CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP019651	Paenibacillus larvae subsp. larvae strain ERIC_I chromosome, complete genome	4 crisprs	csa3,c2c10_CAS-V-U3,cas14j,cas3,DEDDh,cas2,cas1,cas4,cas5,cas7b,cas8b1,WYL,DinG,cmr3gr5,cas10,cmr1gr7,PD-DExK	2	12	31	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP019651_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019651_3

2033614-2034052

Orphan

NA:I-C

Consensus_repeat	Method
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CRISPRCasFinder
GTCGCATCCTACGCGGATGNCGTGGATTGAAAT	CRT

6 spacers

The CRISPR arrays of CP019651_3

>merge|CP019651|3|2033614-2034052|PILER-CR,CRISPRCasFinder,CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAATTATGACCGGGTATCTGCTGTTGCAGAAGCCGAAGGGTGTCGCATCCTACGCGGATACGTGGATTGAAATACGGTATGAATCGTAAGTCGCCTGACTCACGATATGGTCGCATCCTACGCGGATGCGTGGATTGAAATCGTTCTGTGGCCAGTGTCATATGGCGACAGGCGAATGTCGCATCCTACGCGGATGCGTGGATTGAAATAAAAACCCCGATTATGTGGCGGCCGTCCGCACGCGTCGCATCCTACGCGGATGCGTGGATTGAAATCATGAAGTAATTGCAGTTTCGAACAACGCTAAAGGTCGCATCCCATGTGGATGCGTGGATTGAAATTATAGGTGTCACAATACCAGTCGTATCGTAAATTTCTAGTCGCATCCTACGTGGAATGCATGGATTGAAA

>CP019651|3|1|2033614-2033916|PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TATGACCGGGTATCTGCTGTTGCAGAAGCCGAAGGGT
GTCGCATCCTACGCGGATACGTGGATTGAAAT	ACGGTATGAATCGTAAGTCGCCTGACTCACGATATG
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CGTTCTGTGGCCAGTGTCATATGGCGACAGGCGAAT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAAAACCCCGATTATGTGGCGGCCGTCCGCACGC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT

>CP019651|3|3|2033614-2033982|CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TATGACCGGGTATCTGCTGTTGCAGAAGCCGAAGGGT
GTCGCATCCTACGCGGATACGTGGATTGAAAT	ACGGTATGAATCGTAAGTCGCCTGACTCACGATATG
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CGTTCTGTGGCCAGTGTCATATGGCGACAGGCGAAT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAAAACCCCGATTATGTGGCGGCCGTCCGCACGC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CATGAAGTAATTGCAGTTTCGAACAACGCTAAAG
GTCGCATCCCATGTGGATGCGTGGATTGAAAT

>CP019651|3|1|2033614-2034052|CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TATGACCGGGTATCTGCTGTTGCAGAAGCCGAAGGGT
GTCGCATCCTACGCGGATACGTGGATTGAAAT	ACGGTATGAATCGTAAGTCGCCTGACTCACGATATG
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CGTTCTGTGGCCAGTGTCATATGGCGACAGGCGAAT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAAAACCCCGATTATGTGGCGGCCGTCCGCACGC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CATGAAGTAATTGCAGTTTCGAACAACGCTAAAG
GTCGCATCCCATGTGGATGCGTGGATTGAAAT	TATAGGTGTCACAATACCAGTCGTATCGTAAATTTCTA
GTCGCATCCTACGTGGAATGCATGGATTGAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP019651.1\|AVF22079.1\|2030713_2030857_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377224
CP019651.1\|AVF22076.1\|2028757_2029504_+\|glutamine-transport-ATP-binding-protein-GlnQ	unknown	unknown	gnl\|CDD\|224051
CP019651.1\|AVF22083.1\|2033136_2033280_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22085.1\|2035162_2035795_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	unknown	unknown	gnl\|CDD\|274926
CP019651.1\|AVF22087.1\|2037668_2037989_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|379233
CP019651.1\|AVF22088.1\|2038046_2038346_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|225511
CP019651.1\|AVF22093.1\|2043253_2046202_+\|formate-dehydrogenase,-alpha-subunit	unknown	unknown	gnl\|CDD\|225918
CP019651.1\|AVF22081.1\|2032372_2032798_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22091.1\|2039852_2040611_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378279
CP019651.1\|AVF22089.1\|2038436_2039063_-\|transcriptional-regulator-like-protein	unknown	unknown	gnl\|CDD\|133381
CP019651.1\|AVF22090.1\|2039475_2039832_-\|group-I-intron-endonuclease	unknown	unknown	gnl\|CDD\|198398
CP019651.1\|AVF22074.1\|2026513_2027095_+\|transcriptional-regulator-like-protein	unknown	unknown	gnl\|CDD\|366102
CP019651.1\|AVF22075.1\|2027189_2028056_+\|cystine-binding-periplasmic-protein	unknown	unknown	gnl\|CDD\|270431
CP019651.1\|AVF22078.1\|2030255_2030465_+\|cyanate-hydratase-CynS	unknown	unknown	gnl\|CDD\|235079
CP019651.1\|AVF22084.1\|2034332_2034893_-\|acyl-CoA-O-methyltransferase-like-protein	unknown	unknown	gnl\|CDD\|226607
CP019651.1\|AVF22080.1\|2032019_2032211_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22077.1\|2029548_2029971_+\|peroxiredoxin,-OsmC-subfamily	unknown	unknown	gnl\|CDD\|224679
CP019651.1\|AVF22086.1\|2036787_2037078_-\|transposase-like-protein	unknown	unknown	gnl\|CDD\|222853
CP019651.1\|AVF22082.1\|2032826_2033021_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22092.1\|2041199_2041754_+\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|226614

Protein	Function_ID	Function_description	E-value
CP019651.1\|AVF22079.1\|2030713_2030857_-\|hypothetical-protein	gnl\|CDD\|377224	pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily. This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways. This family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins.	0.000424963
CP019651.1\|AVF22076.1\|2028757_2029504_+\|glutamine-transport-ATP-binding-protein-GlnQ	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.66551e-144
CP019651.1\|AVF22077.1\|2029548_2029971_+\|peroxiredoxin,-OsmC-subfamily	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	3.01646e-33
CP019651.1\|AVF22087.1\|2037668_2037989_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	5.50062e-07
CP019651.1\|AVF22088.1\|2038046_2038346_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.000117275
CP019651.1\|AVF22093.1\|2043253_2046202_+\|formate-dehydrogenase,-alpha-subunit	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
CP019651.1\|AVF22091.1\|2039852_2040611_-\|hypothetical-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.68649e-28
CP019651.1\|AVF22089.1\|2038436_2039063_-\|transcriptional-regulator-like-protein	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	9.66457e-20
CP019651.1\|AVF22090.1\|2039475_2039832_-\|group-I-intron-endonuclease	gnl\|CDD\|198398	cd10451, GIY-YIG_LuxR_like, GIY-YIG domain of LuxR and ArsR family transcriptional regulators, and uncharacterized hypothetical proteins found in bacteria. The family includes some bacterial LuxR and ArsR family transcriptional regulators. The a C-terminal conserved domain shows sequence similarity to the N-terminal catalytic GIY-YIG domains of intron-encoded homing endonucleases. Besides, they have an N-terminally fused transcriptional regulators module, comprising the winged helix-turn-helix (wHTH) domain and uncharacterized domain DUF2087. At this point, they are distinct from GIY-YIG homing endonucleases, which typically contain a variety of C-terminally fused nuclease-associated modular DNA-binding domains (NUMODs). Moreover, some key residues relevant to catalysis in GIY-YIG endonucleases are mutanted or absent in this family, which suggests that members in this family might lose the catalytic function that GIY-YIG endonucleases possess. This family also includes many uncharacterized hypothetical proteins that consist of a standalone GIY-YIG like domain.	2.06878e-40
CP019651.1\|AVF22074.1\|2026513_2027095_+\|transcriptional-regulator-like-protein	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	6.06444e-12
CP019651.1\|AVF22075.1\|2027189_2028056_+\|cystine-binding-periplasmic-protein	gnl\|CDD\|270431	cd13713, PBP2_Cystine_like_1, Substrate binding domain of putative ABC transporters involved in cystine import; the type 2 periplasmic binding protein fold. This group contains uncharacterized periplasmic cystine-binding domain of ATP-binding cassette (ABC) transporters. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.93477e-78
CP019651.1\|AVF22078.1\|2030255_2030465_+\|cyanate-hydratase-CynS	gnl\|CDD\|235079	PRK02866, PRK02866, cyanate hydratase; Validated.	3.98684e-48
CP019651.1\|AVF22084.1\|2034332_2034893_-\|acyl-CoA-O-methyltransferase-like-protein	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	7.84028e-29
CP019651.1\|AVF22085.1\|2035162_2035795_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	8.34787e-98
CP019651.1\|AVF22086.1\|2036787_2037078_-\|transposase-like-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.38726e-19
CP019651.1\|AVF22092.1\|2041199_2041754_+\|putative-membrane-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.71031e-17

>CP019651.1|AVF22083.1|2033136_2033280_+|hypothetical-protein
MNVPKKLFYILQYLVLFIKKHYRLHFSKKMRFFSDEFTYYLLTFAEC
>CP019651.1|AVF22082.1|2032826_2033021_+|hypothetical-protein
MFELIASGISAENAAQVINAVFNGLSIVSALSLCAGIAGGAAWFLSNGIGYMIKWAGKKTIIDW
>CP019651.1|AVF22081.1|2032372_2032798_+|hypothetical-protein
MLLLSIAFVISAKMLKIVFKNESILKNKKKILKTYLVSNVLLIFAAFIEALKIGDRKLINEIYFVSIGSKLIFSTVAVLTLISATSWNFIFASVGAIILYIIYFFANKQNTISERTRKVIARGDECLRIYSYGSRGFMPCL
>CP019651.1|AVF22080.1|2032019_2032211_+|hypothetical-protein
MNMKAYISVGHKAAIFLIGLSILVGFIYGFVFEDTDQIKTIGFDGLNVLETFFQIFPIILSLV
>CP019651.1|AVF22079.1|2030713_2030857_-|hypothetical-protein
MHLWHHFKNEQYWYGVTNPVFDLTLHTYKDGKEVEKSGTTRNMEKLE
>CP019651.1|AVF22078.1|2030255_2030465_+|cyanate-hydratase-CynS
MPPTDPLLYRFYEILLVYGPGMKEIIHEKFGDGIMSAIDFEMDIKRVPDPKGDRVLMMLNGKFLPYKKF
>CP019651.1|AVF22077.1|2029548_2029971_+|peroxiredoxin,-OsmC-subfamily
MKVTTTWQGKRAFTSVGPSGYSVTMDATAAYGGDGKGATPMELILAGLAGCMGIDITMILRSTLDTIQSIEIEAEGTRDEEPPKGFTAIDLVFKINGDVPDHRIWRAIELGKEKYCAVSDSLKADIRYKLILNGKEAVKP
>CP019651.1|AVF22076.1|2028757_2029504_+|glutamine-transport-ATP-binding-protein-GlnQ
MIQTAGLTKSFQDTVVLKDINLQVKQNEIVVLLGPSGSGKSTLLRCINGLEELSGGTVEVNGIHIDAKMPARQRRARILEIRRETGMVFQQFNLYPHKTALGNVIESLLVVKKMRREEALKIGEQLLDRVGLADKKDVYPSRLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPELVGEVLDVMQQLAKDGMTMLVVTHEMKFARKVADRIVFMDAGIIVEEADPDAFFESPQSERARKFLKILDHE
>CP019651.1|AVF22075.1|2027189_2028056_+|cystine-binding-periplasmic-protein
MKNKPRKSLILVLAAFLLVALALSGCGSSARDQAGSTPGVSDNTGNKNSRTLEQIKQSGVLKVGIMGIYAPYNFLNDKKEMDGFDADIAKEIAKKMGLKAEFVSQEFSGMIAGLQAGKFDTVISQMTITEDRQKQMDFTEPYITNQVKVIVKQDNNSITKLEDFKGKNIGVGLGTNDEAYLRNEALPKVGNFTIKTYDDVITSLQDLNNGRIDATINNMYALKPIVEKNGFKIKVVGEAVKSDKAAIAVTKGNTELRDALNQALKDLKADGTYKTIFTKWFGEEPPAE
>CP019651.1|AVF22074.1|2026513_2027095_+|transcriptional-regulator-like-protein
MQVALKRFATGGFHATKISDIVAEVGVAQGTFYWYFKSKEAIALELIQEGQAKLLEVIAQGYRRQAGTIQDMVHASEDLLTRLFQFAEANRYLMEMMLGGTSASEAVRKAIGDTRIAMENAFVLNIQRAKELGMLPDTIDPQVRAAFLMSLIEGVISRWLFSSPLPGNGIQQMSAQKLASETARFEFFGLLGI
>CP019651.1|AVF22084.1|2034332_2034893_-|acyl-CoA-O-methyltransferase-like-protein
MQKQICLLLSFTQSREVALLTCKDERLKGYFGNGTLGEYSSIWLARTLPEDGQLITLEFDPKHTKVAEENIRNAGLDYKIEVITDPALETLPTLKGRGFSDFDLIFIDADKLNNPYYLKWALGFPDQVRLLIIGDNVHNEDVIENNSDDINVHEVRQFIDLLYEESHIDSTAIQTVGIKGYDGFVL
>CP019651.1|AVF22085.1|2035162_2035795_+|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family
MNLCFQDVLTEEKQVRELIGNSSEVAKHKSIHHIDSYCREFIAKTPLIFISTSDKEGNCDVSPRGDAAGFVLVLDDKHLVIPERPGNRRIDSVRNILSSPRIGLIFLIPGLEETLRINGRACITKNPELMNRMQAREKTPLLGIGVEVEECYVHCAKAFKRSQTWEAGSWLNQDLLPKVSKMLVAHVNREDFTEEIIAKGLKESYEKRLY
>CP019651.1|AVF22086.1|2036787_2037078_-|transposase-like-protein
MLHSDRGFQYTSQKFKKILEKGNIMQSMSQVGRCIDNGPMESFWGALKCEKYYLHTYHTFEDLERDIEAYIYFYNYERLQAKLNGLSPMEFRIKAA
>CP019651.1|AVF22087.1|2037668_2037989_-|transposase-IS3/IS911-family-protein
MTKGRKTTWQERLEIVQYCLTHNQDYRKTAEQYQASCQQVYQWVKKYQDGGQEALQDGRGRKKAEEELTDADRQKLAMKKMEAEIERLRAENALLKKLEELERRGR
>CP019651.1|AVF22088.1|2038046_2038346_-|transposase-IS3/IS911-family-protein
MSKVQYNAKEKFAMIEEIESGELGLMGVAYKYGISKSTLVKWRRRYDVYGLEGLEVRTKNRSYSAELKLQAVLDYLKGELSQCDIIHKYKIASRTQLSN
>CP019651.1|AVF22089.1|2038436_2039063_-|transcriptional-regulator-like-protein
MYGVKELERLQQILFYRELDFPLEKIKQLLEGESRLGILSDQKDLLLARKQRLDRLIQTLDESIESVVKGEVMDQSSMFKGFESEQKWKNALAEHKEYLKETYGLDILEDRPIDVKDMNEKASRADRFMEEMAKALKAGMKFDDETVRGLIREHIDFLNQNVHATSAEDFALQARFFLDDDFHRNIMESRQTGLAYYLFTAAESYAVK
>CP019651.1|AVF22090.1|2039475_2039832_-|group-I-intron-endonuclease
MSRINKEHRAELQQAYKELKKRAAVYQIRNTMNGKLFIDSTLNLKTLNGEKFMLNMGTHNNRSLQQEWKEFGEDAFVFEVLEELKKTENEYVDIKDELKKLKDKWLGQVQPYGEKGYN
>CP019651.1|AVF22091.1|2039852_2040611_-|hypothetical-protein
MENPDLFWGSSLKELKQGYRELETHFVCILCGRAVEKGVIYQEYGIFYEAERFTRLHIEHTHGSVFDYLIQLDKKLTGLTDHQSSLLRLFYQGKNDSQIQQELGIGSVSTIRNHRFVLKEKERQAKVFLTMMELLKEKDRHAPEFVPLDPSAKMVDDRYNITKEENEKLLHKYFPEGTDGPLTSFRSLQEKHKLVVLKEMIKRFESGKIYTEKEVNRILAAAYEDYAILRRYLIEYRFLDRKPDGSQYWKKD
>CP019651.1|AVF22092.1|2041199_2041754_+|putative-membrane-protein
MHKTATIYQSFITFLHKIGFSMLVFKTALAAAISWWIALLFTPEYPPYLAPIAAVLIVNITVASTLIKAFYRIVGVIYGVLINLLIGSLVSNSTIAIFLSVLLGTALTSAFRLNNQIVSQVGVSAVMALAFLKTPYYGWGRIAETILGCLVAILVNVVIAPSNNLPKAARSIRKLSEISSNQIH
>CP019651.1|AVF22093.1|2043253_2046202_+|formate-dehydrogenase,-alpha-subunit
METVKFQLNGEEHETAEGTRILDFLLELGKDHPHICYSPITGPIQSCDTCMCEADGKLVRACSTTLKPGMRIRTSSEKAQIAQKEAMDRILENHMLYCTVCDNNNGNCKVHNTTEMLGIEHQSRPFRPKGYKKDMSNPFYRYDPDQCILCGRCVEACQDLQVNETLSIDWEREIPRVIWDDDKAINESSCVSCGHCVTVCPCNALMEKTMLGEAGFLTGMSEGLMNPMIDLVKAVEPGYSGIFAVSEMEAALRETRTKKTKTVCTFCGVGCSFEVWTKDRVILKIEPNEQAPVNSISTCVKGKFGWDFVNSDQRLTAPLIRRGDQFAPAGWDEAIDYIAERLGRIKEEYGGNALSFVASSKTTNEDTYLMQKLARQVFETNNVDNCSRYCQSPASDGLQNTVGYGGDSATIRDIEQAGLVIIVGANSAEAHPVLATRVKRAHKLRGQKLIVADLRKHEMAERADLFIRPKQGTDFVWLTALAKYILDQGWHDEAFLRERVNNREEYEQMIEKYTISYAEKITGIPGEQLIQTAKMICEASGTCILWGMGVTQNVGGSHTSAAISNLLLVTGNYGRTGTGAYPLRGHNNVQGACDMGALPQWLPGYQKLADDEVRQKFEKAYGVRISPEPGLTNVGMVEAIHEGRLKGMYLMGEDMVWVDSNSNNVQEALVKLDFFVVQDVFLTKTAQFADVVLPACPSLEKDGTFTNTERRIQRLYRALEPLGDSKPDWWIIQQLANRMGANWAYKHPGDVMDEIASLVPTFAGVRYSRLEHWNSQHWPVREDGTDEPLLYTQRFNFPDGKARLSTAEYIPPVGYPSDFDLIVNNGRLLEHFHETNLTGKSKGINYKLPSVFVEISSELAGKRGLEDGSLVRLVSPYGSIKLHVLVTDRVEGNHIYVPMHSHSHENAINILSGNAVDMKTSTPAYKQTRARMEIIQKEGISPLPRHNHRFARRRPQTGVQVERKWERQDYEPIADVNVNGGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019651_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019651_4

2036300-2036665

Orphan

I-C

Consensus_repeat	Method
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CRISPRCasFinder
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	PILER-CR

5 spacers

The CRISPR arrays of CP019651_4

>merge|CP019651|4|2036300-2036665|CRT,CRISPRCasFinder,PILER-CR
TGTCGCATCCTACGCGGATGCGTGGATTGAAATACATCATCTGAAACACCCTCAGGAAACAATTCCTGTCGCATCCTACGCGGATGCGTGGATTGAAATAACAATTACAAATATGCAACTGAAGCAGATGTAAATGTCGCATCCTACGCGGATGCGTGGATTGAAATCATCATCAAAATACAAACCGAATTGATTGCTATTCCCGTCGCATCCTACGCGGATGCGTGGATTGAAATGGATAATTTCCGAAAGGTTATTTTGGTTTTCAATGTCGCATCCTACGCGGATGCGTGGATTGAAATCAATTAAGCCGACCGCCATATAGCGCGGCTATGTCGCATCCTACGCGAATAGTTGAATTGCAAA

>CP019651|4|2|2036300-2036665|CRT
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACATCATCTGAAACACCCTCAGGAAACAATTCC
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	AACAATTACAAATATGCAACTGAAGCAGATGTAAA
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	CATCATCAAAATACAAACCGAATTGATTGCTATTCC
CGTCGCATCCTACGCGGATGCGTGGATTGAAAT	GGATAATTTCCGAAAGGTTATTTTGGTTTTCAA
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	CAATTAAGCCGACCGCCATATAGCGCGGCTA
TGTCGCATCCTACGCGAATAGTTGAATTGCAAA

