0.69

gacctgtagaacctgttactccatttgct	CRISPR spacer
ttatagtagaacctgttactccacttaaa	Protospacer
   . ******************.**.

1079. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tactcctgttgctcctgctgctcccgttgctccaac	Protospacer
  .**************.******.****  ** .*

1080. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tattcctgttgctcccgttgctccggttactcccgt	Protospacer
  *************.******** ***.  **.*.

1081. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1082. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcccgttactcctgttgctcccgt	Protospacer
  .************.***.*********  **.*.

1083. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1084. spacer 17.7|3755396|36|CP026613|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
agaacctgttgctccagttgctccagttggaatacc	Protospacer
*   *********** ******** ****** .  *

1085. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1086. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcccgttactcctgttgctcccgt	Protospacer
  .************.***.*********  **.*.

1087. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1088. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1089. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgctcccgttactcctgttgctcccgt	Protospacer
  .************.***.*********  **.*.

1090. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1091. spacer 17.7|3755396|36|CP026613|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcccgttactcctgttgctcctgttgctcccgt	Protospacer
  .***.***.******************  **.*.

1092. spacer 17.7|3755396|36|CP026613|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.75

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgctcctgttgccccggttgctcctgttgccccggt	Protospacer
  .*********.** *************  ** *.

1093. spacer 17.12|3755645|36|CP026613|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.75

tgcacctgttggacctgttactccggttgctccatc	CRISPR spacer
caggcctgtcggacctgttactcccgttgctcctgt	Protospacer
.. .*****.************** ********  .

1094. spacer 9.26|2199974|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 10, identity: 0.714

tgcttgtgctgtaggtgttccttgtgctgtcatat	CRISPR spacer
aacacgtgctgtaggtgggccttgtgctgtccccg	Protospacer
 .* .************  ************ .

1095. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050647 (Escherichia coli strain PapM-36-2 plasmid pIncFIB, complete sequence) position: , mismatch: 10, identity: 0.722

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
ataaaagattaaaaaaaataaaatcatctttatcac	Protospacer
******.******* ***********   * * ...

1096. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NC_019348 (Lactococcus lactis subsp. cremoris plasmid pAF07, complete sequence) position: , mismatch: 10, identity: 0.722

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
cgcaaaaattaaaataaagcaaatcaaaaatttcgt	Protospacer
   ***************  *********    .**

1097. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN693542 (Marine virus AFVG_25M165, complete genome) position: , mismatch: 10, identity: 0.722

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
ttcataaattagaaaaaataaaatcaaaatataaag	Protospacer
 * * ******.** **************** . .

1098. spacer 11.31|2361096|35|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034172 (Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

cagctatgtaaaactcttttttaccattataaaat	CRISPR spacer
taataaaagaaaaatcttttttaacattataaaaa	Protospacer
.*.. * . **** ********* **********

1099. spacer 15.31|3314222|35|CP026613|CRISPRCasFinder,CRT matches to MN033866 (Leviviridae sp. isolate H1_Bulk_Litter_6_scaffold_308 hypothetical protein (H1BulkLitter6308_000001), hypothetical protein (H1BulkLitter6308_000002), RNA-dependent RNA polymerase (H1BulkLitter6308_000003), and hypothetical protein (H1BulkLitter6308_000004) genes, complete cds) position: , mismatch: 10, identity: 0.714

ctgtaaatagtatcgtgtttctctgtataaagaat	CRISPR spacer
ccgtacagagtatcgtgtttctctgtatcgcttta	Protospacer
*.*** * ******************** .

1100. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 10, identity: 0.722

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tggtcctgttggtcctgttggtcctgttgaaatagg	Protospacer
   ******** ******** ********.* . *

1101. spacer 17.7|3755396|36|CP026613|CRT matches to NZ_CP024167 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence) position: , mismatch: 10, identity: 0.722

atttcctgttgctcctgttgctcctgttggacctgc	CRISPR spacer
tgttcctgttgttcctgttgttcctgttgctgatat	Protospacer
  *********.********.********    *..

1102. spacer 8.1|1745913|36|CP026613|PILER-CR,CRISPRCasFinder,CRT matches to NC_014389 (Butyrivibrio proteoclasticus B316 plasmid pCY360, complete sequence) position: , mismatch: 11, identity: 0.694

cttgtagataatgcagaagaagaagaaaaacagatt	CRISPR spacer
atcaattataataccgaagaagaagaaaaacaggag	Protospacer
 *..   *****.* ******************.

1103. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN693056 (Marine virus AFVG_25M10, complete genome) position: , mismatch: 11, identity: 0.694

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
tgcataaattagaaaaaataaaatcaaaatataaag	Protospacer
   * ******.** **************** . .

1104. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN693152 (Marine virus AFVG_25M11, complete genome) position: , mismatch: 11, identity: 0.694

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
tgcataaattagaaaaaataaaatcaaaatataaag	Protospacer
   * ******.** **************** . .

1105. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN693342 (Marine virus AFVG_25M9, complete genome) position: , mismatch: 11, identity: 0.694

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
tgcataaattagaaaaaataaaatcaaaatataaag	Protospacer
   * ******.** **************** . .

1106. spacer 11.19|2360306|36|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to MN693020 (Marine virus AFVG_117M64, complete genome) position: , mismatch: 11, identity: 0.694

ataaaaaattaaaataaataaaatcaaaataagtgt	CRISPR spacer
tgcataaattagaaaaaataaaatcaaaatataaag	Protospacer
   * ******.** **************** . .

1107. spacer 9.2|2198391|37|CP026613|CRISPRCasFinder,CRT,PILER-CR matches to HG796590 (Uncultured bacterium plasmid pRGI01759) position: , mismatch: 12, identity: 0.676

gaggcgtttttttctgttccgactcctgttcctgtat	CRISPR spacer
aaaagctttttttctgttccaacccctgttccaaccc	Protospacer
.*..  **************.**.******** .. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

277442 : 293625

Synechococcus_phage(23.08%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVD43655.1\|277442_277955_-	nitroreductase family protein	A0A1V0E011	Clostridioides_phage	1.7e-83	87.6
AVD43656.1\|278404_278881_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.1e-26	45.8
AVD43657.1\|278886_279585_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3F9V5	Synechococcus_phage	1.5e-45	43.9
AVD43658.1\|279596_280964_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-49	31.0
AVD43659.1\|280957_282034_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.9e-64	42.8
AVD43660.1\|282027_282621_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.6e-24	39.9
AVD43661.1\|282613_284146_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	E3SNU8	Prochlorococcus_phage	2.3e-38	49.7
AVD43662.1\|284156_285407_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AVD43663.1\|285431_289238_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	1.2e-30	24.1
AVD43664.1\|289441_290314_+	dTDP-4-dehydrorhamnose reductase	H9NCE8	Sphingomonas_phage	3.3e-13	29.0
AVD43665.1\|290422_291292_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	6.2e-97	61.5
AVD43666.1\|291340_291898_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.5e-48	53.6
AVD43667.1\|291935_292919_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.8e-79	47.1
AVD43668.1\|292956_293625_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	4.1e-24	46.9

DBSCAN-SWA_2

572224 : 646288

Streptococcus_phage(25.0%)