>CP019651|4|4|2036301-2036665|CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACATCATCTGAAACACCCTCAGGAAACAATTCCT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AACAATTACAAATATGCAACTGAAGCAGATGTAAAT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CATCATCAAAATACAAACCGAATTGATTGCTATTCCC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	GGATAATTTCCGAAAGGTTATTTTGGTTTTCAAT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CAATTAAGCCGACCGCCATATAGCGCGGCTAT
GTCGCATCCTACGCGAATAGTTGAATTGCAAA

>CP019651|4|2|2036366-2036601|PILER-CR
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	AACAATTACAAATATGCAACTGAAGCAGATGTAAA
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT	CATCATCAAAATACAAACCGAATTGATTGCTATTCC
CGTCGCATCCTACGCGGATGCGTGGATTGAAAT	GGATAATTTCCGAAAGGTTATTTTGGTTTTCAA
TGTCGCATCCTACGCGGATGCGTGGATTGAAAT

Protein	Signature genes	Signature genes Name	Protein_function
CP019651.1\|AVF22079.1\|2030713_2030857_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377224
CP019651.1\|AVF22076.1\|2028757_2029504_+\|glutamine-transport-ATP-binding-protein-GlnQ	unknown	unknown	gnl\|CDD\|224051
CP019651.1\|AVF22083.1\|2033136_2033280_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22085.1\|2035162_2035795_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	unknown	unknown	gnl\|CDD\|274926
CP019651.1\|AVF22087.1\|2037668_2037989_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|379233
CP019651.1\|AVF22088.1\|2038046_2038346_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|225511
CP019651.1\|AVF22093.1\|2043253_2046202_+\|formate-dehydrogenase,-alpha-subunit	unknown	unknown	gnl\|CDD\|225918
CP019651.1\|AVF22081.1\|2032372_2032798_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22095.1\|2046712_2047516_+\|FdhD-like-protein	unknown	unknown	gnl\|CDD\|234823
CP019651.1\|AVF22091.1\|2039852_2040611_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378279
CP019651.1\|AVF22089.1\|2038436_2039063_-\|transcriptional-regulator-like-protein	unknown	unknown	gnl\|CDD\|133381
CP019651.1\|AVF22090.1\|2039475_2039832_-\|group-I-intron-endonuclease	unknown	unknown	gnl\|CDD\|198398
CP019651.1\|AVF22094.1\|2046204_2046696_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225283
CP019651.1\|AVF22078.1\|2030255_2030465_+\|cyanate-hydratase-CynS	unknown	unknown	gnl\|CDD\|235079
CP019651.1\|AVF22084.1\|2034332_2034893_-\|acyl-CoA-O-methyltransferase-like-protein	unknown	unknown	gnl\|CDD\|226607
CP019651.1\|AVF22080.1\|2032019_2032211_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22077.1\|2029548_2029971_+\|peroxiredoxin,-OsmC-subfamily	unknown	unknown	gnl\|CDD\|224679
CP019651.1\|AVF22086.1\|2036787_2037078_-\|transposase-like-protein	unknown	unknown	gnl\|CDD\|222853
CP019651.1\|AVF22082.1\|2032826_2033021_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22092.1\|2041199_2041754_+\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|226614

Protein	Function_ID	Function_description	E-value
CP019651.1\|AVF22079.1\|2030713_2030857_-\|hypothetical-protein	gnl\|CDD\|377224	pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily. This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways. This family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins.	0.000424963
CP019651.1\|AVF22076.1\|2028757_2029504_+\|glutamine-transport-ATP-binding-protein-GlnQ	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.66551e-144
CP019651.1\|AVF22095.1\|2046712_2047516_+\|FdhD-like-protein	gnl\|CDD\|234823	PRK00724, PRK00724, formate dehydrogenase accessory sulfurtransferase FdhD.	1.34538e-113
CP019651.1\|AVF22077.1\|2029548_2029971_+\|peroxiredoxin,-OsmC-subfamily	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	3.01646e-33
CP019651.1\|AVF22089.1\|2038436_2039063_-\|transcriptional-regulator-like-protein	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	9.66457e-20
CP019651.1\|AVF22088.1\|2038046_2038346_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.000117275
CP019651.1\|AVF22093.1\|2043253_2046202_+\|formate-dehydrogenase,-alpha-subunit	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
CP019651.1\|AVF22087.1\|2037668_2037989_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	5.50062e-07
CP019651.1\|AVF22091.1\|2039852_2040611_-\|hypothetical-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.68649e-28
CP019651.1\|AVF22090.1\|2039475_2039832_-\|group-I-intron-endonuclease	gnl\|CDD\|198398	cd10451, GIY-YIG_LuxR_like, GIY-YIG domain of LuxR and ArsR family transcriptional regulators, and uncharacterized hypothetical proteins found in bacteria. The family includes some bacterial LuxR and ArsR family transcriptional regulators. The a C-terminal conserved domain shows sequence similarity to the N-terminal catalytic GIY-YIG domains of intron-encoded homing endonucleases. Besides, they have an N-terminally fused transcriptional regulators module, comprising the winged helix-turn-helix (wHTH) domain and uncharacterized domain DUF2087. At this point, they are distinct from GIY-YIG homing endonucleases, which typically contain a variety of C-terminally fused nuclease-associated modular DNA-binding domains (NUMODs). Moreover, some key residues relevant to catalysis in GIY-YIG endonucleases are mutanted or absent in this family, which suggests that members in this family might lose the catalytic function that GIY-YIG endonucleases possess. This family also includes many uncharacterized hypothetical proteins that consist of a standalone GIY-YIG like domain.	2.06878e-40
CP019651.1\|AVF22094.1\|2046204_2046696_+\|hypothetical-protein	gnl\|CDD\|225283	COG2427, COG2427, Uncharacterized conserved protein [Function unknown].	9.5598e-20
CP019651.1\|AVF22078.1\|2030255_2030465_+\|cyanate-hydratase-CynS	gnl\|CDD\|235079	PRK02866, PRK02866, cyanate hydratase; Validated.	3.98684e-48
CP019651.1\|AVF22084.1\|2034332_2034893_-\|acyl-CoA-O-methyltransferase-like-protein	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	7.84028e-29
CP019651.1\|AVF22085.1\|2035162_2035795_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	8.34787e-98
CP019651.1\|AVF22086.1\|2036787_2037078_-\|transposase-like-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.38726e-19
CP019651.1\|AVF22092.1\|2041199_2041754_+\|putative-membrane-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.71031e-17

>CP019651.1|AVF22085.1|2035162_2035795_+|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family
MNLCFQDVLTEEKQVRELIGNSSEVAKHKSIHHIDSYCREFIAKTPLIFISTSDKEGNCDVSPRGDAAGFVLVLDDKHLVIPERPGNRRIDSVRNILSSPRIGLIFLIPGLEETLRINGRACITKNPELMNRMQAREKTPLLGIGVEVEECYVHCAKAFKRSQTWEAGSWLNQDLLPKVSKMLVAHVNREDFTEEIIAKGLKESYEKRLY
>CP019651.1|AVF22084.1|2034332_2034893_-|acyl-CoA-O-methyltransferase-like-protein
MQKQICLLLSFTQSREVALLTCKDERLKGYFGNGTLGEYSSIWLARTLPEDGQLITLEFDPKHTKVAEENIRNAGLDYKIEVITDPALETLPTLKGRGFSDFDLIFIDADKLNNPYYLKWALGFPDQVRLLIIGDNVHNEDVIENNSDDINVHEVRQFIDLLYEESHIDSTAIQTVGIKGYDGFVL
>CP019651.1|AVF22083.1|2033136_2033280_+|hypothetical-protein
MNVPKKLFYILQYLVLFIKKHYRLHFSKKMRFFSDEFTYYLLTFAEC
>CP019651.1|AVF22082.1|2032826_2033021_+|hypothetical-protein
MFELIASGISAENAAQVINAVFNGLSIVSALSLCAGIAGGAAWFLSNGIGYMIKWAGKKTIIDW
>CP019651.1|AVF22081.1|2032372_2032798_+|hypothetical-protein
MLLLSIAFVISAKMLKIVFKNESILKNKKKILKTYLVSNVLLIFAAFIEALKIGDRKLINEIYFVSIGSKLIFSTVAVLTLISATSWNFIFASVGAIILYIIYFFANKQNTISERTRKVIARGDECLRIYSYGSRGFMPCL
>CP019651.1|AVF22080.1|2032019_2032211_+|hypothetical-protein
MNMKAYISVGHKAAIFLIGLSILVGFIYGFVFEDTDQIKTIGFDGLNVLETFFQIFPIILSLV
>CP019651.1|AVF22079.1|2030713_2030857_-|hypothetical-protein
MHLWHHFKNEQYWYGVTNPVFDLTLHTYKDGKEVEKSGTTRNMEKLE
>CP019651.1|AVF22078.1|2030255_2030465_+|cyanate-hydratase-CynS
MPPTDPLLYRFYEILLVYGPGMKEIIHEKFGDGIMSAIDFEMDIKRVPDPKGDRVLMMLNGKFLPYKKF
>CP019651.1|AVF22077.1|2029548_2029971_+|peroxiredoxin,-OsmC-subfamily
MKVTTTWQGKRAFTSVGPSGYSVTMDATAAYGGDGKGATPMELILAGLAGCMGIDITMILRSTLDTIQSIEIEAEGTRDEEPPKGFTAIDLVFKINGDVPDHRIWRAIELGKEKYCAVSDSLKADIRYKLILNGKEAVKP
>CP019651.1|AVF22076.1|2028757_2029504_+|glutamine-transport-ATP-binding-protein-GlnQ
MIQTAGLTKSFQDTVVLKDINLQVKQNEIVVLLGPSGSGKSTLLRCINGLEELSGGTVEVNGIHIDAKMPARQRRARILEIRRETGMVFQQFNLYPHKTALGNVIESLLVVKKMRREEALKIGEQLLDRVGLADKKDVYPSRLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPELVGEVLDVMQQLAKDGMTMLVVTHEMKFARKVADRIVFMDAGIIVEEADPDAFFESPQSERARKFLKILDHE
>CP019651.1|AVF22086.1|2036787_2037078_-|transposase-like-protein
MLHSDRGFQYTSQKFKKILEKGNIMQSMSQVGRCIDNGPMESFWGALKCEKYYLHTYHTFEDLERDIEAYIYFYNYERLQAKLNGLSPMEFRIKAA
>CP019651.1|AVF22087.1|2037668_2037989_-|transposase-IS3/IS911-family-protein
MTKGRKTTWQERLEIVQYCLTHNQDYRKTAEQYQASCQQVYQWVKKYQDGGQEALQDGRGRKKAEEELTDADRQKLAMKKMEAEIERLRAENALLKKLEELERRGR
>CP019651.1|AVF22088.1|2038046_2038346_-|transposase-IS3/IS911-family-protein
MSKVQYNAKEKFAMIEEIESGELGLMGVAYKYGISKSTLVKWRRRYDVYGLEGLEVRTKNRSYSAELKLQAVLDYLKGELSQCDIIHKYKIASRTQLSN
>CP019651.1|AVF22089.1|2038436_2039063_-|transcriptional-regulator-like-protein
MYGVKELERLQQILFYRELDFPLEKIKQLLEGESRLGILSDQKDLLLARKQRLDRLIQTLDESIESVVKGEVMDQSSMFKGFESEQKWKNALAEHKEYLKETYGLDILEDRPIDVKDMNEKASRADRFMEEMAKALKAGMKFDDETVRGLIREHIDFLNQNVHATSAEDFALQARFFLDDDFHRNIMESRQTGLAYYLFTAAESYAVK
>CP019651.1|AVF22090.1|2039475_2039832_-|group-I-intron-endonuclease
MSRINKEHRAELQQAYKELKKRAAVYQIRNTMNGKLFIDSTLNLKTLNGEKFMLNMGTHNNRSLQQEWKEFGEDAFVFEVLEELKKTENEYVDIKDELKKLKDKWLGQVQPYGEKGYN
>CP019651.1|AVF22091.1|2039852_2040611_-|hypothetical-protein
MENPDLFWGSSLKELKQGYRELETHFVCILCGRAVEKGVIYQEYGIFYEAERFTRLHIEHTHGSVFDYLIQLDKKLTGLTDHQSSLLRLFYQGKNDSQIQQELGIGSVSTIRNHRFVLKEKERQAKVFLTMMELLKEKDRHAPEFVPLDPSAKMVDDRYNITKEENEKLLHKYFPEGTDGPLTSFRSLQEKHKLVVLKEMIKRFESGKIYTEKEVNRILAAAYEDYAILRRYLIEYRFLDRKPDGSQYWKKD
>CP019651.1|AVF22092.1|2041199_2041754_+|putative-membrane-protein
MHKTATIYQSFITFLHKIGFSMLVFKTALAAAISWWIALLFTPEYPPYLAPIAAVLIVNITVASTLIKAFYRIVGVIYGVLINLLIGSLVSNSTIAIFLSVLLGTALTSAFRLNNQIVSQVGVSAVMALAFLKTPYYGWGRIAETILGCLVAILVNVVIAPSNNLPKAARSIRKLSEISSNQIH
>CP019651.1|AVF22093.1|2043253_2046202_+|formate-dehydrogenase,-alpha-subunit
METVKFQLNGEEHETAEGTRILDFLLELGKDHPHICYSPITGPIQSCDTCMCEADGKLVRACSTTLKPGMRIRTSSEKAQIAQKEAMDRILENHMLYCTVCDNNNGNCKVHNTTEMLGIEHQSRPFRPKGYKKDMSNPFYRYDPDQCILCGRCVEACQDLQVNETLSIDWEREIPRVIWDDDKAINESSCVSCGHCVTVCPCNALMEKTMLGEAGFLTGMSEGLMNPMIDLVKAVEPGYSGIFAVSEMEAALRETRTKKTKTVCTFCGVGCSFEVWTKDRVILKIEPNEQAPVNSISTCVKGKFGWDFVNSDQRLTAPLIRRGDQFAPAGWDEAIDYIAERLGRIKEEYGGNALSFVASSKTTNEDTYLMQKLARQVFETNNVDNCSRYCQSPASDGLQNTVGYGGDSATIRDIEQAGLVIIVGANSAEAHPVLATRVKRAHKLRGQKLIVADLRKHEMAERADLFIRPKQGTDFVWLTALAKYILDQGWHDEAFLRERVNNREEYEQMIEKYTISYAEKITGIPGEQLIQTAKMICEASGTCILWGMGVTQNVGGSHTSAAISNLLLVTGNYGRTGTGAYPLRGHNNVQGACDMGALPQWLPGYQKLADDEVRQKFEKAYGVRISPEPGLTNVGMVEAIHEGRLKGMYLMGEDMVWVDSNSNNVQEALVKLDFFVVQDVFLTKTAQFADVVLPACPSLEKDGTFTNTERRIQRLYRALEPLGDSKPDWWIIQQLANRMGANWAYKHPGDVMDEIASLVPTFAGVRYSRLEHWNSQHWPVREDGTDEPLLYTQRFNFPDGKARLSTAEYIPPVGYPSDFDLIVNNGRLLEHFHETNLTGKSKGINYKLPSVFVEISSELAGKRGLEDGSLVRLVSPYGSIKLHVLVTDRVEGNHIYVPMHSHSHENAINILSGNAVDMKTSTPAYKQTRARMEIIQKEGISPLPRHNHRFARRRPQTGVQVERKWERQDYEPIADVNVNGGQ
>CP019651.1|AVF22094.1|2046204_2046696_+|hypothetical-protein
MAKSITTITEPVLSEKEANEKAWAEVLEELSRNSEGLRSYIRLLQELHESGIMDTMKAALQSKEELAKVIVKEMNKPNNTNTINNLMAMAGTLSMLDSDVVKKMASSVSTGFHKAREENQTEEKIGLFDLMKALKDPDINRAVRFGLNFLKGMGQSLGEKGEK
>CP019651.1|AVF22095.1|2046712_2047516_+|FdhD-like-protein
MGLPVQITRRILRVQGNEAEKTEDQIVTEYPLTLVLNDREFATLVCTPEHLEELVAGFLCSEGAISGFEDIDDLAIDENTGFAYIKAAQTRPFYEQFHSKRVISSCCGKSRQSFYFHNDRHTMKKIPESGLSIRVEECFRLMEQMQEAARTFRLTGGVHNAALCDRKGVLLFRMDIGRHNALDKIYGHCLMHQIPLHDKIMVFSGRLSSEVLLKTARIGCGIVLSKSAPTQLALDLAEELNITTVGFLRHHTFNIYTGLKRIELGHI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019651_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019651_5

2969951-2970243

TypeI

Consensus_repeat	Method
AGTTTCAATACACCATGTGTTACTGTCAAAC	CRISPRCasFinder
AGTTTCAATACACCATGTGTTACTGTCAAAC	CRT
AGTTTCAATACACCATGTGTTACTGTCAAAC	PILER-CR

4 spacers

csa3,cas2,cas1,cas4,cas3,cas5,cas7b,cas8b1

The CRISPR arrays of CP019651_5

>merge|CP019651|5|2969951-2970243|CRISPRCasFinder,CRT,PILER-CR
CGTTTCAATACACCTTGTGTTACTGTCAAACCCAATTCTTTTTGTTCACAAAGTGCTTTCATCTCCAGTTTCAATACACCATGTGTTACTGTCAAACGCCAAAGGGCGGATAATTTGAGGAGGGCTGTGTGAAGTTTCAATACACCATGTGTTACTGTCAAACCTACTTATAACTGCTGAATACACTGTCGCTACTGCAGTTTCAATACACCATGTGTTACTGTCAAACAAGGGCAGGTACGACGCCCACGCGGCGGGCAATAGTTTCAATACACCATGTGTTACTGTCAAAC

>CP019651|5|5|2969951-2970243|CRISPRCasFinder
CGTTTCAATACACCTTGTGTTACTGTCAAAC	CCAATTCTTTTTGTTCACAAAGTGCTTTCATCTCC
AGTTTCAATACACCATGTGTTACTGTCAAAC	GCCAAAGGGCGGATAATTTGAGGAGGGCTGTGTGA
AGTTTCAATACACCATGTGTTACTGTCAAAC	CTACTTATAACTGCTGAATACACTGTCGCTACTGC
AGTTTCAATACACCATGTGTTACTGTCAAAC	AAGGGCAGGTACGACGCCCACGCGGCGGGCAAT
AGTTTCAATACACCATGTGTTACTGTCAAAC

>CP019651|5|3|2969951-2970243|CRT
CGTTTCAATACACCTTGTGTTACTGTCAAAC	CCAATTCTTTTTGTTCACAAAGTGCTTTCATCTCC
AGTTTCAATACACCATGTGTTACTGTCAAAC	GCCAAAGGGCGGATAATTTGAGGAGGGCTGTGTGA
AGTTTCAATACACCATGTGTTACTGTCAAAC	CTACTTATAACTGCTGAATACACTGTCGCTACTGC
AGTTTCAATACACCATGTGTTACTGTCAAAC	AAGGGCAGGTACGACGCCCACGCGGCGGGCAAT
AGTTTCAATACACCATGTGTTACTGTCAAAC

>CP019651|5|3|2969952-2970243|PILER-CR
GTTTCAATACACCTTGTGTTACTGTCAAACC	CAATTCTTTTTGTTCACAAAGTGCTTTCATCTCCA
GTTTCAATACACCATGTGTTACTGTCAAACG	CCAAAGGGCGGATAATTTGAGGAGGGCTGTGTGAA
GTTTCAATACACCATGTGTTACTGTCAAACC	TACTTATAACTGCTGAATACACTGTCGCTACTGCA
GTTTCAATACACCATGTGTTACTGTCAAACA	AGGGCAGGTACGACGCCCACGCGGCGGGCAATA
GTTTCAATACACCATGTGTTACTGTCAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP019651.1\|AVF22962.1\|2967915_2968212_+\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22963.1\|2968728_2969016_+\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|366690
CP019651.1\|AVF22959.1\|2964428_2964761_+\|mRNA-interferase-NdoA	unknown	unknown	gnl\|CDD\|182138
CP019651.1\|AVF22961.1\|2965299_2967810_+\|coenzyme-A-disulfide-reductase	unknown	unknown	gnl\|CDD\|163244
CP019651.1\|AVF22967.1\|2971739_2972234_-\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|366863
CP019651.1\|AVF22973.1\|2980389_2980512_+\|transposase-IS3/IS911-family-protein	unknown	unknown	unknown
CP019651.1\|AVF22969.1\|2975022_2975823_-\|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI	cas5	cls001430_cas5_CAS-I-B	gnl\|CDD\|131641
CP019651.1\|AVF22966.1\|2970709_2971720_-\|CRISPR-associated-endonuclease-Cas1	cas1	cd09722_cas1_CAS-I-B	gnl\|CDD\|187853
CP019651.1\|AVF22964.1\|2969063_2969879_+\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019651.1\|AVF22968.1\|2972230_2974909_-\|helicase-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224124
CP019651.1\|AVF22971.1\|2976814_2978722_-\|hypothetical-protein	cas8b1	mkCas0106_cas8b1_CAS-I-B	unknown
CP019651.1\|AVF22958.1\|2964165_2964435_+\|Antitoxin-MazE	unknown	unknown	gnl\|CDD\|225215
CP019651.1\|AVF22957.1\|2963514_2963847_-\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22974.1\|2981230_2981593_-\|integrase-catalytic-region	unknown	unknown	unknown
CP019651.1\|AVF22955.1\|2962208_2962796_-\|transposase-like-protein	unknown	unknown	gnl\|CDD\|222853
CP019651.1\|AVF22972.1\|2978742_2979447_-\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22965.1\|2970420_2970702_-\|CRISPR-associated-endoribonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP019651.1\|AVF22960.1\|2965012_2965303_+\|transcriptional-regulator-like-protein	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP019651.1\|AVF22956.1\|2963045_2963327_-\|transposase	unknown	unknown	gnl\|CDD\|225511
CP019651.1\|AVF22970.1\|2975859_2976822_-\|CRISPR-associated-protein,-family	cas7b	pfam05107_cas7b_CAS-I-B:CAS-I-C	gnl\|CDD\|377458

Protein	Function_ID	Function_description	E-value
CP019651.1\|AVF22963.1\|2968728_2969016_+\|transposase-IS3/IS911-family-protein	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	2.12019e-14
CP019651.1\|AVF22959.1\|2964428_2964761_+\|mRNA-interferase-NdoA	gnl\|CDD\|182138	PRK09907, PRK09907, endoribonuclease MazF.	1.54304e-36
CP019651.1\|AVF22961.1\|2965299_2967810_+\|coenzyme-A-disulfide-reductase	gnl\|CDD\|163244	TIGR03385, Coenzyme_A_disulfide_reductase, CoA-disulfide reductase. Members of this protein family are CoA-disulfide reductase (EC 1.8.1.14), as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol. [Cellular processes, Detoxification].	2.26115e-159
CP019651.1\|AVF22967.1\|2971739_2972234_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|366863	pfam01930, Cas_Cas4, Domain of unknown function DUF83. This domain has no known function. The domain contains three conserved cysteines at its C-terminus.	1.07351e-48
CP019651.1\|AVF22969.1\|2975022_2975823_-\|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI	gnl\|CDD\|131641	TIGR02592, hypothetical_protein_CTC_01466, CRISPR-associated protein Cas5, subtype I-B/HMARI. This is a CRISPR-associated protein unique to the hmari subtype of cas genes and CRISPR repeat, which is the only subtype present in Haloarcula marismortui ATCC 43049. The hmari type, though uncommon, is also found in the Aquificae, Thermotogae, Firmicutes, and Dictyoglomi.	2.66133e-32
CP019651.1\|AVF22966.1\|2970709_2971720_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187853	cd09722, Cas1_I-B, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.67035e-131
CP019651.1\|AVF22964.1\|2969063_2969879_+\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	6.08435e-80
CP019651.1\|AVF22968.1\|2972230_2974909_-\|helicase-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	1.92885e-27
CP019651.1\|AVF22958.1\|2964165_2964435_+\|Antitoxin-MazE	gnl\|CDD\|225215	COG2336, MazE, Growth regulator [Signal transduction mechanisms].	1.40855e-22
CP019651.1\|AVF22970.1\|2975859_2976822_-\|CRISPR-associated-protein,-family	gnl\|CDD\|377458	pfam05107, Cas_Cas7, CRISPR-associated protein Cas7. CRISPR-associated protein Cas7 is one of the components of the type I-B cascade-like antiviral defense complex. In Haloferax volcanii, Cas5, Cas6 and Cas7 form a small complex that aids the stability of CRISPR-derived RNA.	3.64746e-33
CP019651.1\|AVF22955.1\|2962208_2962796_-\|transposase-like-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.87643e-33
CP019651.1\|AVF22965.1\|2970420_2970702_-\|CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	5.10639e-27
CP019651.1\|AVF22960.1\|2965012_2965303_+\|transcriptional-regulator-like-protein	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	9.84683e-15
CP019651.1\|AVF22956.1\|2963045_2963327_-\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.51286e-09

>CP019651.1|AVF22964.1|2969063_2969879_+|transposase
MCALLSVSKSGYYEWTKRKESERLKRRKKLERWIRRTFFDSRQLYGSPKVWYALKKQGIHVSQKTVARIMKELGLRSRTVKKYKATTNSKHNLPVAENVLNQSFAAEKPNQVWMADITYIPTDEGWLYLASLEDLCTRKIVGFHMGERMTRELCLRALDQAYRHQRPKGTVLHHSDRGSQYASSDYQTQLRQYGMTGNMSRKGNCYDNACIESFHNVLKKELVYLHKFKTRKEAKEKIFEYITCFYNGKRIHSSIGYLTPNQCEHMICLAA
>CP019651.1|AVF22963.1|2968728_2969016_+|transposase-IS3/IS911-family-protein
MTKKYDKEFKLQSVRLIQEEGKSVAQVAREMGLHENTLYRWIAEFKNAGNQAFPGSGQLKPEDKALRDLQKRIRNLEEENDILKKTMHYFAKDRR
>CP019651.1|AVF22962.1|2967915_2968212_+|hypothetical-protein
MKSSFLGIIGVAILALGIGTAVYASEAKPYSSKEMIPDMEQRYPYMDMERMPTRMEQRHPHMDMKQMCTHMEQRHPHMDMEQRRTHMEQRHPQLNYSE
>CP019651.1|AVF22961.1|2965299_2967810_+|coenzyme-A-disulfide-reductase
MNKKVLIVGGVAGGASAAARLRRLDEDTEIVMFEKGEYVSFANCGLPYYIGDTIQDREKLFVQTPEAMRRRFNIDVRVNSEVTGIDPHTKTIRVQSKERGVYEETYDYLILSPGAKPVRPPLPGIDSVRIHTLRNIPDTDRIKASVTEEGTRSAVVIGGGFIGVEMAENLREIGLDVTLVEAGLQILAPFDPEMAGVLSKELEEQGVRLIIENSVQSFHDKDNYIETVLANGSVLQSDIVILAIGVSPDTAFLRDSGLELGPKGHIIVNNKLETNLDGVYAVGDAVEITDFVTKQKTAIPLAGPANKQGRIAADNICGLDTIYEGSQGTSILKVFGLTGAATGSNEKTLQKLGLPYKVNYVHPNSHASYYPGAAPLTIKLIFNDKGTVLGSQIVGYDGVDKRIDDIATVIRLRGTVTDLTELELAYAPPYSSAKDPVNMAGYTAENILAGRTEVFTPGDLLKRNKETTILVDVRTEMEHRNGHIEGSLSISIDDLRSRMHELDPNKEIWVYCQVGLRGYTASRILIQHGFKVKNLTGGYKIYQMAQFKPGKVKPPVTPSRLQSETESETVYLSHRWEQQDHTSSAKQPLSFDESLDACGLCCPGPLIQVKQQMDRLQDGQVLKVTASDPGFYEDIQAWAGMCGNPLLQISKLNDGTVEAYIQKESTSAAPVEKTTSQTPIPENSTMVVFSGDLDKAIASFIIANGAASSGKKVTIFFTFWGLNIIRKSEKIPVSKSLIGKMFGAMMPRGSRKLALSKMNMMGMGAKMIRSVMKKNNVSSLEELMETALQQGVEIVACQMSMDVMGIKKEELIDGVRVGGVGYYLGKADKSGINLFI
>CP019651.1|AVF22960.1|2965012_2965303_+|transcriptional-regulator-like-protein
MNNDFERYNEAAELLKALAHPVRLCIVKGLMEKGSCNVSFMQNCLGLPQSTVSQHLQKLRALGIVAAHRTGLEINYSVENEKVKQLVQIFFREESS
>CP019651.1|AVF22959.1|2964428_2964761_+|mRNA-interferase-NdoA
MVKRAPDQGDIVYMDFNPQIGHEQAGRRPGLVVSPTSFNRVTGFIVVCPITRTVRNYPYEVPLPSDLMTEGVVLAHQVKSLDWKARKAEVREKVPQEIIDDVLDLIHTFL
>CP019651.1|AVF22958.1|2964165_2964435_+|Antitoxin-MazE
MGKDRERMSVMSTIVSKWGNSLAIRIPSNLAESLNIKEGSEVELSIMDSTLTIKPKKRKPTLEELLAKITDGNHHEEIDFGKPEGNEVW
>CP019651.1|AVF22957.1|2963514_2963847_-|hypothetical-protein
MKILSKALLSSIAAFGLLAGSVSTQTPGQQAITSQQAGVKSTIVNPLIKLKVGWSTWIGMPGSKVVLVSGEGVVSLDQYGKVVGLSPGNATVYNYAADGNLYINHIQVTY
>CP019651.1|AVF22956.1|2963045_2963327_-|transposase
MPRQRRTFTDDFKRQMVQLHENGKSRAAIINEYELSASALNRWIKQANQSGSFSEKDNRSLEENELIALRKENQRLKMEVDILKQAALIMGRK
>CP019651.1|AVF22955.1|2962208_2962796_-|transposase-like-protein
MFPRTRWLNTNHTKPHVTESQQPNELNRKFEQSEAKRVVVSDLTYVKVKNRWHYICIFVDLFNREIIGSSAGPKKNAALVARAFSSVQGDLRQIQLFHTDRGSEFKNKLIDETLATFQIGRSLSMKGCHYDNAVAEAAFKVMKTEFISQMNFQSLQHLILELNDYINWYNRHRIHGTLGYMSPINYRRLSLKKAV
>CP019651.1|AVF22965.1|2970420_2970702_-|CRISPR-associated-endoribonuclease-Cas2
MAKNYHYVILVYDIGEKRVGKVFKICKRYLVHFQKSVFRGEITPSNLLKLRNDLKKVIDKDSDFIAIFKMTGDYVFDEEVIGVRSNNQESLLL
>CP019651.1|AVF22966.1|2970709_2971720_-|CRISPR-associated-endonuclease-Cas1
MSKSVPSTRYIRTPGTLGREDNSLTFRSEKGIVHLPIHGLKELYLLNEISLNSKLFSFLSMAGITVHFFDYYGHFRGTFYPKEARVSGKVKLLQAKACLERRMPIAISLVYAIASNIHEVLYHYYKHGNKEIKPYLDWLKKDVPHLLEKIQDIPRLLSLEGEIWRRFFETFKTFLPDDFRMSKRVKRPPDNPLNALISFGNTILYTKTISQIYHTHLDQTISFLHEPSDRRFSLSLDLSEPFKPLIVYRTIFEVVNNRRIQVGKHFEKKYNYCILNEAGRDVFISALEERMQQVFEHKTLKRKLSYLTAIKYDAYKLKKHIVEGTPFMPFLEKDRR
>CP019651.1|AVF22967.1|2971739_2972234_-|CRISPR-associated-protein-Cas4
MKITGTVVNYYVHCRRQCWLVAHGMNFEDDSEDVRIGRVQHEIRSEGKKNTEIAIEGIKVDKLTDQYVVEVKKSDADVEATKWQTLYYLYVLRQKGMERQGRLEFIERNKQASKKMALELDIETEQELLVLLEKIEQYLQQEQPDPPVLEKKCKRCAYYAYCFV
>CP019651.1|AVF22968.1|2972230_2974909_-|helicase-Cas3
MTVTYSVSIRTWMVSETADLLWAHTPQKGQNAAPETLIQHSELVMQFAQQLMGCNGVNSAIERALDRLKIDSESLDTSIRERIRNYFIQAIYLHDLGKVNPAYQRVRLRNEQMGEMGKFGDSHHSLLSALLYLHIHLRELRSELSLDPYAFSPNRKLNRRMYKFLRHVLYTFAYVISRHHTCLTYVEERLGGQFTEFESKLSALHERIIQNPEYVHFYKYKKELIEETSLFNDIIADKRGRLNHLHSAFPFYILVKLLYSTLVASDFRAAYAYLEGKSPRFHYFGEDLPIHPMIKAYRNTPVYQGIEQFRKNPESTKISPINRLRSALFDETENRLLEQIQENVFYLEAPTGSGKTNMSIHLALQLLNSNQGLNKLIYIFPFNSLIEQTKETLDRIFDKPELGNYRVEVINSITPMVTKAEAEGEQKEPDIDYRAVLLQRQLLQYPVTLTSHVNFFHYLFGTGRESNLAFAHLCNSVIILDEIQSYRNDLWKEIIHFMRAYADILHIKFIIMSATLPELDLLMEHKEAEPEISTCLLVKDRNLYFRDPLFCNRVHLHFDLLKKGKIDQDVLIKQVLEVLEEQKANGKTTRLLIEFISKKSARLFYKEIRQHVGEIPVFELTGDDSHFYRKRLLEKLGKNSEGKFYLLDVIVVATQVIEAGVDIDMDVGFKDISLLDSEEQFLGRINRSCLRDDCHAYFFHMDTVRNIYRNDWRTEYDLRAEPYQHMLATKDFSGFYHLSMKRINDSRNKSDENNWEKFKRMIQDLDYRQVEEWMTLIKEKQVSLFLNYAHQTEDGSILVGEEVWNQYVDLMENRDMDYAERQVKLSQIRQTISYFTYTYSLSHGDKPGIYDRQLGSLYYVSDGTSYMETDPLTQTKKFNRALYMESERSILL
>CP019651.1|AVF22969.1|2975022_2975823_-|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI
MRALRFELKGETAFFKKPDVNVYAYFTYSHIHKVALYGLFGAIIGLGGYSQQYERNHPLTSNRRKNSEIKAVFPEFYEVFRDTSVCIVPHGDRGYFAKKIQIFNNTVGYASQEVGGVLNVREQWLEHPHWTIYVAEDEGIPQPVFDRLADYILHSKAEYCPYLGKNDHPASLTQPALVELEKPTNPPLYIDSLHRSESIRYDQEGGVKGGLQSFFKEFMPVGLNDANNGYMLEPLVFTNHEIDADTLQETDWERLYLDGERTLYFI
>CP019651.1|AVF22970.1|2975859_2976822_-|CRISPR-associated-protein,-family
MTKKKNRVVGLIGIVSRMANWNADFSGNPKTTSNGQLFGSDKALKYSIKRLWEEQGKKVLYIRSYKLGGGKGELEKIQPRDLAERYEYLFGEAVSKSSPEVLNRLFQCVDVMNFGATFAVKEQNIGLTGPVQIGQGFNKYEESNIEVQDILSPFRNSNEKSEDKDATSIGKKITADECHYIYPFSVNPNCYDNFVGLPGMEGFEGYSEEAYEAFKEGALIGATILNTNSKSGAENAFSLFISFKDGLPAYLPNLDPYVKVYKQEGMTVYDLSAIIPILRDVQAYIEKIELYVNPYATKVQLDYPGIETLNIFTRQEVALV
>CP019651.1|AVF22971.1|2976814_2978722_-|hypothetical-protein
MLKDMAESYRLAARKFPNLIFDQHMLKEGLYLRLRVDKSWEEQSEAFEDNHLIIQPKEEQHPENVDLYDWFTRRDYYSSLVAMNKPVDSKKQIHSNNPFTFYVKREVFLGEKPGKFSMQENVTRFLNMTYPDEVERKWKVLLPAGKVKNTQVIETFFMQTEYTDALHYLASDFRQKWMERITHWYANNLNALTDFLRQIPFKKYVKLYFTTDFPTSSDQLPCEQVYAYEYTLYTIPKIFNSNDYNQMIEGTIVGLPSFNISMNSKKPFLEHRTMRVQVPIRVSLEQAMLIKQTAEWLMSKPKYTTNKFAYTSDFTFEQSIEPEGTFHIFVDGKDNEVVSFENVPFPSEFNLFIYQKNILHLRDHEGNLKPDKELKSTEEVQKAISSSFFRGRMSGQFLYDEPKARSKDFTSVMVALFMQSKQAFHDWLFKGTAISLRPLFSRLTLRLLEEQLLYVEPAQQSQNKKVLDLRWLADAFNLRLCIADYLNKEGSRTMTNRITEVMTSLKQKFSQDGMSVCGNDDEFYFLTGQLAFYLKSQSETQNKTGDLLSPFLVAKRSEQLKKKLEDAYILHKHKIKLNHAKFNKAFSNIFGYKPDGHELTGDAREMFLAGLFADNWFYEKPEKKKNDDKGADYSD
>CP019651.1|AVF22972.1|2978742_2979447_-|hypothetical-protein
MFYELKATVLLKQEVHYLHVPERIGSWISRAALNDPVLKQEHYSTGYKHIVYGNPYPREKDGIYKKDRVYVITIRSSLNETLQRIDRSLHILQEDNYFQLLALSGIQTKNPRHILELVTVTPAIVTVDGKPWVPGGNIELLLSRIHANTEKKFHSLNPDQKVRLDHYFAHGVQVENSKPIALAYKGRKLLGNKIRLFIQEDPVSQQLAHTALGSGILEKNSVLGAGFCLAKELD
>CP019651.1|AVF22973.1|2980389_2980512_+|transposase-IS3/IS911-family-protein
MRRTKYSNEFKVQVVKEALETRNKAAVARRYELTSNMLHR
>CP019651.1|AVF22974.1|2981230_2981593_-|integrase-catalytic-region
MVFEKKTNEVDKLKKEYENKQEHLEKLVGQLTVEVDWLKKNLVLNKSLEDRKVMVERDNTKITVKRQANRTSVSRHRKGHRESEENVQIMHHIDEIYMKHPYFGYRRMIQFFEIKIQNQF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019651_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019651_6

2979794-2980022

TypeI

Consensus_repeat	Method
GTTTCAATACACCTCGTGTTACTATCAAAC	CRISPRCasFinder

3 spacers

cas8b1,cas7b,cas5,cas3,cas4,cas1,cas2

The CRISPR arrays of CP019651_6

>merge|CP019651|6|2979794-2980022|CRISPRCasFinder
AGTTCAATATACCTTGTGTTACTTTCAAACATACGGAAACGGAAGAGTATTGGGAAATGGAAGAACTGTTTCAATACACCTCGTGTTACTATCAAACGGAATGATTCGGTATTCGTCTGCCTGATACTTTTCCGTTTCAATACACCTCGTGTTACTATCAAACGGCAAATGGTGGACGGACACGGAATCACCCACACCAGTTTCAATACACCTCGTGTTACTATCAAAC

>CP019651|6|6|2979794-2980022|CRISPRCasFinder
AGTTCAATATACCTTGTGTTACTTTCAAAC	ATACGGAAACGGAAGAGTATTGGGAAATGGAAGAACT
GTTTCAATACACCTCGTGTTACTATCAAAC	GGAATGATTCGGTATTCGTCTGCCTGATACTTTTCC
GTTTCAATACACCTCGTGTTACTATCAAAC	GGCAAATGGTGGACGGACACGGAATCACCCACACCA
GTTTCAATACACCTCGTGTTACTATCAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP019651.1\|AVF22977.1\|2983329_2983617_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
CP019651.1\|AVF22963.1\|2968728_2969016_+\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|366690
CP019651.1\|AVF22975.1\|2982039_2982291_+\|DNA-polymerase-IV-2	unknown	unknown	gnl\|CDD\|235104
CP019651.1\|AVF22968.1\|2972230_2974909_-\|helicase-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224124
CP019651.1\|AVF22967.1\|2971739_2972234_-\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|366863
CP019651.1\|AVF22982.1\|2987969_2989136_+\|amidohydrolase-like-protein	unknown	unknown	gnl\|CDD\|349941
CP019651.1\|AVF22978.1\|2983679_2983931_-\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22969.1\|2975022_2975823_-\|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI	cas5	cls001430_cas5_CAS-I-B	gnl\|CDD\|131641
CP019651.1\|AVF22976.1\|2982522_2982639_-\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22966.1\|2970709_2971720_-\|CRISPR-associated-endonuclease-Cas1	cas1	cd09722_cas1_CAS-I-B	gnl\|CDD\|187853
CP019651.1\|AVF22964.1\|2969063_2969879_+\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019651.1\|AVF22981.1\|2986132_2987785_+\|Beta-xylosidase	unknown	unknown	gnl\|CDD\|226190
CP019651.1\|AVF22971.1\|2976814_2978722_-\|hypothetical-protein	cas8b1	mkCas0106_cas8b1_CAS-I-B	unknown
CP019651.1\|AVF22973.1\|2980389_2980512_+\|transposase-IS3/IS911-family-protein	unknown	unknown	unknown
CP019651.1\|AVF22970.1\|2975859_2976822_-\|CRISPR-associated-protein,-family	cas7b	pfam05107_cas7b_CAS-I-B:CAS-I-C	gnl\|CDD\|377458
CP019651.1\|AVF22972.1\|2978742_2979447_-\|hypothetical-protein	unknown	unknown	unknown
CP019651.1\|AVF22965.1\|2970420_2970702_-\|CRISPR-associated-endoribonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP019651.1\|AVF22974.1\|2981230_2981593_-\|integrase-catalytic-region	unknown	unknown	unknown
CP019651.1\|AVF22980.1\|2985305_2985815_-\|transposase	unknown	unknown	gnl\|CDD\|315923
CP019651.1\|AVF22979.1\|2984288_2985302_+\|transcriptional-regulatory-protein	unknown	unknown	gnl\|CDD\|197666