tRNA,transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVD43901.1\|572224_572941_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AVD43902.1\|573019_574330_+	methylase	NA	NA	NA	NA
AVD43903.1\|574429_574966_+	signal peptidase I	NA	NA	NA	NA
AVD43904.1\|575131_575668_+	signal peptidase I	NA	NA	NA	NA
AVD43905.1\|575677_576433_+	endonuclease	NA	NA	NA	NA
AVD43906.1\|576506_578174_+	nucleoside kinase	NA	NA	NA	NA
AVD43907.1\|578747_579677_+	glutaminase	NA	NA	NA	NA
AVD43908.1\|579774_580338_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AVD43909.1\|580820_581657_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	2.8e-30	33.5
AVD43910.1\|581939_582935_+	aldo/keto reductase	NA	NA	NA	NA
AVD43911.1\|583168_583573_-	RusA family crossover junction endodeoxyribonuclease	NA	NA	NA	NA
AVD43912.1\|584330_585245_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
AVD43913.1\|585350_587588_+	ATP-binding protein	A0A2H4UU76	Bodo_saltans_virus	6.9e-07	33.7
AVD44850.1\|588025_588643_+	endonuclease III	NA	NA	NA	NA
AVD43914.1\|588836_589307_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
AVD43915.1\|589341_590190_+	DegV family protein	NA	NA	NA	NA
AVD43916.1\|590477_591482_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
AVD43917.1\|592589_593708_+\|transposase	transposase	A0A0H3UZC2	Geobacillus_virus	1.4e-109	52.7
AVD43918.1\|594756_595518_+	hypothetical protein	NA	NA	NA	NA
AVD43919.1\|595520_596339_+	hypothetical protein	NA	NA	NA	NA
AVD43920.1\|596517_597120_+	DUF445 family protein	NA	NA	NA	NA
AVD43921.1\|597912_599832_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.8e-144	39.9
AVD43922.1\|600556_601648_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
AVD43923.1\|601995_602193_-	PadR family transcriptional regulator	NA	NA	NA	NA
AVD43924.1\|602552_603893_+	ATP-binding protein	X5JAC0	Clostridium_phage	1.4e-79	39.7
AVD43925.1\|604234_604804_-	hydrolase	NA	NA	NA	NA
AVD43926.1\|604964_606215_-	MFS transporter	NA	NA	NA	NA
AVD43927.1\|606223_606457_-	hypothetical protein	NA	NA	NA	NA
AVD43928.1\|606507_607095_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AVD43929.1\|607386_608847_+	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AVD43930.1\|609215_609821_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AVD43931.1\|609823_612391_+	pyruvate, phosphate dikinase	A0A1V0SGR7	Hokovirus	3.5e-47	39.2
AVD43932.1\|612383_612548_+	hypothetical protein	NA	NA	NA	NA
AVD43933.1\|612650_614735_-	EAL domain-containing protein	G3MA91	Bacillus_virus	2.9e-07	26.6
AVD44851.1\|614782_616012_-	GGDEF domain-containing protein	NA	NA	NA	NA
AVD43934.1\|616013_617195_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	6.6e-09	26.0
AVD43935.1\|618321_618597_+	hypothetical protein	NA	NA	NA	NA
AXL65668.1\|618616_618904_+	hypothetical protein	NA	NA	NA	NA
AVD43936.1\|619323_621840_+	ATP-binding protein	NA	NA	NA	NA
AVD43937.1\|621854_627065_+	hypothetical protein	NA	NA	NA	NA
AVD43938.1\|627577_627769_-	hypothetical protein	NA	NA	NA	NA
AVD43939.1\|627962_628151_+	hypothetical protein	NA	NA	NA	NA
AVD43940.1\|628320_628761_-	DUF3788 domain-containing protein	NA	NA	NA	NA
AVD43941.1\|629095_630409_+	DUF3440 domain-containing protein	A0A220GKF8	Streptococcus_phage	3.3e-94	41.5
AVD43942.1\|630426_630963_+	chromosome partitioning protein ParB	A0A220GKT8	Streptococcus_phage	2.1e-63	69.7
AVD43943.1\|631460_631682_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
AVD43944.1\|631681_631945_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
AVD43945.1\|632008_632581_+	manganese catalase family protein	NA	NA	NA	NA
AVD43946.1\|633372_634026_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
AVD43947.1\|634187_634721_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	5.9e-34	49.4
AVD43948.1\|636523_636937_+	DUF3795 domain-containing protein	NA	NA	NA	NA
AVD43949.1\|637010_637547_+	GrpB family protein	NA	NA	NA	NA
AVD43950.1\|637707_639282_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
AVD43951.1\|639970_640543_-	urea carboxylase-associated family protein	NA	NA	NA	NA
AVD43952.1\|640946_641516_+	GrpB family protein	NA	NA	NA	NA
AVD43953.1\|641852_643025_-	ATP-binding protein	X5JAC0	Clostridium_phage	4.0e-14	25.3
AVD43954.1\|643420_643597_-	hypothetical protein	NA	NA	NA	NA
AVD43955.1\|643700_644282_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AVD43956.1\|644404_645229_-	MerR family transcriptional regulator	NA	NA	NA	NA
AVD43957.1\|645394_646288_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