Protein	Function_ID	Function_description	E-value
CP019651.1\|AVF22963.1\|2968728_2969016_+\|transposase-IS3/IS911-family-protein	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	2.12019e-14
CP019651.1\|AVF22975.1\|2982039_2982291_+\|DNA-polymerase-IV-2	gnl\|CDD\|235104	PRK03103, PRK03103, DNA polymerase IV; Reviewed.	3.57129e-20
CP019651.1\|AVF22966.1\|2970709_2971720_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187853	cd09722, Cas1_I-B, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.67035e-131
CP019651.1\|AVF22967.1\|2971739_2972234_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|366863	pfam01930, Cas_Cas4, Domain of unknown function DUF83. This domain has no known function. The domain contains three conserved cysteines at its C-terminus.	1.07351e-48
CP019651.1\|AVF22969.1\|2975022_2975823_-\|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI	gnl\|CDD\|131641	TIGR02592, hypothetical_protein_CTC_01466, CRISPR-associated protein Cas5, subtype I-B/HMARI. This is a CRISPR-associated protein unique to the hmari subtype of cas genes and CRISPR repeat, which is the only subtype present in Haloarcula marismortui ATCC 43049. The hmari type, though uncommon, is also found in the Aquificae, Thermotogae, Firmicutes, and Dictyoglomi.	2.66133e-32
CP019651.1\|AVF22977.1\|2983329_2983617_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	4.08422e-18
CP019651.1\|AVF22964.1\|2969063_2969879_+\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	6.08435e-80
CP019651.1\|AVF22981.1\|2986132_2987785_+\|Beta-xylosidase	gnl\|CDD\|226190	COG3664, XynB, Beta-xylosidase [Carbohydrate transport and metabolism].	8.39773e-29
CP019651.1\|AVF22980.1\|2985305_2985815_-\|transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.6551e-40
CP019651.1\|AVF22982.1\|2987969_2989136_+\|amidohydrolase-like-protein	gnl\|CDD\|349941	cd08021, M20_Acy1_YhaA-like, M20 Peptidase aminoacylase 1 subfamily, includes Bacillus subtilis YhaA and Staphylococcus aureus amidohydrolase, SACOL0085. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine). This family includes Staphylococcus aureus amidohydrolase, SACOL0085, which contains two manganese ions in the active site, and forms a homotetramer with variations in interdomain orientation which possibly plays a role in the regulation of catalytic activity.	1.37234e-178
CP019651.1\|AVF22970.1\|2975859_2976822_-\|CRISPR-associated-protein,-family	gnl\|CDD\|377458	pfam05107, Cas_Cas7, CRISPR-associated protein Cas7. CRISPR-associated protein Cas7 is one of the components of the type I-B cascade-like antiviral defense complex. In Haloferax volcanii, Cas5, Cas6 and Cas7 form a small complex that aids the stability of CRISPR-derived RNA.	3.64746e-33
CP019651.1\|AVF22968.1\|2972230_2974909_-\|helicase-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	1.92885e-27
CP019651.1\|AVF22965.1\|2970420_2970702_-\|CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	5.10639e-27
CP019651.1\|AVF22979.1\|2984288_2985302_+\|transcriptional-regulatory-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.79893e-28

>CP019651.1|AVF22972.1|2978742_2979447_-|hypothetical-protein
MFYELKATVLLKQEVHYLHVPERIGSWISRAALNDPVLKQEHYSTGYKHIVYGNPYPREKDGIYKKDRVYVITIRSSLNETLQRIDRSLHILQEDNYFQLLALSGIQTKNPRHILELVTVTPAIVTVDGKPWVPGGNIELLLSRIHANTEKKFHSLNPDQKVRLDHYFAHGVQVENSKPIALAYKGRKLLGNKIRLFIQEDPVSQQLAHTALGSGILEKNSVLGAGFCLAKELD
>CP019651.1|AVF22971.1|2976814_2978722_-|hypothetical-protein
MLKDMAESYRLAARKFPNLIFDQHMLKEGLYLRLRVDKSWEEQSEAFEDNHLIIQPKEEQHPENVDLYDWFTRRDYYSSLVAMNKPVDSKKQIHSNNPFTFYVKREVFLGEKPGKFSMQENVTRFLNMTYPDEVERKWKVLLPAGKVKNTQVIETFFMQTEYTDALHYLASDFRQKWMERITHWYANNLNALTDFLRQIPFKKYVKLYFTTDFPTSSDQLPCEQVYAYEYTLYTIPKIFNSNDYNQMIEGTIVGLPSFNISMNSKKPFLEHRTMRVQVPIRVSLEQAMLIKQTAEWLMSKPKYTTNKFAYTSDFTFEQSIEPEGTFHIFVDGKDNEVVSFENVPFPSEFNLFIYQKNILHLRDHEGNLKPDKELKSTEEVQKAISSSFFRGRMSGQFLYDEPKARSKDFTSVMVALFMQSKQAFHDWLFKGTAISLRPLFSRLTLRLLEEQLLYVEPAQQSQNKKVLDLRWLADAFNLRLCIADYLNKEGSRTMTNRITEVMTSLKQKFSQDGMSVCGNDDEFYFLTGQLAFYLKSQSETQNKTGDLLSPFLVAKRSEQLKKKLEDAYILHKHKIKLNHAKFNKAFSNIFGYKPDGHELTGDAREMFLAGLFADNWFYEKPEKKKNDDKGADYSD
>CP019651.1|AVF22970.1|2975859_2976822_-|CRISPR-associated-protein,-family
MTKKKNRVVGLIGIVSRMANWNADFSGNPKTTSNGQLFGSDKALKYSIKRLWEEQGKKVLYIRSYKLGGGKGELEKIQPRDLAERYEYLFGEAVSKSSPEVLNRLFQCVDVMNFGATFAVKEQNIGLTGPVQIGQGFNKYEESNIEVQDILSPFRNSNEKSEDKDATSIGKKITADECHYIYPFSVNPNCYDNFVGLPGMEGFEGYSEEAYEAFKEGALIGATILNTNSKSGAENAFSLFISFKDGLPAYLPNLDPYVKVYKQEGMTVYDLSAIIPILRDVQAYIEKIELYVNPYATKVQLDYPGIETLNIFTRQEVALV
>CP019651.1|AVF22969.1|2975022_2975823_-|CRISPR-associated-protein-Cas5,-subtype-I-B/HMARI
MRALRFELKGETAFFKKPDVNVYAYFTYSHIHKVALYGLFGAIIGLGGYSQQYERNHPLTSNRRKNSEIKAVFPEFYEVFRDTSVCIVPHGDRGYFAKKIQIFNNTVGYASQEVGGVLNVREQWLEHPHWTIYVAEDEGIPQPVFDRLADYILHSKAEYCPYLGKNDHPASLTQPALVELEKPTNPPLYIDSLHRSESIRYDQEGGVKGGLQSFFKEFMPVGLNDANNGYMLEPLVFTNHEIDADTLQETDWERLYLDGERTLYFI
>CP019651.1|AVF22968.1|2972230_2974909_-|helicase-Cas3
MTVTYSVSIRTWMVSETADLLWAHTPQKGQNAAPETLIQHSELVMQFAQQLMGCNGVNSAIERALDRLKIDSESLDTSIRERIRNYFIQAIYLHDLGKVNPAYQRVRLRNEQMGEMGKFGDSHHSLLSALLYLHIHLRELRSELSLDPYAFSPNRKLNRRMYKFLRHVLYTFAYVISRHHTCLTYVEERLGGQFTEFESKLSALHERIIQNPEYVHFYKYKKELIEETSLFNDIIADKRGRLNHLHSAFPFYILVKLLYSTLVASDFRAAYAYLEGKSPRFHYFGEDLPIHPMIKAYRNTPVYQGIEQFRKNPESTKISPINRLRSALFDETENRLLEQIQENVFYLEAPTGSGKTNMSIHLALQLLNSNQGLNKLIYIFPFNSLIEQTKETLDRIFDKPELGNYRVEVINSITPMVTKAEAEGEQKEPDIDYRAVLLQRQLLQYPVTLTSHVNFFHYLFGTGRESNLAFAHLCNSVIILDEIQSYRNDLWKEIIHFMRAYADILHIKFIIMSATLPELDLLMEHKEAEPEISTCLLVKDRNLYFRDPLFCNRVHLHFDLLKKGKIDQDVLIKQVLEVLEEQKANGKTTRLLIEFISKKSARLFYKEIRQHVGEIPVFELTGDDSHFYRKRLLEKLGKNSEGKFYLLDVIVVATQVIEAGVDIDMDVGFKDISLLDSEEQFLGRINRSCLRDDCHAYFFHMDTVRNIYRNDWRTEYDLRAEPYQHMLATKDFSGFYHLSMKRINDSRNKSDENNWEKFKRMIQDLDYRQVEEWMTLIKEKQVSLFLNYAHQTEDGSILVGEEVWNQYVDLMENRDMDYAERQVKLSQIRQTISYFTYTYSLSHGDKPGIYDRQLGSLYYVSDGTSYMETDPLTQTKKFNRALYMESERSILL
>CP019651.1|AVF22967.1|2971739_2972234_-|CRISPR-associated-protein-Cas4
MKITGTVVNYYVHCRRQCWLVAHGMNFEDDSEDVRIGRVQHEIRSEGKKNTEIAIEGIKVDKLTDQYVVEVKKSDADVEATKWQTLYYLYVLRQKGMERQGRLEFIERNKQASKKMALELDIETEQELLVLLEKIEQYLQQEQPDPPVLEKKCKRCAYYAYCFV
>CP019651.1|AVF22966.1|2970709_2971720_-|CRISPR-associated-endonuclease-Cas1
MSKSVPSTRYIRTPGTLGREDNSLTFRSEKGIVHLPIHGLKELYLLNEISLNSKLFSFLSMAGITVHFFDYYGHFRGTFYPKEARVSGKVKLLQAKACLERRMPIAISLVYAIASNIHEVLYHYYKHGNKEIKPYLDWLKKDVPHLLEKIQDIPRLLSLEGEIWRRFFETFKTFLPDDFRMSKRVKRPPDNPLNALISFGNTILYTKTISQIYHTHLDQTISFLHEPSDRRFSLSLDLSEPFKPLIVYRTIFEVVNNRRIQVGKHFEKKYNYCILNEAGRDVFISALEERMQQVFEHKTLKRKLSYLTAIKYDAYKLKKHIVEGTPFMPFLEKDRR
>CP019651.1|AVF22965.1|2970420_2970702_-|CRISPR-associated-endoribonuclease-Cas2
MAKNYHYVILVYDIGEKRVGKVFKICKRYLVHFQKSVFRGEITPSNLLKLRNDLKKVIDKDSDFIAIFKMTGDYVFDEEVIGVRSNNQESLLL
>CP019651.1|AVF22964.1|2969063_2969879_+|transposase
MCALLSVSKSGYYEWTKRKESERLKRRKKLERWIRRTFFDSRQLYGSPKVWYALKKQGIHVSQKTVARIMKELGLRSRTVKKYKATTNSKHNLPVAENVLNQSFAAEKPNQVWMADITYIPTDEGWLYLASLEDLCTRKIVGFHMGERMTRELCLRALDQAYRHQRPKGTVLHHSDRGSQYASSDYQTQLRQYGMTGNMSRKGNCYDNACIESFHNVLKKELVYLHKFKTRKEAKEKIFEYITCFYNGKRIHSSIGYLTPNQCEHMICLAA
>CP019651.1|AVF22963.1|2968728_2969016_+|transposase-IS3/IS911-family-protein
MTKKYDKEFKLQSVRLIQEEGKSVAQVAREMGLHENTLYRWIAEFKNAGNQAFPGSGQLKPEDKALRDLQKRIRNLEEENDILKKTMHYFAKDRR
>CP019651.1|AVF22973.1|2980389_2980512_+|transposase-IS3/IS911-family-protein
MRRTKYSNEFKVQVVKEALETRNKAAVARRYELTSNMLHR
>CP019651.1|AVF22974.1|2981230_2981593_-|integrase-catalytic-region
MVFEKKTNEVDKLKKEYENKQEHLEKLVGQLTVEVDWLKKNLVLNKSLEDRKVMVERDNTKITVKRQANRTSVSRHRKGHRESEENVQIMHHIDEIYMKHPYFGYRRMIQFFEIKIQNQF
>CP019651.1|AVF22975.1|2982039_2982291_+|DNA-polymerase-IV-2
MLFKKHWDGLPVRKISVSLEELVRDDTMQLTFFEDALEKALDDIKDRFGNASVMCTVSITGSDQAKELHILKNMKKPHLMSRG
>CP019651.1|AVF22976.1|2982522_2982639_-|hypothetical-protein
MIIDGIEYEDVLEITGRQVLRSAAGFYIGRLAKMSWSN
>CP019651.1|AVF22977.1|2983329_2983617_+|IclR-family-transcriptional-regulator
MAKVVDDMLKTLEKSLDLLEHFTEETPSWGVRELAKKMGLSHSIVYRILVTYKKKGFLRQNPETKKYELDLKFWGFGCLVQDQMKITEAIYPVIE
>CP019651.1|AVF22978.1|2983679_2983931_-|hypothetical-protein
MLKSIYTHERLVGAGLRYAERIIRDAAAGLPMSDNEYLAIIRQRRKKAAIAKRQRKADDTEYWVKRAAAYQRVEERVRKFESK
>CP019651.1|AVF22979.1|2984288_2985302_+|transcriptional-regulatory-protein
MSNEWPSSIQLSLVQLKTMNKQALDELIILLILRGRVHIQISGKTYQLKADDVVMIHPYENFTLRSDNGTFILKLMITRAGVEQYLKCPWNPRFSCNSAIANEGEQDTYRMLRETLTYLMLAYYRQHEGFPFEMGKYLFKLLSILTTHFQGEDQGESMIQANGVHNKRILRILHVIDQDYRSPLSLEQFARQEYISLYHLSRQFKKNVGMTFTQYVNEVRLKKAVPELLHTEHPILKIAMNNGFANVKTFNKCFKDHYGMTPSEFRSERGKEVSAQESLQAAHSSYEVINPSAALEELSKYMVKKDLNDHSNVIRKKVELMVETEHSTVLYKLNERK
>CP019651.1|AVF22980.1|2985305_2985815_-|transposase
MLFEDESMIRDYQAIQKTWFLRGKQRIIPTTGKHRGVKLLATVDYETGHIVWQEDEQYTAETFLSFLQKVLATYPTGKLALVLDNARIHHAKLLRPFLEAQKNRLELVYLPPYSPQLNIVEGLWKWLKSSVINNVFYSAVSEIRLRVGQFMDEIMKHPHAIIDRLCVRL
>CP019651.1|AVF22981.1|2986132_2987785_+|Beta-xylosidase
MLDLQGSQSTVLVRMNVTAHRHSVSIQNVSDRLHGCAFQMQIDRLVAFIHSALFGLLHGCRYFCQFGMFIHCHPHLSILDLFLIRQMVPFSLPRFAKNIDSTYIATPRKIINIGQASEVLDQEVQSQLQCVYQELEFHYIRMIGFGIEHELKEKSNMLIEWPNNNRIFDFIVANKMMPMIQLKVEEVMASQSSKLKKDPILDMVCYLIDRYGRAELETWCFELVSESVKDSKSIQLAYERLYNQLKMVHPRLQVGLQILSSLDPEETERFQSFVDYAKSSQREPDFVTLTADPSEEKDSRDGENLFQYYRKYQKNLLQHVKQGFEKAGLEQPRCFITEWNTLVGQGDVLSGSFFRAALIIEILTDLSSEIQGIGFWLNIKLKEKLTRVRQDSCLSVFLYEKLKRPLFFVLQMFDRLGSKVLHIEEGCVLTLEGEEWHLLVYNACYMDPLYSIDDFLTQVRNKRIDIYLSGLPARNYQLKQYLLDKDHGGIYHEWIRLGAPKELDAEMLRYLESKILPEVQMERSFLLDELNLHASLTMNACKLYVIQPLL
>CP019651.1|AVF22982.1|2987969_2989136_+|amidohydrolase-like-protein
MTNWREQLPTEEVIQWRRHFHQYPELSFEEEETSNYIYDVLSTFPNLELSRPTTNSLIAKLTGSTPGKTIALRADIDALPIEEEADVEFKSTKPGIMHACGHDTHAAMLLGAAKVLSGMKDQLSGVIKFIFQPAEEVPPGGAKEIVDTGVLNDVDYVFGIHIFPKLPAGMIGTNPGAMSAAQDIFELKIQGKGSHGSTPELSIDPITIGAEIVTNLNNIVSRHVSALDNAVLSIGQFTAGEVFNVIPDAATIKGTVRTTNADIRKLMKKRIHEVIDHIVKAYNGTYELHYQNGYSAVVNNEESTDIVRKAADKIVGEQQFICPKMMGSEDFSAYTDVTKGSFFVLGGGTEEEGCGYMNHHPKFKINEDALAIGMQMHVQIALDVLGKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP019651_4	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	CP019651.1	2650313-2650347	0	1.0
CP019651_4	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	CP019651.1	2650312-2650347	0	1.0

1. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to position: 2650313-2650347, mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaa	Protospacer
***********************************

2. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to position: 2650312-2650347, mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaat	Protospacer
************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP019651_3	3.3\|2033783\|36\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033783-2033818	36	NZ_CP019656	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed1, complete sequence	36367-36402	0	1.0
CP019651_4	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	KT361653	Paenibacillus phage Paisley, complete genome	35313-35347	0	1.0
CP019651_4	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	NC_028746	Paenibacillus phage Harrison, complete genome	35316-35350	0	1.0
CP019651_4	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	KT361653	Paenibacillus phage Paisley, complete genome	35313-35348	0	1.0
CP019651_4	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	NC_028746	Paenibacillus phage Harrison, complete genome	35316-35351	0	1.0
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	KP296792	Bacteriophage Lily, complete genome	34478-34514	1	0.973
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH460824	Paenibacillus phage Unity, complete genome	31019-31053	1	0.971
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH460824	Paenibacillus phage Unity, complete genome	31019-31053	1	0.971
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35866-35896	2	0.935
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29491-29521	2	0.935
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30452-30482	2	0.935
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30453-30483	2	0.935
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35866-35897	2	0.938
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29491-29522	2	0.938
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30452-30483	2	0.938
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30453-30484	2	0.938
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	MG727701	Paenibacillus phage Leyra, complete genome	32524-32560	3	0.919
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	NC_048689	Paenibacillus phage PBL1c, complete genome	29845-29881	3	0.919
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	KP296795	Bacteriophage Shelly, complete genome	31400-31436	3	0.919
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	NC_028788	Bacteriophage Diva, complete genome	29282-29318	3	0.919
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	KT361652	Paenibacillus phage Xenia, complete genome	31397-31433	3	0.919
CP019651_3	3.1\|2033646\|37\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033646-2033682	37	CP019719	Paenibacillus phage phiERICV, complete genome	8995-9031	4	0.892
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH460826	Paenibacillus phage Heath, complete genome	15843-15876	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH460825	Paenibacillus phage Scottie, complete genome	15203-15236	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH460824	Paenibacillus phage Unity, complete genome	15843-15876	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH460827	Paenibacillus phage Halcyone, complete genome	15843-15876	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH454080	Paenibacillus phage Ley, complete genome	15637-15670	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH454076	Paenibacillus phage Ash, complete genome	15637-15670	4	0.882
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	MH431938	Paenibacillus phage C7Cdelta, complete genome	15576-15609	4	0.882
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18376-18406	4	0.871
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18376-18407	4	0.875
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH460826	Paenibacillus phage Heath, complete genome	36053-36087	4	0.886
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH460825	Paenibacillus phage Scottie, complete genome	36483-36517	4	0.886
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH460827	Paenibacillus phage Halcyone, complete genome	36053-36087	4	0.886
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH460826	Paenibacillus phage Heath, complete genome	36053-36087	4	0.886
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH460825	Paenibacillus phage Scottie, complete genome	36483-36517	4	0.886
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH460827	Paenibacillus phage Halcyone, complete genome	36053-36087	4	0.886
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH454080	Paenibacillus phage Ley, complete genome	36477-36511	7	0.8
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH454076	Paenibacillus phage Ash, complete genome	36477-36511	7	0.8
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	MH431938	Paenibacillus phage C7Cdelta, complete genome	36428-36462	7	0.8
CP019651_5	5.2\|2970048\|35\|CP019651\|CRISPRCasFinder,CRT	2970048-2970082	35	KT755656	Paenibacillus phage Tripp, complete genome	37416-37450	7	0.8
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH454080	Paenibacillus phage Ley, complete genome	36477-36511	7	0.8
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH454076	Paenibacillus phage Ash, complete genome	36477-36511	7	0.8
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	MH431938	Paenibacillus phage C7Cdelta, complete genome	36428-36462	7	0.8
CP019651_5	5.6\|2970049\|35\|CP019651\|PILER-CR	2970049-2970083	35	KT755656	Paenibacillus phage Tripp, complete genome	37416-37450	7	0.8
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP012255	Cronobacter sakazakii strain NCTC 8155 plasmid pCS2, complete sequence	30217-30247	8	0.742
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP049260	Cronobacter sakazakii strain CS-931 plasmid pCsaCS931b, complete sequence	42449-42479	8	0.742
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NC_020263	Cronobacter sakazakii SP291 plasmid pSP291-1, complete sequence	43644-43674	8	0.742
CP019651_5	5.4\|2970180\|33\|CP019651\|CRISPRCasFinder,CRT	2970180-2970212	33	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	71940-71972	8	0.758
CP019651_5	5.8\|2970181\|33\|CP019651\|PILER-CR	2970181-2970213	33	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	71940-71972	8	0.758
CP019651_2	2.1\|1213499\|31\|CP019651\|CRISPRCasFinder	1213499-1213529	31	NZ_CP019084	Paludisphaera borealis strain PX4 plasmid PALBO2, complete sequence	803-833	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	CP027110	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09a, complete sequence	43998-44028	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	CP049261	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09c, complete sequence	121706-121736	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	CP045779	Cronobacter sakazakii strain CFSAN068773 plasmid p1CFSAN068773, complete sequence	121287-121317	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NC_009780	Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence	43618-43648	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_CP028976	Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence	66434-66464	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NC_010123	Gluconacetobacter diazotrophicus PA1 5 plasmid pGDIPal5II, complete sequence	10297-10327	9	0.71
CP019651_4	4.5\|2036602\|31\|CP019651\|CRT	2036602-2036632	31	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1482611-1482641	9	0.71
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP012255	Cronobacter sakazakii strain NCTC 8155 plasmid pCS2, complete sequence	30216-30247	9	0.719
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP049260	Cronobacter sakazakii strain CS-931 plasmid pCsaCS931b, complete sequence	42448-42479	9	0.719
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NC_020263	Cronobacter sakazakii SP291 plasmid pSP291-1, complete sequence	43643-43674	9	0.719
CP019651_3	3.4\|2033851\|34\|CP019651\|PILER-CR,CRISPRCasFinder,CRT	2033851-2033884	34	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	801586-801619	10	0.706
CP019651_4	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	MN693193	Marine virus AFVG_25M440, complete genome	43946-43980	10	0.714
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	CP027110	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09a, complete sequence	43997-44028	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_CP028976	Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence	66434-66465	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NC_010123	Gluconacetobacter diazotrophicus PA1 5 plasmid pGDIPal5II, complete sequence	10297-10328	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	CP049261	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09c, complete sequence	121705-121736	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1482611-1482642	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	CP045779	Cronobacter sakazakii strain CFSAN068773 plasmid p1CFSAN068773, complete sequence	121286-121317	10	0.688
CP019651_4	4.10\|2036602\|32\|CP019651\|CRISPRCasFinder	2036602-2036633	32	NC_009780	Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence	43617-43648	10	0.688
CP019651_4	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	MN693193	Marine virus AFVG_25M440, complete genome	43945-43980	11	0.694

1. spacer 3.3|2033783|36|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019656 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cgttctgtggccagtgtcatatggcgacaggcgaat	CRISPR spacer
cgttctgtggccagtgtcatatggcgacaggcgaat	Protospacer
************************************

2. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaa	Protospacer
***********************************

3. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaa	Protospacer
***********************************

4. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaat	Protospacer
************************************

5. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaat	Protospacer
************************************

6. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to KP296792 (Bacteriophage Lily, complete genome) position: , mismatch: 1, identity: 0.973

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tatgaccgggtatctgctgttgctgaagccgaagggt	Protospacer
*********************** *************

7. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH460824 (Paenibacillus phage Unity, complete genome) position: , mismatch: 1, identity: 0.971

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggctgtgtga	Protospacer
***** *****************************

8. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH460824 (Paenibacillus phage Unity, complete genome) position: , mismatch: 1, identity: 0.971

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggctgtgtga	Protospacer
***** *****************************

9. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 2, identity: 0.935

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
tacttaagccgaccgccatatagcgcggcta	Protospacer
.* ****************************

10. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 2, identity: 0.935

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
tacttaagccgaccgccatatagcgcggcta	Protospacer
.* ****************************

11. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
tacttaagccgaccgccatatagcgcggcta	Protospacer
.* ****************************

12. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.935

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
tacttaagccgaccgccatatagcgcggcta	Protospacer
.* ****************************

13. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 2, identity: 0.938

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* *****************************

14. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 2, identity: 0.938

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* *****************************

15. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* *****************************

16. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.938

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* *****************************

17. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MG727701 (Paenibacillus phage Leyra, complete genome) position: , mismatch: 3, identity: 0.919

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtttctgctgttgcagaagccgaagggt	Protospacer
**..******* *************************

18. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to NC_048689 (Paenibacillus phage PBL1c, complete genome) position: , mismatch: 3, identity: 0.919

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtttctgctgttgcagaagccgaagggt	Protospacer
**..******* *************************

19. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to KP296795 (Bacteriophage Shelly, complete genome) position: , mismatch: 3, identity: 0.919

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtttctgctgttgcagaagccgaagggt	Protospacer
**..******* *************************

20. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to NC_028788 (Bacteriophage Diva, complete genome) position: , mismatch: 3, identity: 0.919

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtttctgctgttgcagaagccgaagggt	Protospacer
**..******* *************************

21. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to KT361652 (Paenibacillus phage Xenia, complete genome) position: , mismatch: 3, identity: 0.919

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtttctgctgttgcagaagccgaagggt	Protospacer
**..******* *************************

22. spacer 3.1|2033646|37|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to CP019719 (Paenibacillus phage phiERICV, complete genome) position: , mismatch: 4, identity: 0.892

tatgaccgggtatctgctgttgcagaagccgaagggt	CRISPR spacer
tacaaccgggtatctgctgttgcggaagccgaggggt	Protospacer
**..*******************.********.****

23. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH460826 (Paenibacillus phage Heath, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

24. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH460825 (Paenibacillus phage Scottie, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

25. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH460824 (Paenibacillus phage Unity, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

26. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH460827 (Paenibacillus phage Halcyone, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

27. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH454080 (Paenibacillus phage Ley, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

28. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH454076 (Paenibacillus phage Ash, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

29. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to MH431938 (Paenibacillus phage C7Cdelta, complete genome) position: , mismatch: 4, identity: 0.882

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gtaaacaccgattatgtgtcggccgtccgcacgc	Protospacer
. **** *********** ***************

30. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.871

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
acttaaagccgaccgccatatagcgcggcta	Protospacer
   * **************************

31. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.875

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
acttaaagccgaccgccatatagcgcggctat	Protospacer
   * ***************************

32. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH460826 (Paenibacillus phage Heath, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

33. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH460825 (Paenibacillus phage Scottie, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

34. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH460827 (Paenibacillus phage Halcyone, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

35. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH460826 (Paenibacillus phage Heath, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

36. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH460825 (Paenibacillus phage Scottie, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

37. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH460827 (Paenibacillus phage Halcyone, complete genome) position: , mismatch: 4, identity: 0.886

gccaaagggcggataatttgaggagggct-gtgtga	CRISPR spacer
gccaatgggcggataatttgaggagggttcgtatg-	Protospacer
***** *********************.* **.**

38. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH454080 (Paenibacillus phage Ley, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

39. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH454076 (Paenibacillus phage Ash, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

40. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to MH431938 (Paenibacillus phage C7Cdelta, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

41. spacer 5.2|2970048|35|CP019651|CRISPRCasFinder,CRT matches to KT755656 (Paenibacillus phage Tripp, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

42. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH454080 (Paenibacillus phage Ley, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

43. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH454076 (Paenibacillus phage Ash, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

44. spacer 5.6|2970049|35|CP019651|PILER-CR matches to MH431938 (Paenibacillus phage C7Cdelta, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

45. spacer 5.6|2970049|35|CP019651|PILER-CR matches to KT755656 (Paenibacillus phage Tripp, complete genome) position: , mismatch: 7, identity: 0.8

gccaaagggcggataatttgaggagggctgtgtga	CRISPR spacer
gccaatgggcggataatctgaggaggtccaagtgg	Protospacer
***** ***********.******** *.. ***.

46. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP012255 (Cronobacter sakazakii strain NCTC 8155 plasmid pCS2, complete sequence) position: , mismatch: 8, identity: 0.742

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
caccaccgccgaccgccatattgcccggctg	Protospacer
** .   ************** ** *****.

47. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP049260 (Cronobacter sakazakii strain CS-931 plasmid pCsaCS931b, complete sequence) position: , mismatch: 8, identity: 0.742

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
caccaccgccgaccgccatattgcccggctg	Protospacer
** .   ************** ** *****.

48. spacer 4.5|2036602|31|CP019651|CRT matches to NC_020263 (Cronobacter sakazakii SP291 plasmid pSP291-1, complete sequence) position: , mismatch: 8, identity: 0.742

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
caccaccgccgaccgccatattgcccggctg	Protospacer
** .   ************** ** *****.

49. spacer 5.4|2970180|33|CP019651|CRISPRCasFinder,CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.758

aagggcaggtacgacgcccacgcggcgggcaat	CRISPR spacer
gacggcaggaacgacgccctcgcggcgcggatg	Protospacer
.* ****** ********* ******* * *

50. spacer 5.8|2970181|33|CP019651|PILER-CR matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.758

aagggcaggtacgacgcccacgcggcgggcaat	CRISPR spacer
gacggcaggaacgacgccctcgcggcgcggatg	Protospacer
.* ****** ********* ******* * *

51. spacer 2.1|1213499|31|CP019651|CRISPRCasFinder matches to NZ_CP019084 (Paludisphaera borealis strain PX4 plasmid PALBO2, complete sequence) position: , mismatch: 9, identity: 0.71

taactttccccaccagccctttttcggcaaa	CRISPR spacer
cggctttccgcaccagccctttgtcggtgcg	Protospacer
...****** ************ ****.. .

52. spacer 4.5|2036602|31|CP019651|CRT matches to CP027110 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09a, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgccaccgccgaccgccatattgcccggctg	Protospacer
*. .   ************** ** *****.

53. spacer 4.5|2036602|31|CP019651|CRT matches to CP049261 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09c, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgccaccgccgaccgccatattgcccggctg	Protospacer
*. .   ************** ** *****.

54. spacer 4.5|2036602|31|CP019651|CRT matches to CP045779 (Cronobacter sakazakii strain CFSAN068773 plasmid p1CFSAN068773, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgccaccgccgaccgccatattgcccggctg	Protospacer
*. .   ************** ** *****.

55. spacer 4.5|2036602|31|CP019651|CRT matches to NC_009780 (Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgccaccgccgaccgccatattgcccggctg	Protospacer
*. .   ************** ** *****.

56. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_CP028976 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgccaccgccgaccgccatattgcccggctg	Protospacer
*. .   ************** ** *****.

57. spacer 4.5|2036602|31|CP019651|CRT matches to NC_010123 (Gluconacetobacter diazotrophicus PA1 5 plasmid pGDIPal5II, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgcgcccgccgaccgccagatggcgcggctc	Protospacer
*.  .  *********** **.********

58. spacer 4.5|2036602|31|CP019651|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 9, identity: 0.71

caattaagccgaccgccatatagcgcggcta	CRISPR spacer
cgtcggcgccgaccgccgtatagggcggctc	Protospacer
*. . . **********.***** ******

59. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP012255 (Cronobacter sakazakii strain NCTC 8155 plasmid pCS2, complete sequence) position: , mismatch: 9, identity: 0.719

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
caccaccgccgaccgccatattgcccggctgc	Protospacer
** .   ************** ** *****..

60. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP049260 (Cronobacter sakazakii strain CS-931 plasmid pCsaCS931b, complete sequence) position: , mismatch: 9, identity: 0.719

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
caccaccgccgaccgccatattgcccggctgc	Protospacer
** .   ************** ** *****..

61. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NC_020263 (Cronobacter sakazakii SP291 plasmid pSP291-1, complete sequence) position: , mismatch: 9, identity: 0.719

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
caccaccgccgaccgccatattgcccggctgc	Protospacer
** .   ************** ** *****..

62. spacer 3.4|2033851|34|CP019651|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 10, identity: 0.706

aaaaaccccgattatgtggcggccgtccgcacgc	CRISPR spacer
gcaaacctcgattatgtggcggcggtgcagatcg	Protospacer
. *****.*************** ** *. *.

63. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to MN693193 (Marine virus AFVG_25M440, complete genome) position: , mismatch: 10, identity: 0.714

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
gttagaattaaatatgcaactgtagcagatgcaaa	Protospacer
. .*.   .************* ********.***

64. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to CP027110 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09a, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgccaccgccgaccgccatattgcccggctgc	Protospacer
*. .   ************** ** *****..

65. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_CP028976 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgccaccgccgaccgccatattgcccggctgc	Protospacer
*. .   ************** ** *****..

66. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NC_010123 (Gluconacetobacter diazotrophicus PA1 5 plasmid pGDIPal5II, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgcgcccgccgaccgccagatggcgcggctca	Protospacer
*.  .  *********** **.********

67. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to CP049261 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09c, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgccaccgccgaccgccatattgcccggctgc	Protospacer
*. .   ************** ** *****..

68. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgtcggcgccgaccgccgtatagggcggctcg	Protospacer
*. . . **********.***** ******

69. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to CP045779 (Cronobacter sakazakii strain CFSAN068773 plasmid p1CFSAN068773, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgccaccgccgaccgccatattgcccggctgc	Protospacer
*. .   ************** ** *****..

70. spacer 4.10|2036602|32|CP019651|CRISPRCasFinder matches to NC_009780 (Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence) position: , mismatch: 10, identity: 0.688

caattaagccgaccgccatatagcgcggctat	CRISPR spacer
cgccaccgccgaccgccatattgcccggctgc	Protospacer
*. .   ************** ** *****..

71. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to MN693193 (Marine virus AFVG_25M440, complete genome) position: , mismatch: 11, identity: 0.694

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
gttagaattaaatatgcaactgtagcagatgcaaag	Protospacer
. .*.   .************* ********.***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

321523 : 384780

uncultured_Caudovirales_phage(20.0%)

bacteriocin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20306.1\|321523_321823_+\|transposase	putative transposase	NA	NA	NA	NA
AVF20307.1\|321918_322365_-	Thiol-disulfide oxidoreductase YkuV	NA	NA	NA	NA
AVF20308.1\|322379_322883_-	hypothetical protein	NA	NA	NA	NA
AVF20309.1\|322852_324334_-\|bacteriocin	putative bacteriocin-skfA transport system permease protein SkfF	NA	NA	NA	NA
AVF20310.1\|324326_325049_-	SkfA peptide export ATP-binding protein SkfE	A0A2H4PQG7	Staphylococcus_phage	1.9e-19	31.1
AVF20311.1\|325061_326555_-	abortive infection protein	NA	NA	NA	NA
AVF20312.1\|326568_327783_-\|bacteriocin	Antilisterial bacteriocin subtilosin biosynthesis protein AlbA	NA	NA	NA	NA
AVF20313.1\|327856_328042_-	Sporulation-killing factor SkfA	NA	NA	NA	NA
AVF20314.1\|328416_328821_+	D-mannose binding lectin	NA	NA	NA	NA
AVF20315.1\|329606_329933_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVF20316.1\|330071_330362_-	hypothetical protein	NA	NA	NA	NA
AVF20317.1\|331001_333041_-	methyl-accepting chemotaxis protein signaling domain protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-11	43.3
AVF20318.1\|333160_333871_-	putative membrane protein	NA	NA	NA	NA
AVF20319.1\|334298_334511_-	hypothetical protein	NA	NA	NA	NA
AVF20320.1\|334719_335154_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF20321.1\|335150_338318_+	putative membrane protein YdgH	NA	NA	NA	NA
AVF20322.1\|338516_339104_+	peptide deformylase 2	E3SLL2	Synechococcus_phage	1.2e-11	36.8
AVF20323.1\|339158_340127_+	peptide methionine sulfoxide reductase MsrA/MsrB	NA	NA	NA	NA
AVF20324.1\|340452_341022_+	sodium/hydrogen exchanger family protein	NA	NA	NA	NA
AVF20325.1\|340831_341293_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF20326.1\|341479_342700_+	major facilitator superfamily MFS_1 protein	NA	NA	NA	NA
AVF20327.1\|343073_343502_+	transcriptional regulator, BadM/Rrf2 family	NA	NA	NA	NA
AVF20328.1\|343733_344459_+	transcriptional regulator, GntR family	NA	NA	NA	NA
AVF20329.1\|344643_345141_+	N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 2	NA	NA	NA	NA
AVF20330.1\|345159_345927_+	putative N-acetylgalactosamine permease IIC component 2	NA	NA	NA	NA
AVF20331.1\|345916_346789_+	N-acetylgalactosamine permease IID component AgaD	NA	NA	NA	NA
AVF20332.1\|346806_347229_+	PTS system mannose-specific component IIAB-like protein	NA	NA	NA	NA
AVF20333.1\|347293_350989_-	amino acid adenylation protein	A0A2K9KZV5	Tupanvirus	2.3e-76	30.8
AVF20334.1\|351073_352831_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-15	30.7
AVF20335.1\|354081_355716_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AVF20336.1\|356191_357421_-	acetyltransferase	NA	NA	NA	NA
AVF20337.1\|357865_358933_-	thiamine biosynthesis lipoprotein ApbE	NA	NA	NA	NA
AVF20338.1\|359232_359523_+	putative membrane protein	NA	NA	NA	NA
AVF20339.1\|359599_360160_+	heptaprenyl diphosphate synthase related protein	NA	NA	NA	NA
AVF20340.1\|360195_361029_+	energy-coupling factor transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-21	34.2
AVF20341.1\|361004_361871_+	energy-coupling factor transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-13	28.9
AVF20342.1\|361887_362691_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AVF20343.1\|364781_366056_+	aminotransferase class-III	A0A1V0SKB7	Klosneuvirus	3.4e-27	27.2
AVF20344.1\|366069_367509_+	3-octaprenyl-4hydroxybenzoate decarboxylase	NA	NA	NA	NA
AVF20345.1\|367480_368365_+	4-hydroxybenzoate polyprenyltransferase	NA	NA	NA	NA
AVF20346.1\|368712_369042_-	Two-component sensor histidine kinase YkoG-like protein	NA	NA	NA	NA
AVF20347.1\|369051_369357_-	heavy metal sensor kinase	NA	NA	NA	NA
AVF20348.1\|369353_369902_-	Two-component response regulator YkoH-like protein	NA	NA	NA	NA
AVF20349.1\|371944_372169_+	hypothetical protein	NA	NA	NA	NA
AVF20350.1\|372463_373801_+	Clostridium P-47 protein	NA	NA	NA	NA
AVF20351.1\|376720_377404_+	toxin-like protein	NA	NA	NA	NA
AVF20352.1\|379767_380991_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF20353.1\|381126_382050_+	lethal factor domain protein	NA	NA	NA	NA
AVF20354.1\|382145_382583_+	toxin-like protein	NA	NA	NA	NA
AVF20355.1\|382911_383349_+	hypothetical protein	NA	NA	NA	NA
AVF20356.1\|383229_383529_-\|transposase	transposase	A0A218MNI5	uncultured_virus	4.5e-23	51.6
AVF20357.1\|384012_384780_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