1337325 : 1400233

Clostridium_phage(42.86%)

tRNA,plate,portal,transposase,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVD44542.1\|1337325_1338060_+\|protease	Clp protease	NA	NA	NA	NA
AVD44543.1\|1338182_1340591_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	3.3e-92	50.4
AVD44544.1\|1340593_1341652_+\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
AVD44545.1\|1341645_1342980_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
AVD44546.1\|1342966_1343509_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AVD44547.1\|1343775_1344822_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	7.1e-124	65.8
AVD44868.1\|1344997_1346539_+	ribonuclease Y	NA	NA	NA	NA
AXL65679.1\|1346848_1349185_+	diguanylate cyclase	G3MA91	Bacillus_virus	3.8e-16	29.8
AVD44548.1\|1350090_1351209_+\|transposase	transposase	A0A0H3UZC2	Geobacillus_virus	2.4e-109	53.0
AVD44549.1\|1351273_1351489_+	hypothetical protein	NA	NA	NA	NA
AVD44550.1\|1351540_1353322_+	DNA helicase	NA	NA	NA	NA
AVD44551.1\|1353401_1353932_-	signal peptidase I	NA	NA	NA	NA
AVD44552.1\|1353971_1354796_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
AVD44553.1\|1355052_1355964_+	recombinase	NA	NA	NA	NA
AVD44554.1\|1356102_1357548_+	adenylosuccinate lyase	NA	NA	NA	NA
AVD44555.1\|1357848_1358301_+	MarR family transcriptional regulator	NA	NA	NA	NA
AVD44556.1\|1358519_1359716_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AVD44557.1\|1360100_1361051_+	galactose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AVD44558.1\|1361171_1361924_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	1.6e-56	44.4
AVD44559.1\|1362015_1362792_-	exonuclease	NA	NA	NA	NA
AVD44560.1\|1363106_1365005_+	glutamine synthetase	NA	NA	NA	NA
AVD44869.1\|1365132_1366254_-	galactosyldiacylglycerol synthase	NA	NA	NA	NA
AVD44561.1\|1366452_1366785_+	PadR family transcriptional regulator	NA	NA	NA	NA
AVD44562.1\|1366771_1367830_+	DUF1700 domain-containing protein	NA	NA	NA	NA
AVD44563.1\|1367822_1368893_+	hypothetical protein	NA	NA	NA	NA
AVD44564.1\|1368994_1369531_+	hypothetical protein	NA	NA	NA	NA
AVD44565.1\|1369650_1370358_+	lantibiotic protection ABC transporter ATP-binding subunit	A0A2H4PQG7	Staphylococcus_phage	2.3e-57	49.8
AVD44566.1\|1370359_1371079_+	lantibiotic immunity ABC transporter MutE/EpiE family permease subunit	NA	NA	NA	NA
AVD44567.1\|1371080_1371851_+	lantibiotic immunity ABC transporter MutG family permease subunit	NA	NA	NA	NA
AVD44870.1\|1371984_1373376_+	sensor histidine kinase	NA	NA	NA	NA
AVD44568.1\|1373451_1374273_-	pyridoxamine kinase	NA	NA	NA	NA
AVD44569.1\|1374523_1375678_+	amidase domain-containing protein	NA	NA	NA	NA
AVD44570.1\|1375860_1376061_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.7e-16	66.2
AVD44571.1\|1376481_1376910_+	CBS domain-containing protein	NA	NA	NA	NA
AVD44572.1\|1377052_1377808_-	peptidylprolyl isomerase	NA	NA	NA	NA
AVD44573.1\|1377928_1378345_-	hypothetical protein	NA	NA	NA	NA
AVD44574.1\|1378508_1379015_-	hypothetical protein	A0A0A8WEK1	Clostridium_phage	1.1e-56	67.7
AVD44575.1\|1379096_1379417_-	XRE family transcriptional regulator	A0A0A8WE28	Clostridium_phage	9.7e-24	55.5
AVD44576.1\|1379585_1379783_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVD44577.1\|1379886_1380327_+	hypothetical protein	A0A090EUN5	Clostridium_phage	1.1e-28	47.9
AVD44578.1\|1380575_1381019_+	hypothetical protein	A0A1V0DZX9	Clostridioides_phage	2.0e-19	36.7
AVD44579.1\|1381023_1382088_+\|tail	phage tail sheath protein	A0A1V0DZX4	Clostridioides_phage	5.8e-97	53.1
AVD44580.1\|1382101_1382530_+\|portal	phage portal protein	A0A1V0DZX1	Clostridioides_phage	2.8e-34	51.8
AVD44581.1\|1382643_1383090_+\|portal	phage portal protein	A0A090EUD0	Clostridium_phage	8.2e-13	36.0
AVD44582.1\|1383116_1383284_+	hypothetical protein	NA	NA	NA	NA
AVD44583.1\|1383283_1385737_+	hypothetical protein	A0A1V0DZX3	Clostridioides_phage	1.4e-16	58.4
AVD44584.1\|1385736_1386159_+	hypothetical protein	A0A090DBR9	Clostridium_phage	1.7e-52	71.1
AVD44585.1\|1386440_1387970_+	cell wall hydrolase	A0A1V0DZX6	Clostridioides_phage	1.3e-243	81.1
AVD44586.1\|1387985_1388312_+	DUF2577 domain-containing protein	J9QE86	Clostridium_phage	3.9e-52	92.6
AVD44587.1\|1388311_1388740_+	DUF2634 domain-containing protein	A0A0A8WJ32	Clostridium_phage	3.7e-63	81.0
AVD44588.1\|1388732_1389785_+\|plate	baseplate J/gp47 family protein	A0A0A8WFP3	Clostridium_phage	3.5e-139	70.4
AVD44589.1\|1389781_1390480_+	DUF2313 domain-containing protein	A0A090D815	Clostridium_phage	9.5e-48	56.9
AVD44590.1\|1390480_1391467_+\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	7.6e-59	45.8
AVD44591.1\|1391488_1396666_+	chromosome condensation regulator	A0A0A8WEY5	Clostridium_phage	2.6e-81	27.2
AVD44592.1\|1396682_1397036_+	hypothetical protein	A0A0A8WJF2	Clostridium_phage	5.5e-12	42.1
AVD44593.1\|1397298_1397559_+	hypothetical protein	E2ELK7	Clostridium_phage	9.9e-35	90.6
AVD44594.1\|1397769_1398225_-	hypothetical protein	NA	NA	NA	NA
AVD44595.1\|1398452_1398872_-	XRE family transcriptional regulator	S5MUV6	Brevibacillus_phage	1.6e-05	35.9
AVD44596.1\|1399167_1399377_+	XRE family transcriptional regulator	Q5YAA3	Bacillus_phage	5.9e-06	47.2
AVD44597.1\|1399396_1399618_+	hypothetical protein	NA	NA	NA	NA
AVD44598.1\|1399834_1400233_-	helix-turn-helix domain-containing protein	A0A059T669	Listeria_phage	1.0e-06	34.5