391769 : 439727

Paenibacillus_phage(23.53%)

tRNA,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20364.1\|391769_392522_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	6.4e-135	98.7
AVF20365.1\|393432_393936_-	hypothetical protein	NA	NA	NA	NA
AVF20366.1\|393952_395935_-	peptidoglycan-N-acetylmuramate O-acetyltransferase	B5WZU0	Pseudomonas_phage	3.8e-41	32.2
AVF20367.1\|396415_396790_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	1.2e-65	97.6
AVF20368.1\|396920_397175_+\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	4.5e-40	95.3
AVF20369.1\|397726_399673_-	ABC transporter, permease protein	NA	NA	NA	NA
AVF20370.1\|399659_400430_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
AVF20371.1\|401196_402570_-	thermophilic serine proteinase	NA	NA	NA	NA
AVF20372.1\|402808_403081_-\|transposase	transposase	U5P429	Shigella_phage	7.7e-14	47.0
AVF20373.1\|403468_403756_-\|transposase	transposase IS3/IS911 family protein	A0A1P8CWP5	Bacillus_phage	3.1e-05	37.8
AVF20374.1\|404427_405084_+	Isonitrile hydratase	NA	NA	NA	NA
AVF20375.1\|405818_406082_+\|transposase	transposase IS3/IS911	NA	NA	NA	NA
AVF20376.1\|406048_406951_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.5e-45	42.3
AVF20377.1\|407329_407659_-	hypothetical protein	NA	NA	NA	NA
AVF20378.1\|407787_407907_-	hypothetical protein	NA	NA	NA	NA
AVF20379.1\|407986_408124_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVF20380.1\|408140_408290_+\|transposase	transposase	NA	NA	NA	NA
AVF20381.1\|408820_410530_-\|tRNA	arginine--tRNA ligase ArgS	A0A2I2L3K1	Orpheovirus	3.1e-76	32.3
AVF20382.1\|411072_411744_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.5e-66	57.8
AVF20383.1\|411740_412226_+	queuosine biosynthesis protein QueD	J9PV91	Bacillus_phage	7.7e-57	68.2
AVF20384.1\|412218_412956_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	4.2e-54	41.8
AVF20385.1\|413009_413501_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.2e-49	63.1
AVF20386.1\|413909_414713_+	Methyltransferase domain protein	NA	NA	NA	NA
AVF20387.1\|414837_416280_+	putative dipeptidase YtjP	NA	NA	NA	NA
AVF20388.1\|416535_416937_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AVF20389.1\|417042_418464_-	Na(+)/H(+) antiporter NhaC	NA	NA	NA	NA
AVF20390.1\|418699_419248_+	RNA polymerase sigma factor SigW-like protein	NA	NA	NA	NA
AVF20391.1\|419231_419852_+	hypothetical protein	NA	NA	NA	NA
AVF20392.1\|420658_420763_+	hypothetical protein	NA	NA	NA	NA
AVF20393.1\|420856_421369_+	Double zinc ribbon	NA	NA	NA	NA
AVF20394.1\|421780_422413_+	regulatory protein TenI	NA	NA	NA	NA
AVF20395.1\|422396_423101_+	FAD-dependent glycine oxidase-like protein	NA	NA	NA	NA
AVF20396.1\|423157_423361_+	sulfur carrier protein ThiS	NA	NA	NA	NA
AVF20397.1\|423401_424163_+	thiazole synthase ThiG	NA	NA	NA	NA
AVF20398.1\|424159_425086_+	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase ThiD	NA	NA	NA	NA
AVF20399.1\|425057_425756_+	regulatory protein TenI	NA	NA	NA	NA
AVF20400.1\|425784_427596_+	Phosphomethylpyrimidine synthase	NA	NA	NA	NA
AVF20401.1\|427683_428364_+	Putative undecaprenyl-diphosphatase YbjG	NA	NA	NA	NA
AVF20402.1\|429295_429910_-	ATP-binding protein CirD	A0A2H4PQG7	Staphylococcus_phage	4.8e-11	30.3
AVF20403.1\|429930_430386_-	hypothetical protein	NA	NA	NA	NA
AVF20404.1\|430400_431522_-	hypothetical protein	NA	NA	NA	NA
AVF20405.1\|431529_431829_-\|bacteriocin	putative bacteriocin	NA	NA	NA	NA
AVF20406.1\|431983_432166_-	hypothetical protein	NA	NA	NA	NA
AVF20407.1\|432277_432406_+	putative transposon DNA-invertase Bin3	NA	NA	NA	NA
AVF20408.1\|432434_432845_+	resolvase	A0A0F7LA37	Escherichia_phage	2.7e-10	36.2
AVF20409.1\|433635_433803_-\|transposase	transposase family protein	NA	NA	NA	NA
AVF20410.1\|433831_433933_-	hypothetical protein	NA	NA	NA	NA
AVF20411.1\|434167_434545_+\|bacteriocin	putative bacteriocin	NA	NA	NA	NA
AVF20412.1\|435403_436099_+	ABC transporter	G9BWD6	Planktothrix_phage	7.8e-18	33.3
AVF20413.1\|436095_436452_+	hypothetical protein	NA	NA	NA	NA
AVF20414.1\|436798_438772_+	hypothetical protein	NA	NA	NA	NA
AVF20415.1\|439151_439727_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	3.9e-39	49.7

DBSCAN-SWA_3

450185 : 494540

Paenibacillus_phage(40.0%)

transposase,holin,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20425.1\|450185_450404_+\|transposase	transposase, IS605 family	NA	NA	NA	NA
AVF20426.1\|451508_452414_+	ABC transporter, ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-23	30.0
AVF20427.1\|452406_453675_+	putative membrane protein	NA	NA	NA	NA
AVF20428.1\|454009_455647_+	L-2,4-diaminobutyrate decarboxylase	NA	NA	NA	NA
AVF20429.1\|455871_456669_-	multidrug resistance protein	NA	NA	NA	NA
AVF20430.1\|456669_457155_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVF20431.1\|457397_459758_+	Helicase IV	A0A1E1ETV1	Acanthamoeba_castellanii_mimivirus	1.7e-08	25.9
AVF20432.1\|459806_460985_-	cystathionine beta-lyase PatB	NA	NA	NA	NA
AVF20433.1\|461167_461974_-	polysaccharide deacetylase	NA	NA	NA	NA
AVF20434.1\|462421_463255_-	hypothetical protein	NA	NA	NA	NA
AVF20435.1\|463382_464621_+	3-oxoacyl-[acyl-carrier-protein] synthase 2	NA	NA	NA	NA
AVF20436.1\|465103_465673_+	putative maltose O-acetyltransferase Maa	NA	NA	NA	NA
AVF20437.1\|465942_466368_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF20438.1\|466374_466521_+	hypothetical protein	NA	NA	NA	NA
AVF20439.1\|466527_467751_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF20440.1\|467815_467941_+	LexA repressor-like protein	NA	NA	NA	NA
AVF20441.1\|467943_468312_+	Acetyltransferase (GNAT) family protein	NA	NA	NA	NA
AVF20442.1\|468457_468685_-	Sulfurtransferase TusA	NA	NA	NA	NA
AVF20443.1\|468674_469886_-	putative inner membrane protein	NA	NA	NA	NA
AVF20444.1\|470527_471121_+	RNA polymerase sigma factor SigO	NA	NA	NA	NA
AVF20445.1\|471186_471438_+	Sigma-O factor regulatory protein RsoA	NA	NA	NA	NA
AVF20446.1\|472056_472461_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	5.1e-30	55.3
AVF20447.1\|472817_473243_+	putative toxin-antitoxin system, toxin component	NA	NA	NA	NA
AVF20448.1\|473244_473616_+	transcriptional regulator, ArsR family	NA	NA	NA	NA
AVF20449.1\|473876_474194_+	methylated-DNA-protein- cysteinemethyltransferase	NA	NA	NA	NA
AVF20450.1\|474344_474569_+	hypothetical protein	NA	NA	NA	NA
AVF20451.1\|474583_474754_-	putative DNA-binding protein	NA	NA	NA	NA
AVF20452.1\|475150_475636_+	hypothetical protein	NA	NA	NA	NA
AVF20453.1\|476046_476529_+	hypothetical protein	NA	NA	NA	NA
AVF20454.1\|477106_477352_+	hypothetical protein	NA	NA	NA	NA
AVF20455.1\|477436_478477_+	putative oxidoreductase YvaA	NA	NA	NA	NA
AVF20456.1\|478754_479816_+	glyceraldehyde-3-phosphate dehydrogenase 2	NA	NA	NA	NA
AVF20457.1\|479939_480530_+	transcriptional regulator, TetR family	NA	NA	NA	NA
AVF20458.1\|480595_481813_+	major facilitator superfamily MFS_1 protein	NA	NA	NA	NA
AVF20459.1\|482070_483054_+	Homoserine kinase	NA	NA	NA	NA
AVF20460.1\|483385_484288_+	carboxylate/amino acid/amine transporter	NA	NA	NA	NA
AVF20461.1\|484284_485076_-	hypothetical protein	NA	NA	NA	NA
AVF20462.1\|485475_486207_+	glyoxalase family protein	NA	NA	NA	NA
AVF20463.1\|486257_486740_+	hypothetical protein	NA	NA	NA	NA
AVF20464.1\|486813_487335_-	putative cell-wall hydrolase	NA	NA	NA	NA
AVF20465.1\|487492_488872_-	sensor histidine kinase YkoH	A0A1V0SGX0	Hokovirus	5.7e-20	32.4
AVF20466.1\|488861_489563_-	response regulator ArlR	W8CYM9	Bacillus_phage	7.3e-32	36.1
AVF20467.1\|489764_490517_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF20468.1\|490654_491338_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.8e-120	97.8
AVF20469.1\|491430_492024_-	undecaprenyl-diphosphatase BcrC	NA	NA	NA	NA
AVF20470.1\|492272_492980_+	ABC-type transporter ATP-binding protein EcsA	A0A2H4PQG7	Staphylococcus_phage	2.2e-15	28.1
AVF20471.1\|493025_493214_+	ABC transporter-like protein	NA	NA	NA	NA
AVF20472.1\|493526_494540_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	1.3e-18	30.6

DBSCAN-SWA_4

521391 : 557919

Streptococcus_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20504.1\|521391_522552_+\|holin	glycine betaine/carnitine/choline transport ATP-binding protein OpuCA	G3M9Y6	Bacillus_virus	9.0e-27	33.6
AVF20505.1\|522548_523205_+\|holin	choline transport system permease protein OpuBB	NA	NA	NA	NA
AVF20506.1\|523221_524115_+\|holin	choline-binding protein	NA	NA	NA	NA
AVF20507.1\|524158_524788_+\|holin	glycine betaine/carnitine/choline transport system permease protein OpuCD	NA	NA	NA	NA
AVF20508.1\|525068_525497_+	Acetyltransferase YpeA	NA	NA	NA	NA
AVF20509.1\|525777_526365_+	hypothetical protein	NA	NA	NA	NA
AVF20510.1\|526393_527563_+	putative iron-sulfur cluster binding protein	NA	NA	NA	NA
AVF20511.1\|527633_528668_+	metal dependent phosphohydrolase	NA	NA	NA	NA
AVF20512.1\|528768_528978_+	hypothetical protein	NA	NA	NA	NA
AVF20513.1\|529333_529924_+	GTP cyclohydrolase 1	E7DN69	Pneumococcus_phage	5.5e-49	54.4
AVF20514.1\|530144_531425_-	putative superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	8.1e-37	42.8
AVF20515.1\|531498_532530_-	hypothetical protein	NA	NA	NA	NA
AVF20516.1\|532867_533611_+	hypothetical protein	NA	NA	NA	NA
AVF20517.1\|533718_534690_+	CDF family cation diffusion facilitator	NA	NA	NA	NA
AVF20518.1\|534849_537549_-	aconitate hydratase Acn	NA	NA	NA	NA
AVF20519.1\|537891_538911_+	two-component response regulator	NA	NA	NA	NA
AVF20520.1\|538933_540055_+	D-alanine--D-alanine ligase Ddl	NA	NA	NA	NA
AVF20521.1\|540178_540367_+	hypothetical protein	NA	NA	NA	NA
AVF20522.1\|540567_541596_+	UV DNA damage endonuclease UvsE	A0A2I2L3D9	Orpheovirus	7.7e-22	27.5
AVF20523.1\|541784_542555_+	enoyl-[acyl-carrier-protein] reductase [NADH] FabI	NA	NA	NA	NA
AVF20524.1\|542688_542982_-	hypothetical protein	NA	NA	NA	NA
AVF20525.1\|543489_544344_+	inositol-1-monophosphatase SuhB	NA	NA	NA	NA
AVF20526.1\|544426_544864_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
AVF20527.1\|545024_546029_+	biotin synthase BioB	NA	NA	NA	NA
AVF20528.1\|546104_550631_-	glutamate synthase [NADPH] large chain GltA	NA	NA	NA	NA
AVF20529.1\|551156_552470_-	glutamate-1-semialdehyde 2,1-aminomutase 1	NA	NA	NA	NA
AVF20530.1\|552561_553587_-	transcriptional regulator LytR	NA	NA	NA	NA
AVF20531.1\|554136_554607_+	peroxiredoxin-like protein	NA	NA	NA	NA
AVF20532.1\|554898_556254_+	putative polysaccharide deacetylase YheN	NA	NA	NA	NA
AVF20533.1\|556391_557018_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	6.1e-54	53.8
AVF20534.1\|557244_557919_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	3.0e-35	43.8

DBSCAN-SWA_5

616544 : 711104

Staphylococcus_phage(25.0%)

integrase,coat,transposase,lysis,protease,holin

attL 619681:619695|attR 628543:628557

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20576.1\|616544_616988_+\|transposase	transposase-like protein	NA	NA	NA	NA
AVF20577.1\|617044_617227_-	hypothetical protein	NA	NA	NA	NA
AVF20578.1\|617396_619391_-	methyl-accepting chemotaxis protein TlpB	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-11	54.8
AVF20579.1\|619575_619812_+	hypothetical protein	NA	NA	NA	NA
619681:619695	attL	NA	NA	NA	NA
AVF20580.1\|619994_620279_-\|integrase	phage integrase family protein	NA	NA	NA	NA
AVF20581.1\|620575_620848_+	transcriptional regulator, LuxR family	NA	NA	NA	NA
AVF20582.1\|620844_621855_+\|protease	intracellular serine protease	A0A2H4PQH1	Staphylococcus_phage	9.9e-22	28.6
AVF20583.1\|621870_622569_+	ABC transporter-like protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	30.0
AVF20584.1\|622574_623729_+	ABC transporter-like protein	NA	NA	NA	NA
AVF20585.1\|623829_624051_+	hypothetical protein	NA	NA	NA	NA
AVF20586.1\|627504_627780_+\|transposase	transposase mutator type	A0A218MNI5	uncultured_virus	3.1e-18	61.5
AVF20587.1\|628022_628532_-	hypothetical protein	NA	NA	NA	NA
AVF20588.1\|629342_630800_+	Type I restriction enzyme EcoKI M protein	A0A1W6JNK1	Staphylococcus_phage	3.2e-21	26.9
628543:628557	attR	NA	NA	NA	NA
AVF20589.1\|630789_631950_+	EcoKI restriction-modification system protein HsdS	NA	NA	NA	NA
AVF20590.1\|631960_635311_+	type I restriction enzyme EcoKI subunit R	Q5YA94	Bacillus_phage	2.0e-18	23.2
AVF20591.1\|635964_637269_+	hypothetical protein	NA	NA	NA	NA
AVF20592.1\|637253_638714_+	hypothetical protein	NA	NA	NA	NA
AVF20593.1\|638706_639468_+	hypothetical protein	NA	NA	NA	NA
AVF20594.1\|639474_642693_+	putative ABC transporter ATP-binding protein YbbL	NA	NA	NA	NA
AVF20595.1\|643884_644370_+	taurine catabolism dioxygenase TauD/TfdA	NA	NA	NA	NA
AVF20596.1\|644478_645441_+	ATP-binding transport protein NatA	A0A2R8FG22	Brazilian_cedratvirus	3.1e-17	24.0
AVF20597.1\|645424_646225_+	putative ABC transporter, permease protein	NA	NA	NA	NA
AVF20598.1\|646229_647027_+	putative ABC transporter, permease protein	NA	NA	NA	NA
AVF20599.1\|647754_649638_+	chaperone protein HtpG	A0A1V0SAD6	Catovirus	3.6e-94	34.4
AVF20600.1\|651517_652465_+	export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-24	32.4
AVF20601.1\|652641_653586_+	ABC transporter-like protein	NA	NA	NA	NA
AVF20602.1\|653801_654221_+	thioesterase superfamily protein	NA	NA	NA	NA
AVF20603.1\|654217_655168_+	malonyl-CoA-[acyl-carrier-protein] transacylase	NA	NA	NA	NA
AVF20604.1\|655160_655907_+	3-oxoacyl-[acyl-carrier-protein] reductase FabG	W8CYX9	Bacillus_phage	4.9e-10	46.1
AVF20605.1\|656029_656317_+	acyl carrier protein	NA	NA	NA	NA
AVF20606.1\|656323_656812_+	(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
AVF20607.1\|656808_659607_+	putative acetyltransferase	NA	NA	NA	NA
AVF20608.1\|659635_660193_+\|transposase	transposase	NA	NA	NA	NA
AVF20609.1\|660210_660720_+\|transposase	transposase	NA	NA	NA	NA
AVF20610.1\|660932_661373_+	hypothetical protein	NA	NA	NA	NA
AVF20611.1\|662987_663167_-	dTDP-glucose 4,6-dehydratase	NA	NA	NA	NA
AVF20612.1\|663163_663886_-\|coat	spore coat polysaccharide biosynthesis protein SpsI	H9NC64	Sphingomonas_phage	7.8e-45	41.0
AVF20613.1\|664866_665757_+	3D domain protein	A0A024B055	Bacillus_phage	3.7e-12	43.6
AVF20614.1\|666060_667071_-	polysaccharide deacetylase	NA	NA	NA	NA
AVF20615.1\|667507_668383_+	putative endopeptidase LytE	D2KRB9	Lactobacillus_phage	2.6e-10	33.0
AVF20616.1\|668699_669098_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	1.1e-21	43.5
AVF20617.1\|669200_669722_-	putative oxidoreductase YusZ	NA	NA	NA	NA
AVF20618.1\|670149_670848_+	pirin domain protein	NA	NA	NA	NA
AVF20619.1\|670934_672104_-	N-acetylglucosamine-6-phosphate deacetylase NagA	NA	NA	NA	NA
AVF20620.1\|672100_672829_-	glucosamine-6-phosphate deaminase NagB	NA	NA	NA	NA
AVF20621.1\|672832_673690_-	transcriptional regulator, RpiR family	NA	NA	NA	NA
AVF20622.1\|673876_674545_+	pyrophosphatase PpaX	NA	NA	NA	NA
AVF20623.1\|674593_675799_+	putative membrane protein	NA	NA	NA	NA
AVF20624.1\|675817_677782_+	soluble pyridine nucleotide transhydrogenase	NA	NA	NA	NA
AVF20625.1\|677991_679491_-	Inner membrane protein YqiK	A0A2I2L4B2	Orpheovirus	1.6e-07	27.2
AVF20626.1\|679531_680053_-	membrane integrity-associated integral inner membrane protein	NA	NA	NA	NA
AVF20627.1\|680174_681083_-	putative phosphatase	NA	NA	NA	NA
AVF20628.1\|681231_681927_+	glycosyltransferase, group 2 family protein	A8CG95	Salmonella_phage	1.4e-06	28.0
AVF20629.1\|681942_682332_+	hypothetical protein	NA	NA	NA	NA
AVF20630.1\|682335_682707_+	4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE	NA	NA	NA	NA
AVF20631.1\|682747_683974_+	putative membrane protein	NA	NA	NA	NA
AVF20632.1\|683996_685433_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF20633.1\|685438_686557_-\|coat	spore coat associated-like protein	NA	NA	NA	NA
AVF20634.1\|686556_687927_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF20635.1\|687939_689139_-\|coat	endospore coat-associated protein YheC	NA	NA	NA	NA
AVF20636.1\|689147_690521_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF20637.1\|690650_691817_+	putative membrane protein	NA	NA	NA	NA
AVF20638.1\|691865_692225_+	hypothetical protein	NA	NA	NA	NA
AVF20639.1\|692408_693404_+	oxidoreductase-like protein	NA	NA	NA	NA
AVF20640.1\|693639_693810_-	hypothetical protein	NA	NA	NA	NA
AVF20641.1\|693809_694478_-	ABC-transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-10	25.6
AVF20642.1\|694470_694785_-	hypothetical protein	NA	NA	NA	NA
AVF20643.1\|695262_695502_+	Sorbitol-6-phosphate 2-dehydrogenase	NA	NA	NA	NA
AVF20644.1\|695523_695652_+	putative transaldolase Tal	NA	NA	NA	NA
AVF20645.1\|695614_695782_-\|transposase	transposase, IS605 family	A0A288TXV8	Enterococcus_phage	8.6e-08	57.7
AVF20646.1\|695886_697698_-	oligopeptide-binding protein OppA	NA	NA	NA	NA
AVF20647.1\|697904_698147_+	hypothetical protein	NA	NA	NA	NA
AVF20648.1\|698274_698553_+	hypothetical protein	NA	NA	NA	NA
AVF20649.1\|698707_700045_+	inosine-5'-monophosphate dehydrogenase GuaB	NA	NA	NA	NA
AVF20650.1\|700028_700442_-	hypothetical protein	NA	NA	NA	NA
AVF20651.1\|700510_700663_-	hypothetical protein	NA	NA	NA	NA
AVF20652.1\|700882_701065_-	hypothetical protein	NA	NA	NA	NA
AVF20653.1\|701163_703485_+	ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein	NA	NA	NA	NA
AVF20654.1\|703481_704111_+	response regulator receiver domain protein	NA	NA	NA	NA
AVF20655.1\|704132_705107_+	isoprenyl transferase-like protein	NA	NA	NA	NA
AVF20656.1\|705249_705456_-	hypothetical protein	NA	NA	NA	NA
AVF20657.1\|705421_705964_-	hypothetical protein	NA	NA	NA	NA
AVF20658.1\|706317_706665_+	putative DNA-binding protein	NA	NA	NA	NA
AVF20659.1\|708130_709177_+	gamma-D-glutamate-meso-diaminopimelate muropeptidase-like protein	A0A1W6DXV0	Rhodococcus_phage	2.3e-13	39.1
AVF20660.1\|709625_710204_-	hypothetical protein	NA	NA	NA	NA
AVF20661.1\|710200_710533_-	Sporulation membrane protein YtrH	NA	NA	NA	NA
AVF20662.1\|710756_711104_+\|transposase	putative transposase	D9J0Y9	Brochothrix_phage	1.4e-31	64.8

DBSCAN-SWA_6

794000 : 842201

Brevibacillus_phage(43.75%)

coat,capsid,tRNA,lysis,transposase,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20746.1\|794000_795335_+	phage protein	A0A0A7S087	Clostridium_phage	7.5e-110	46.4
AVF20747.1\|795336_795798_+	putative phage protein	A0A0A7RVP1	Clostridium_phage	2.8e-48	60.3
AVF20748.1\|795817_796240_+	phage protein	X5JAB6	Clostridium_phage	5.8e-24	41.8
AVF20749.1\|796611_798657_+\|tail	putative tail length tape measure protein	A0A0K2CP22	Brevibacillus_phage	2.5e-128	40.5
AVF20750.1\|798656_799298_+	putative phage cell wall hydrolase	S5MUH0	Brevibacillus_phage	2.7e-49	46.3
AVF20751.1\|799302_800271_+	putative phage cell wall hydrolase	S5MNC9	Brevibacillus_phage	3.4e-112	59.5
AVF20752.1\|800270_800558_+	hypothetical protein	S5M5M4	Brevibacillus_phage	7.4e-15	36.8
AVF20753.1\|800560_800983_+	phage protein	A0A0A7RTU4	Clostridium_phage	3.3e-27	47.8
AVF20754.1\|800960_802037_+\|capsid	phage capsid assembly-like protein	S5MUH6	Brevibacillus_phage	9.0e-98	50.3
AVF20755.1\|802029_802611_+	putative phage protein	S5MA71	Brevibacillus_phage	7.9e-32	42.3
AVF20756.1\|802607_802886_+	hypothetical protein	NA	NA	NA	NA
AVF20757.1\|802889_804989_+	phage structural protein	NA	NA	NA	NA
AVF20758.1\|805001_805394_+	hypothetical protein	NA	NA	NA	NA
AVF20759.1\|805386_805548_+	hypothetical protein	NA	NA	NA	NA
AVF20760.1\|805586_805997_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	2.3e-30	50.4
AVF20761.1\|805993_806767_+	N-acetylmuramoyl-L-alanine amidase	D6QWN1	uncultured_phage	4.0e-55	62.3
AVF20762.1\|806984_808277_-	putative bifunctional chitinase/lysozyme precursor	NA	NA	NA	NA
AVF20763.1\|808938_809286_+	hypothetical protein	NA	NA	NA	NA
AVF20764.1\|809336_809681_-	hypothetical protein	NA	NA	NA	NA
AVF20765.1\|809865_810069_+\|coat	spore coat-like protein	NA	NA	NA	NA
AVF20766.1\|810087_810207_+	hypothetical protein	NA	NA	NA	NA
AVF20767.1\|811272_812412_+	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVF20768.1\|812721_812949_+	putative propanediol utilization protein	NA	NA	NA	NA
AVF20769.1\|812960_813392_+	putative ethanolamine/propanediol utilization protein	NA	NA	NA	NA
AVF20770.1\|813627_814200_+	response regulator-like protein	NA	NA	NA	NA
AVF20771.1\|814192_815617_+	putative sensor histidine kinase	NA	NA	NA	NA
AVF20772.1\|815757_817188_+	reactivating factor for ethanolamine ammonia lyase	NA	NA	NA	NA
AVF20773.1\|817217_818582_+	ethanolamine ammonia-lyase heavy chain EutB	NA	NA	NA	NA
AVF20774.1\|818603_819554_+	ethanolamine ammonia-lyase light chain EutC	NA	NA	NA	NA
AVF20775.1\|819572_820226_+	ethanolamine utilization protein EutL	NA	NA	NA	NA
AVF20776.1\|820237_820978_+	propanediol utilization protein PduA	NA	NA	NA	NA
AVF20777.1\|821128_822592_+	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVF20778.1\|822641_822929_+	propanediol utilization protein PduA	NA	NA	NA	NA
AVF20779.1\|823073_823901_+	ethanolamine utilization cobalamin adenosyltransferase EutT	NA	NA	NA	NA
AVF20780.1\|823912_824551_+	phosphate propanoyltransferase PduL	NA	NA	NA	NA
AVF20781.1\|824569_825253_+	putative ethanolamine utilization protein	NA	NA	NA	NA
AVF20782.1\|825265_825538_+	ethanolamine utilization protein EutN	NA	NA	NA	NA
AVF20783.1\|825530_826076_+	ethanolamine utilization protein	NA	NA	NA	NA
AVF20784.1\|826095_827211_+	ethanolamine utilization protein EutH	NA	NA	NA	NA
AVF20785.1\|827213_827324_+	hypothetical protein	NA	NA	NA	NA
AVF20786.1\|827548_828388_+	methyltransferase type 11	NA	NA	NA	NA
AVF20787.1\|828515_828680_-	hypothetical protein	NA	NA	NA	NA
AVF20788.1\|828727_828889_-	hypothetical protein	NA	NA	NA	NA
AVF20789.1\|829824_830019_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF20790.1\|830041_830254_+	hypothetical protein	NA	NA	NA	NA
AVF20791.1\|830352_830814_+	putative DNA-binding protein	A0A0K2CP77	Brevibacillus_phage	2.0e-22	30.5
AVF20792.1\|830810_830942_+	hypothetical protein	NA	NA	NA	NA
AVF20793.1\|831747_832050_+	hypothetical protein	NA	NA	NA	NA
AVF20794.1\|832066_832591_+	putative integral membrane protein	NA	NA	NA	NA
AVF20795.1\|832673_833087_+	hypothetical protein	NA	NA	NA	NA
AVF20796.1\|833358_833661_-	hypothetical protein	NA	NA	NA	NA
AVF20797.1\|834046_834484_+	hypothetical protein	NA	NA	NA	NA
AVF20798.1\|834758_835397_+	transcriptional regulatory protein	NA	NA	NA	NA
AVF20799.1\|835396_835579_+	hypothetical protein	NA	NA	NA	NA
AVF20800.1\|835685_836747_+	selenide, water dikinase	NA	NA	NA	NA
AVF20801.1\|836801_837854_+\|tRNA	tRNA 2-selenouridine synthase SelU	NA	NA	NA	NA
AVF20802.1\|838114_838585_+	hypothetical protein	NA	NA	NA	NA
AVF20803.1\|838647_839025_+	Gas vesicle protein	NA	NA	NA	NA
AVF20804.1\|839798_840371_-	putative ribosomal-protein-alanine acetyltransferase YjcK	D0R097	Streptococcus_phage	1.1e-06	28.3
AVF20805.1\|840539_841223_+\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	9.3e-16	30.9
AVF20806.1\|841679_842201_+\|transposase	putative transposase	A0A0H3UZC2	Geobacillus_virus	4.3e-21	40.0

DBSCAN-SWA_7

935062 : 967212

Clostridium_botulinum_C_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20903.1\|935062_935644_-\|transposase	putative transposase	NA	NA	NA	NA
AVF20904.1\|935735_936380_-	hypothetical protein	NA	NA	NA	NA
AVF20905.1\|936725_937052_+	hypothetical protein	NA	NA	NA	NA
AVF20906.1\|937178_937487_-	hypothetical protein	NA	NA	NA	NA
AVF20907.1\|937879_938113_+	hypothetical protein	NA	NA	NA	NA
AVF20908.1\|938184_938853_+	Adenosylcobinamide amidohydrolase	NA	NA	NA	NA
AVF20909.1\|939785_939944_-	Ribosomal RNA large subunit methyltransferase Cfr	NA	NA	NA	NA
AVF20910.1\|940053_940164_-	hypothetical protein	NA	NA	NA	NA
AVF20911.1\|940361_940757_+\|transposase	transposase IS200-family protein	Q332K6	Clostridium_botulinum_C_phage	7.0e-40	62.8
AVF20912.1\|940761_941775_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	1.3e-18	30.6
AVF20913.1\|941930_943409_-	ATP-binding cassette efflux transporter-like protein	A0A2K9L0W2	Tupanvirus	5.0e-30	25.4
AVF20914.1\|944659_944881_-	hypothetical protein	NA	NA	NA	NA
AVF20915.1\|944932_945052_-	hypothetical protein	NA	NA	NA	NA
AVF20916.1\|945048_945270_-	hypothetical protein	NA	NA	NA	NA
AVF20917.1\|945914_947210_-	two-component sensor kinase	NA	NA	NA	NA
AVF20918.1\|947216_947954_-	Two-component response regulator LytS-like protein	NA	NA	NA	NA
AVF20919.1\|948169_948727_+	Membrane protein putatively involved in post-translational modification of the autoinducing quorum-sensing peptide	NA	NA	NA	NA
AVF20920.1\|948797_948938_+	cyclic lactone autoinducer peptide	NA	NA	NA	NA
AVF20921.1\|948962_949160_+	hypothetical protein	NA	NA	NA	NA
AVF20922.1\|949279_950677_+	radical SAM domain protein	NA	NA	NA	NA
AVF20923.1\|950683_951907_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF20924.1\|951971_952841_+	arginine deiminase ArcA	NA	NA	NA	NA
AVF20925.1\|952858_953857_+	ornithine carbamoyltransferase, catabolic	NA	NA	NA	NA
AVF20926.1\|953953_955369_+	arginine/ornithine antiporter ArcD	NA	NA	NA	NA
AVF20927.1\|955385_956339_+	carbamate kinase ArcC	NA	NA	NA	NA
AVF20928.1\|956377_957064_+	cAMP-binding protein	NA	NA	NA	NA
AVF20929.1\|957119_957617_-	cAMP-binding protein	NA	NA	NA	NA
AVF20930.1\|958110_958278_+	L-gulono-1,4-lactone dehydrogenase	NA	NA	NA	NA
AVF20931.1\|958351_958777_-	putative ribosomal protein	NA	NA	NA	NA
AVF20932.1\|958905_959769_-	copper amine oxidase-like protein	NA	NA	NA	NA
AVF20933.1\|960110_961142_-	putative membrane protein	NA	NA	NA	NA
AVF20934.1\|961374_961809_+	hypothetical protein	NA	NA	NA	NA
AVF20935.1\|961914_962238_+	hypothetical protein	NA	NA	NA	NA
AVF20936.1\|962841_963012_+	hypothetical protein	NA	NA	NA	NA
AVF20937.1\|963032_963299_+	hypothetical protein	NA	NA	NA	NA
AVF20938.1\|963757_965227_+	hypothetical protein	NA	NA	NA	NA
AVF20939.1\|965198_965552_+	hypothetical protein	NA	NA	NA	NA
AVF20940.1\|965541_966204_+	ATP-binding protein CirD	A0A2H4PQG7	Staphylococcus_phage	1.4e-13	28.1
AVF20941.1\|966301_966637_-\|transposase	transposase	NA	NA	NA	NA
AVF20942.1\|966654_967212_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_8

972505 : 1029367

Apis_mellifera_filamentous_virus(20.0%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF20947.1\|972505_973063_+\|transposase	transposase	NA	NA	NA	NA
AVF20948.1\|973080_973590_+\|transposase	transposase	NA	NA	NA	NA
AVF20949.1\|973752_975216_+	GlcNAc-binding protein A	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.3e-26	38.2
AVF20950.1\|975383_975842_+	transcriptional regulator, XRE family	NA	NA	NA	NA
AVF20951.1\|975915_976218_+	transcriptional regulator, XRE family	NA	NA	NA	NA
AVF20952.1\|976280_977156_-	ferri-bacillibactin esterase BesA	NA	NA	NA	NA
AVF20953.1\|977303_978521_-	cytochrome P450	NA	NA	NA	NA
AVF20954.1\|979004_980885_+	ATP-dependent OLD family endonuclease	NA	NA	NA	NA
AVF20955.1\|980971_981292_-	hypothetical protein	NA	NA	NA	NA
AVF20956.1\|981661_981901_+	type I restriction enzyme EcoKI subunit R-like protein	NA	NA	NA	NA
AVF20957.1\|981897_982461_+	type I restriction enzyme EcoKI subunit R-like protein	NA	NA	NA	NA
AVF20958.1\|982457_983690_+	type-1 restriction enzyme StySJI specificity protein HsdS	NA	NA	NA	NA
AVF20959.1\|984421_984802_+	hypothetical protein	NA	NA	NA	NA
AVF20960.1\|984791_986999_+	putative DNA helicase	NA	NA	NA	NA
AVF20961.1\|987032_987260_-	hypothetical protein	NA	NA	NA	NA
AVF20962.1\|987275_987488_-\|transposase	transposase	NA	NA	NA	NA
AVF20963.1\|987664_988105_+\|transposase	transposase	NA	NA	NA	NA
AVF20964.1\|988560_989235_-	hypothetical protein	NA	NA	NA	NA
AVF20965.1\|989376_989664_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVF20966.1\|990940_991297_+	hypothetical protein	Q38196	Clostridium_botulinum_phage	2.7e-06	35.5
AVF20967.1\|991212_991461_-	hypothetical protein	NA	NA	NA	NA
AVF20968.1\|991432_991687_-	hypothetical protein	NA	NA	NA	NA
AVF20969.1\|992794_994876_+	Thioredoxin-related protein	NA	NA	NA	NA
AVF20970.1\|995030_996071_-	hypothetical protein	NA	NA	NA	NA
AVF20971.1\|996447_997395_+	Sulfite exporter TauE/SafE	NA	NA	NA	NA
AVF20972.1\|997457_998150_-	putative membrane protein	NA	NA	NA	NA
AVF20973.1\|998146_998506_-	LrgA family protein	NA	NA	NA	NA
AVF20974.1\|998833_1000036_+	NAD-dependent malic enzyme	NA	NA	NA	NA
AVF20975.1\|1000241_1001567_+	inosine-5'-monophosphate dehydrogenase GuaB	NA	NA	NA	NA
AVF20976.1\|1001852_1002014_+	hypothetical protein	NA	NA	NA	NA
AVF20977.1\|1002073_1003366_+	isocitrate lyase AceA	NA	NA	NA	NA
AVF20978.1\|1003395_1004994_+	malate synthase Mls	NA	NA	NA	NA
AVF20979.1\|1005129_1008255_+	putative N-acetyltransferase YvbK	NA	NA	NA	NA
AVF20980.1\|1008287_1008719_+	hypothetical protein	NA	NA	NA	NA
AVF20981.1\|1011410_1011689_-	hypothetical protein	NA	NA	NA	NA
AVF20982.1\|1011688_1012120_-	hypothetical protein	NA	NA	NA	NA
AVF20983.1\|1012247_1012802_+	hypothetical protein	NA	NA	NA	NA
AVF20984.1\|1012798_1013389_-	putative carbonic anhydrase YtiB	NA	NA	NA	NA
AVF20985.1\|1013411_1013747_-	HesB/YadR/YfhF-family protein	NA	NA	NA	NA
AVF20986.1\|1013853_1015374_+	Zn-dependent carboxypeptidase	NA	NA	NA	NA
AVF20987.1\|1015963_1017052_-\|transposase	putative transposase	NA	NA	NA	NA
AVF20988.1\|1017364_1017865_+	ABC transporter-like protein	NA	NA	NA	NA
AVF20989.1\|1018032_1018275_+	ABC transporter, ATP-binding protein	NA	NA	NA	NA
AVF20990.1\|1018275_1018827_+	glycine betaine transport ATP-binding protein OpuAA	G3M9Y6	Bacillus_virus	2.3e-20	39.6
AVF20991.1\|1018816_1019107_+	hypothetical protein	NA	NA	NA	NA
AVF20992.1\|1019546_1020509_+	putative lipoprotein	NA	NA	NA	NA
AVF20993.1\|1020606_1021176_+\|coat	spore coat protein E	NA	NA	NA	NA
AVF20994.1\|1021277_1022633_+	hypothetical protein	NA	NA	NA	NA
AVF20995.1\|1022756_1025438_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	5.8e-29	22.2
AVF20996.1\|1025468_1027517_+	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	6.0e-66	30.2
AVF20997.1\|1027586_1028417_+	methyltransferase-like protein	NA	NA	NA	NA
AVF20998.1\|1028404_1029367_+\|tRNA	tRNA dimethylallyltransferase MiaA	NA	NA	NA	NA

DBSCAN-SWA_9

1041456 : 1090516

Paenibacillus_phage(45.45%)

tRNA,integrase,transposase,coat

attL 1048649:1048666|attR 1079236:1079253

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21010.1\|1041456_1041588_+\|transposase	transposase	NA	NA	NA	NA
AVF21011.1\|1041791_1042607_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-58	45.4
AVF21012.1\|1042716_1043547_-\|integrase	integrase catalytic region	Q6H9S6	Enterobacteria_phage	1.0e-16	26.1
AVF21013.1\|1043990_1044365_+	toxin-like protein	NA	NA	NA	NA
AVF21014.1\|1044325_1044679_+	toxin-like protein	NA	NA	NA	NA
AVF21015.1\|1045186_1048543_+	toxin-like protein	A0A1V0E026	Clostridioides_phage	1.4e-88	37.6
1048649:1048666	attL	NA	NA	NA	NA
AVF21016.1\|1048763_1049207_-\|transposase	transposase-like protein	NA	NA	NA	NA
AVF21017.1\|1049624_1049951_-\|transposase	transposase	NA	NA	NA	NA
AVF21018.1\|1050019_1050259_-\|integrase	phage integrase-like protein	A0A0S2SXP1	Bacillus_phage	5.5e-24	71.8
AVF21019.1\|1050518_1050869_+	hypothetical protein	NA	NA	NA	NA
AVF21020.1\|1050708_1051041_-	hypothetical protein	NA	NA	NA	NA
AVF21021.1\|1051030_1051492_-\|transposase	putative transposase for insertion sequence element IS3 family protein	A0A2I6AZV9	Macacine_betaherpesvirus	4.2e-20	40.7
AVF21022.1\|1051535_1051946_-	hypothetical protein	NA	NA	NA	NA
AVF21023.1\|1052861_1054085_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21024.1\|1054940_1056032_+	membrane transcriptional regulator-like protein	NA	NA	NA	NA
AVF21025.1\|1056129_1056363_+	hypothetical protein	A0A0K2CYV5	Paenibacillus_phage	2.2e-09	46.6
AVF21026.1\|1056859_1057126_+	hypothetical protein	A0A2I7SCW2	Paenibacillus_phage	1.9e-28	72.7
AVF21027.1\|1057271_1057889_-	LexA repressor	A0A1B2APZ1	Phage_Wrath	6.5e-16	63.8
AVF21028.1\|1058034_1058412_+	Cell division suppressor protein YneA	NA	NA	NA	NA
AVF21029.1\|1058593_1058779_+	hypothetical protein	NA	NA	NA	NA
AVF21030.1\|1058805_1059600_+	phosphatase-like protein	NA	NA	NA	NA
AVF21031.1\|1059705_1060248_-	acireductone dioxygenase MtnD	NA	NA	NA	NA
AVF21032.1\|1060524_1063965_+	methionine synthase MetH	A0A140XBC7	Dickeya_phage	5.1e-09	46.7
AVF21033.1\|1064139_1065096_+	ribonuclease Z	NA	NA	NA	NA
AVF21034.1\|1065134_1065248_+	hypothetical protein	NA	NA	NA	NA
AVF21035.1\|1065219_1065594_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	4.6e-65	96.8
AVF21036.1\|1066594_1067362_-\|transposase	transposase	A0A2I7SC07	Paenibacillus_phage	5.7e-62	61.5
AVF21037.1\|1067389_1068613_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21038.1\|1068605_1068956_-	hypothetical protein	A0A2I7SC07	Paenibacillus_phage	2.9e-13	61.2
AVF21039.1\|1069719_1069905_-	hypothetical protein	A0A0C5AJ71	Bacteriophage	6.0e-10	65.2
AVF21040.1\|1070587_1070821_+	hypothetical protein	A0A0C5AFE4	Paenibacillus_phage	1.6e-20	75.3
AVF21041.1\|1071176_1073840_+	ATP-dependent helicase	NA	NA	NA	NA
AVF21042.1\|1074094_1075162_+	putative phage DNA-binding protein	A0A0A7RTT7	Clostridium_phage	2.2e-48	33.9
AVF21043.1\|1075410_1075893_+	putative phage protein	A0A0N9SGM1	Paenibacillus_phage	1.4e-26	41.3
AVF21044.1\|1076094_1076646_-	hypothetical protein	NA	NA	NA	NA
AVF21045.1\|1077455_1078205_-	putative phage-associated protein	A0A0C5ABL3	Bacteriophage	5.1e-92	67.5
AVF21046.1\|1078207_1078969_-	hypothetical protein	A0A0C5AN10	Bacteriophage	2.9e-82	68.7
AVF21047.1\|1079718_1081281_+	bacillolysin	NA	NA	NA	NA
1079236:1079253	attR	NA	NA	NA	NA
AVF21048.1\|1081692_1082916_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21049.1\|1083366_1083681_+	hypothetical protein	NA	NA	NA	NA
AVF21050.1\|1084275_1084914_+	ribonuclease H	NA	NA	NA	NA
AVF21051.1\|1085126_1086545_+	cobyrinic acid A,C-diamide synthase	NA	NA	NA	NA
AVF21052.1\|1086923_1087910_+\|tRNA	tryptophan--tRNA ligase TrpS	NA	NA	NA	NA
AVF21053.1\|1088287_1088512_+	small, acid-soluble spore protein A	A0A1P8CX76	Bacillus_phage	5.6e-10	47.8
AVF21054.1\|1088648_1089632_-	membrane-bound metal-dependent hydrolase	NA	NA	NA	NA
AVF21055.1\|1090036_1090516_-\|coat	spore coat protein GerQ	NA	NA	NA	NA

DBSCAN-SWA_10

1168081 : 1303001

160

Paenibacillus_phage(80.2%)

terminase,integrase,portal,coat,capsid,transposase,tail,protease,head

attL 1191973:1191988|attR 1269431:1270819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21135.1\|1168081_1168591_-\|transposase	transposase	NA	NA	NA	NA
AVF21136.1\|1168608_1169166_-\|transposase	transposase	NA	NA	NA	NA
AVF21137.1\|1169270_1169870_+	S-layer domain-containing protein	NA	NA	NA	NA
AVF21138.1\|1170142_1171063_+	endo-1,4-D-glucanase	NA	NA	NA	NA
AVF21139.1\|1171164_1172457_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AVF21140.1\|1172775_1174215_+	NAD-dependent malic enzyme	NA	NA	NA	NA
AVF21141.1\|1174218_1175013_+	MSM operon regulatory protein-like protein	NA	NA	NA	NA
AVF21142.1\|1175078_1175558_+	protein YtsP	NA	NA	NA	NA
AVF21143.1\|1175660_1176344_+\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	2.2e-121	97.8
AVF21144.1\|1176481_1177234_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF21145.1\|1177554_1178154_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF21146.1\|1178183_1178696_-	efflux transporter-like protein	NA	NA	NA	NA
AVF21147.1\|1178707_1179490_-	phosphatidylserine decarboxylase proenzyme Psd	NA	NA	NA	NA
AVF21148.1\|1179829_1180996_-	alcohol dehydrogenase GbsB	NA	NA	NA	NA
AVF21149.1\|1181138_1181477_+	putative L,D-transpeptidase YkuD	NA	NA	NA	NA
AVF21150.1\|1181598_1185012_+	hypothetical protein	NA	NA	NA	NA
AVF21151.1\|1185188_1189433_+	hypothetical protein	NA	NA	NA	NA
AVF21152.1\|1189687_1190410_+\|coat	spore coat polysaccharide biosynthesis protein SpsI	G3MA50	Bacillus_virus	3.2e-46	40.9
AVF21153.1\|1190406_1191597_+	putative spore maturation protein	NA	NA	NA	NA
AVF21154.1\|1191571_1192708_+	putative spore maturation protein	NA	NA	NA	NA
1191973:1191988	attL	NA	NA	NA	NA
AVF21155.1\|1192707_1193079_+	hypothetical protein	NA	NA	NA	NA
1191973:1191988	attL	NA	NA	NA	NA
AVF21156.1\|1193259_1194813_+	extracellular matrix biosynthesis-like protein	NA	NA	NA	NA
AVF21157.1\|1194809_1195904_+	UDP-N-acetylglucosamine 2-epimerase WecB	A0A2P1ELS7	Moumouvirus	1.9e-87	44.4
AVF21158.1\|1195893_1196880_+	polysaccharide biosynthesis protein CapD	A0A1V0SAI8	Catovirus	4.2e-41	33.7
AVF21159.1\|1196876_1197707_+	putative reductase	NA	NA	NA	NA
AVF21160.1\|1197703_1198609_+	UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase	A0A291LAD7	Escherichia_phage	1.2e-15	25.7
AVF21161.1\|1198616_1199336_+	glycosyltransferase-like protein	K7Z8A5	Megavirus	1.2e-10	23.6
AVF21162.1\|1199417_1200338_-	NAD dependent epimerase/dehydratase family protein WcaG	E3T4Y8	Cafeteria_roenbergensis_virus	7.4e-32	31.2
AVF21163.1\|1200491_1201283_+	glycosyltransferase, group 2 family protein	NA	NA	NA	NA
AVF21164.1\|1201287_1202304_+	glycosyl transferase family 2	NA	NA	NA	NA
AVF21165.1\|1202290_1203127_+	glycosyltransferase-like protein	NA	NA	NA	NA
AVF21166.1\|1203210_1204077_-	3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2	NA	NA	NA	NA
AVF21167.1\|1204492_1205194_+	dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit	NA	NA	NA	NA
AVF21168.1\|1205174_1206107_+	dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	NA	NA	NA	NA
AVF21169.1\|1206084_1207557_+	putative permease	NA	NA	NA	NA
AVF21170.1\|1207697_1207922_+	spore germination protein GerE	A0A290GJH9	Caldibacillus_phage	3.7e-14	70.5
AVF21171.1\|1209765_1210404_-	channel protein, hemolysin III family	NA	NA	NA	NA
AVF21172.1\|1211067_1211346_-	DNA-binding protein HU 1	M4SRV7	Rhodobacter_phage	7.2e-07	38.3
AVF21173.1\|1211446_1211653_-	cold shock-like protein CspLB	Q9AZD3	Lactococcus_phage	4.6e-19	64.6
AVF21174.1\|1212062_1212968_-\|integrase	phage integrase family protein	A0A0A7AR08	Bacillus_phage	3.5e-87	55.5
AVF21175.1\|1213322_1213682_-	putative phage DNA-binding protein	NA	NA	NA	NA
AVF21176.1\|1213746_1214970_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21177.1\|1214976_1216488_-	type-F conjugative transfer system pilin assembly protein TraF	NA	NA	NA	NA
AVF21178.1\|1218763_1218982_+	hypothetical protein	NA	NA	NA	NA
1217600:1217615	attR	NA	NA	NA	NA
AVF21179.1\|1219498_1219942_+\|transposase	transposase-like protein	NA	NA	NA	NA
1217600:1217615	attR	NA	NA	NA	NA
AVF21180.1\|1220680_1221904_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21181.1\|1222153_1223101_-	L-lactate dehydrogenase P	NA	NA	NA	NA
AVF21182.1\|1223602_1224337_+	methyltransferase domain protein	NA	NA	NA	NA
AVF21183.1\|1224346_1225330_+	beta-lactamase domain protein	NA	NA	NA	NA
AVF21184.1\|1225581_1226823_-\|integrase	phage integrase-like protein	A0A0K2CZ62	Paenibacillus_phage	5.9e-242	100.0
AVF21185.1\|1226877_1227357_-	hypothetical protein	A0A0K2CZC9	Paenibacillus_phage	4.4e-89	100.0
AVF21186.1\|1227362_1228049_-	helix-turn-helix family protein	A0A0K2CZS1	Paenibacillus_phage	2.7e-124	99.6
AVF21187.1\|1228156_1228393_+	anaerobic benzoate catabolism transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	7.4e-37	100.0
AVF21188.1\|1228618_1229443_+	hypothetical protein	A0A0K2CZE3	Paenibacillus_phage	4.6e-150	100.0
AVF21189.1\|1229462_1229852_+	hypothetical protein	A0A0K2CZ66	Paenibacillus_phage	1.2e-68	100.0
AVF21190.1\|1229848_1230613_+	phage regulatory protein, Rha family	A0A0K2CZD5	Paenibacillus_phage	7.5e-131	100.0
AVF21191.1\|1230609_1230903_+	Helix-turn-helix domain protein	A0A0K2CZS5	Paenibacillus_phage	4.4e-47	100.0
AVF21192.1\|1230918_1231557_+	hypothetical protein	A0A0K2CZL5	Paenibacillus_phage	1.3e-128	100.0
AVF21193.1\|1231579_1231795_+	hypothetical protein	A0A0K2CZE8	Paenibacillus_phage	1.6e-30	100.0
AVF21194.1\|1231791_1231923_+	hypothetical protein	A0A0K2CZ71	Paenibacillus_phage	5.7e-15	100.0
AVF21195.1\|1231919_1232177_+	hypothetical protein	A0A0K2CZE0	Paenibacillus_phage	8.3e-42	100.0
AVF21196.1\|1232133_1232328_+	hypothetical protein	A0A0K2CZS8	Paenibacillus_phage	6.9e-33	100.0
AVF21197.1\|1232311_1232584_+	hypothetical protein	A0A0K2CZL9	Paenibacillus_phage	2.2e-45	100.0
AVF21198.1\|1232606_1232825_+	hypothetical protein	A0A0K2CZF4	Paenibacillus_phage	7.0e-34	100.0
AVF21199.1\|1232859_1233093_+	hypothetical protein	A0A0K2CZ76	Paenibacillus_phage	2.8e-36	100.0
AVF21200.1\|1233085_1233274_+	hypothetical protein	A0A0K2CZE4	Paenibacillus_phage	5.3e-30	100.0
AVF21201.1\|1233289_1233679_+	hypothetical protein	A0A0K2CZT2	Paenibacillus_phage	3.0e-67	100.0
AVF21202.1\|1233684_1233924_+	hypothetical protein	A0A0K2CZM3	Paenibacillus_phage	8.2e-36	100.0
AVF21203.1\|1233938_1234097_+	hypothetical protein	A0A0K2CZG0	Paenibacillus_phage	5.1e-18	100.0
AVF21204.1\|1234175_1234295_+	hypothetical protein	A0A0K2CZ81	Paenibacillus_phage	2.9e-18	100.0
AVF21205.1\|1234379_1234595_+	hypothetical protein	A0A0K2CZE9	Paenibacillus_phage	2.7e-30	98.6
AVF21206.1\|1234601_1235300_+	C-5 cytosine-specific DNA methylase	A0A0K2CZT5	Paenibacillus_phage	8.1e-124	100.0
AVF21207.1\|1235308_1235530_+	hypothetical protein	A0A0K2CZM7	Paenibacillus_phage	3.8e-35	100.0
AVF21208.1\|1235548_1235899_+	hypothetical protein	A0A0K2CZG5	Paenibacillus_phage	1.6e-48	100.0
AVF21209.1\|1235895_1236180_+	transition state regulatory protein AbrB	A0A0K2CZ86	Paenibacillus_phage	2.0e-49	100.0
AVF21210.1\|1236212_1236584_+	hypothetical protein	A0A0K2CZF3	Paenibacillus_phage	5.7e-60	100.0
AVF21211.1\|1236620_1237331_+	hypothetical protein	A0A0K2CZT8	Paenibacillus_phage	3.6e-127	100.0
AVF21212.1\|1237396_1238707_+	putative ATP-binding protein involved in virulence	A0A0K2CZN2	Paenibacillus_phage	2.1e-181	100.0
AVF21213.1\|1238709_1239786_+	hypothetical protein	A0A0K2CZH1	Paenibacillus_phage	5.1e-210	100.0
AVF21214.1\|1239810_1240317_+	hypothetical protein	A0A0K2CZ91	Paenibacillus_phage	1.8e-93	100.0
AVF21215.1\|1240326_1241907_+	UvrABC system protein B	A0A0K2CZF8	Paenibacillus_phage	4.7e-305	100.0
AVF21216.1\|1242066_1244373_+	Regulatory protein RepA	A0A0K2CZ75	Paenibacillus_phage	0.0e+00	100.0
AVF21217.1\|1244584_1244938_+	hypothetical protein	A0A0K2CZH7	Paenibacillus_phage	2.1e-64	100.0
AVF21218.1\|1244927_1245323_+	Holliday junction resolvase	A0A0K2CZ96	Paenibacillus_phage	2.0e-71	100.0
AVF21219.1\|1245326_1245548_+	hypothetical protein	A0A0K2CZG3	Paenibacillus_phage	9.9e-36	100.0
AVF21220.1\|1245549_1246650_+	RNA polymerase sigma-F factor SigF	A0A0K2CZU8	Paenibacillus_phage	6.6e-213	100.0
AVF21221.1\|1246683_1246878_+	hypothetical protein	A0A0K2CZP1	Paenibacillus_phage	3.2e-30	100.0
AVF21222.1\|1246874_1247303_+	phage transcriptional regulator, RinA family	A0A0K2CZI2	Paenibacillus_phage	1.9e-75	100.0
AVF21223.1\|1247434_1247638_+	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	4.0e-31	100.0
AVF21224.1\|1247701_1247926_+	YcfA-like protein	A0A0K2CZG8	Paenibacillus_phage	1.0e-35	100.0
AVF21225.1\|1247915_1248326_+	hypothetical protein	A0A0K2CZV4	Paenibacillus_phage	2.9e-73	100.0
AVF21226.1\|1248374_1248647_+	hypothetical protein	A0A0K2CZP5	Paenibacillus_phage	5.9e-46	100.0
AVF21227.1\|1248880_1249231_+	hypothetical protein	A0A0K2CZA6	Paenibacillus_phage	9.5e-65	100.0
AVF21228.1\|1249242_1249587_+	HNH endonuclease	A0A0K2CZA0	Paenibacillus_phage	4.3e-62	100.0
AVF21229.1\|1249690_1250005_+\|terminase	putative phage terminase, small subunit, P27 family	A0A0K2CZ94	Paenibacillus_phage	1.6e-50	100.0
AVF21230.1\|1249982_1251710_+\|terminase	Phage terminase-like protein, large subunit	A0A0K2CZH9	Paenibacillus_phage	0.0e+00	100.0
AVF21231.1\|1251724_1252960_+\|portal	phage portal protein, HK97 family	A0A0K2CZB0	Paenibacillus_phage	3.5e-239	99.8
AVF21232.1\|1252910_1253666_+\|protease	ATP-dependent Clp protease proteolytic subunit ClpP	A0A0K2CZ28	Paenibacillus_phage	4.6e-133	100.0
AVF21233.1\|1253662_1254805_+\|capsid	phage major capsid protein, HK97 family	A0A0K2CZ99	Paenibacillus_phage	3.5e-209	100.0
AVF21234.1\|1254930_1255194_+	putative phage protein (possible DNA packaging)	A0A0K2CZI4	Paenibacillus_phage	4.2e-41	100.0
AVF21235.1\|1255190_1255511_+\|head,tail	putative phage head-tail adaptor	A0A0K2CZB5	Paenibacillus_phage	3.0e-57	100.0
AVF21236.1\|1255507_1255900_+	phage protein, HK97 gp10 family	A0A0K2CZ33	Paenibacillus_phage	4.3e-66	100.0
AVF21237.1\|1255896_1256226_+	hypothetical protein	A0A0K2CZA4	Paenibacillus_phage	4.4e-56	100.0
AVF21238.1\|1256261_1256858_+\|tail	phage major tail protein, phi13 family	A0A0K2CZP8	Paenibacillus_phage	3.9e-111	100.0
AVF21239.1\|1256929_1257301_+	hypothetical protein	A0A0K2CZI8	Paenibacillus_phage	2.9e-64	100.0
AVF21240.1\|1257534_1261239_+\|tail	phage tail tape measure protein, TP901 family, core region	A0A0K2CZ38	Paenibacillus_phage	0.0e+00	100.0
AVF21241.1\|1261239_1262106_+	Phage-related protein	A0A0K2CZA8	Paenibacillus_phage	4.0e-165	100.0
AVF21242.1\|1262108_1263227_+	hypothetical protein	A0A0K2CZQ1	Paenibacillus_phage	2.0e-212	100.0
AVF21243.1\|1263232_1264306_+	phage structural protein	A0A0K2CZJ3	Paenibacillus_phage	7.1e-212	99.7
AVF21244.1\|1264315_1264657_+	hypothetical protein	A0A0K2CZC5	Paenibacillus_phage	9.9e-59	100.0
AVF21245.1\|1264653_1264815_+	hypothetical protein	A0A0K2CZ44	Paenibacillus_phage	8.8e-26	100.0
AVF21246.1\|1264795_1265026_+	hypothetical protein	A0A0K2CZB4	Paenibacillus_phage	2.0e-34	100.0
AVF21247.1\|1265022_1265694_+	N-acetylmuramoyl-L-alanine amidase	A0A0K2CZQ6	Paenibacillus_phage	8.3e-134	100.0
AVF21248.1\|1265705_1266170_+	hypothetical protein	A0A0K2CZJ8	Paenibacillus_phage	4.5e-86	100.0
AVF21249.1\|1266189_1266429_+	hypothetical protein	A0A0K2CZD0	Paenibacillus_phage	1.0e-33	100.0
AVF21250.1\|1266572_1266752_+	hypothetical protein	A0A0K2CZ50	Paenibacillus_phage	7.1e-24	98.3
AVF21251.1\|1266834_1267107_-	hypothetical protein	A0A0K2CZB9	Paenibacillus_phage	4.3e-49	100.0
AVF21252.1\|1267120_1267393_-	hypothetical protein	A0A0K2CZR1	Paenibacillus_phage	3.3e-41	100.0
AVF21253.1\|1267471_1267645_-	hypothetical protein	A0A0K2CZV9	Paenibacillus_phage	5.6e-26	100.0
AVF21254.1\|1267622_1267841_-	hypothetical protein	A0A0K2CZK3	Paenibacillus_phage	6.8e-37	100.0
AVF21255.1\|1267878_1268082_-	hypothetical protein	A0A0K2CZD3	Paenibacillus_phage	2.9e-34	100.0
AVF21256.1\|1268146_1269370_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21257.1\|1269651_1269804_+	Arc-like DNA binding domain protein	A0A0K2CZC4	Paenibacillus_phage	5.8e-19	100.0
AVF21258.1\|1270372_1270852_-	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	2.6e-81	100.0
AVF21259.1\|1271231_1271813_+	transcriptional regulator, TetR family	NA	NA	NA	NA
AVF21260.1\|1271880_1272222_+	small multidrug resistance protein	NA	NA	NA	NA
AVF21261.1\|1272221_1272536_+	putative membrane protein	NA	NA	NA	NA
AVF21262.1\|1273261_1274245_+	phage structural protein	A0A0C5AEQ0	Bacteriophage	7.1e-49	75.9
AVF21263.1\|1274244_1274403_+	hypothetical protein	A0A2H4J054	uncultured_Caudovirales_phage	7.4e-09	58.7
AVF21264.1\|1274790_1275468_+	N-acetylmuramoyl-L-alanine amidase	A0A0K2CYE7	Paenibacillus_phage	4.8e-129	95.1
AVF21265.1\|1275477_1275708_+	hypothetical protein	R9W000	Paenibacillus_phage	5.0e-06	96.7
AVF21266.1\|1275813_1275927_+	hypothetical protein	NA	NA	NA	NA
AVF21267.1\|1275993_1276170_+	hypothetical protein	NA	NA	NA	NA
AVF21268.1\|1276192_1276702_-\|transposase	transposase	NA	NA	NA	NA
AVF21269.1\|1276719_1277277_-\|transposase	transposase	NA	NA	NA	NA
AVF21270.1\|1277426_1277966_+	hypothetical protein	NA	NA	NA	NA
AVF21271.1\|1278192_1279032_+	putative lethal factor domain protein	NA	NA	NA	NA
AVF21272.1\|1279045_1279318_+	ribonuclease inhibitor-like protein	NA	NA	NA	NA
AVF21273.1\|1279689_1280166_-	hypothetical protein	A0A0C5AER4	Bacteriophage	3.3e-36	69.3
AVF21274.1\|1280911_1281094_+	hypothetical protein	NA	NA	NA	NA
AVF21275.1\|1281324_1282134_-	putative membrane protein	NA	NA	NA	NA
AVF21276.1\|1282245_1282761_-	phosphatidylglycerophosphatase A-like protein	G3MBC5	Bacillus_virus	8.5e-38	53.6
AVF21277.1\|1282997_1284029_+	spore germination protein GerM	NA	NA	NA	NA
AVF21278.1\|1284364_1285120_+	ribonuclease PH	NA	NA	NA	NA
AVF21279.1\|1285106_1285739_+	Non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
AVF21280.1\|1285806_1287651_-	asparagine ligase	L7RC73	Acanthamoeba_polyphaga_moumouvirus	9.9e-28	24.7
AVF21281.1\|1287747_1288293_+	hypothetical protein	NA	NA	NA	NA
AVF21282.1\|1288458_1288935_+	Bacterial membrane flanked domain protein	NA	NA	NA	NA
AVF21283.1\|1288927_1290442_+	Bacterial membrane flanked domain protein	NA	NA	NA	NA
AVF21284.1\|1290496_1290610_+	hypothetical protein	NA	NA	NA	NA
AVF21285.1\|1290623_1290740_+	hypothetical protein	NA	NA	NA	NA
AVF21286.1\|1290836_1292057_+	PGA biosynthesis protein CapA	A0A2H4J