DBSCAN-SWA_4

1478693 : 1488422

Pandoravirus(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVD44658.1\|1478693_1479278_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.5e-57	53.2
AVD44659.1\|1479270_1480629_+	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	7.8e-38	41.6
AVD44660.1\|1480618_1481362_+	aminodeoxychorismate lyase	NA	NA	NA	NA
AVD44661.1\|1481395_1482097_+	hypothetical protein	NA	NA	NA	NA
AVD44662.1\|1482122_1482695_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	2.3e-44	51.6
AVD44663.1\|1482748_1483552_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.1e-23	30.0
AVD44664.1\|1483562_1483928_+	dihydroneopterin aldolase	NA	NA	NA	NA
AVD44665.1\|1483920_1484427_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4VNV0	Pandoravirus	4.2e-13	33.9
AVD44666.1\|1484407_1485193_+	3-deoxy-7-phosphoheptulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.7e-13	27.9
AVD44667.1\|1485447_1487238_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.2e-51	32.6
AVD44668.1\|1487249_1488422_+	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	9.7e-37	36.8

DBSCAN-SWA_5

1581346 : 1601920

Streptococcus_phage(94.44%)

integrase

attL 1578539:1578554|attR 1605798:1605813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1578539:1578554	attL	NA	NA	NA	NA
AVD44748.1\|1581346_1582114_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-30	34.8
AVD44749.1\|1582100_1584038_+	ABC transporter permease	NA	NA	NA	NA
AVD44750.1\|1584253_1584373_+	hypothetical protein	NA	NA	NA	NA
AVD44751.1\|1584395_1584710_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
AVD44752.1\|1584725_1585112_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
AVD44753.1\|1585140_1586526_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
AVD44754.1\|1586528_1586681_+	conjugal transfer protein	NA	NA	NA	NA
AVD44755.1\|1586703_1587909_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
AVD44756.1\|1587951_1588173_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
AVD44757.1\|1588289_1588787_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
AVD44758.1\|1588761_1589268_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
AVD44759.1\|1589251_1591699_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
AVD41375.1\|1593877_1594879_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
AVD41376.1\|1594875_1595808_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
AVD41377.1\|1596082_1596169_+	tetracycline resistance protein	NA	NA	NA	NA
AVD41378.1\|1596184_1598104_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.4
AVD41379.1\|1598204_1598390_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
AVD41380.1\|1598449_1598803_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
AVD44760.1\|1599007_1599079_+	hypothetical protein	NA	NA	NA	NA
AVD41381.1\|1599307_1599730_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
AVD41382.1\|1599726_1599957_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
AVD41383.1\|1600182_1600434_-	hypothetical protein	NA	NA	NA	NA
AVD41384.1\|1600417_1600621_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
AVD41385.1\|1600702_1601920_+\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
1605798:1605813	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2727266 : 2748561

Streptococcus_phage(90.0%)

integrase

attL 2726235:2726250|attR 2746444:2746459

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2726235:2726250	attL	NA	NA	NA	NA
AVD42345.1\|2727266_2727581_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
AVD42346.1\|2727596_2727983_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
AVD42347.1\|2728011_2729397_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
AVD42348.1\|2729399_2729552_+	conjugal transfer protein	NA	NA	NA	NA
AVD42349.1\|2729574_2730780_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
AVD42350.1\|2730822_2731044_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
AVD42351.1\|2731160_2731658_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
AVD42352.1\|2731632_2732139_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
AVD42353.1\|2732122_2734570_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
AVD42354.1\|2734572_2736750_+	YtxH domain-containing protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	99.2
AVD42355.1\|2736746_2737748_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
AVD42356.1\|2737744_2738677_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
AVD42357.1\|2738951_2739038_+	tetracycline resistance protein	NA	NA	NA	NA
AVD42358.1\|2739053_2740973_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.4
AVD42359.1\|2741073_2741259_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
AVD42360.1\|2741318_2741672_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
AVD44802.1\|2741876_2741948_+	hypothetical protein	NA	NA	NA	NA
AVD42361.1\|2742176_2742599_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
AVD42362.1\|2742595_2742826_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
AVD42363.1\|2743051_2743303_-	hypothetical protein	NA	NA	NA	NA
AVD42364.1\|2743286_2743490_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
AVD42365.1\|2743571_2744789_+\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
AVD42366.1\|2745093_2746203_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	1.1e-21	33.3
AVD42367.1\|2746232_2747000_+	PucR family transcriptional regulator	NA	NA	NA	NA
2746444:2746459	attR	NA	NA	NA	NA
AVD42368.1\|2747187_2748561_-	MFS transporter	S4TR35	Salmonella_phage	2.5e-07	22.0

DBSCAN-SWA_7

3130147 : 3139099

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVD42670.1\|3130147_3132061_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.1e-26	29.8
AVD42671.1\|3132143_3133235_-	glycosyltransferase family 4 protein	A0A1V0SL50	Klosneuvirus	1.0e-16	26.2
AVD44809.1\|3133240_3134536_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-89	43.4
AVD42672.1\|3134561_3135314_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	3.5e-16	40.5
AVD42673.1\|3135361_3136270_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AVD42674.1\|3136291_3137041_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.2e-16	38.8
AVD42675.1\|3137069_3138260_-	glycerophosphotransferase	NA	NA	NA	NA
AVD42676.1\|3138259_3139099_-	glycosyltransferase family 2 protein	A0A2P1ELT8	Moumouvirus	1.8e-05	25.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection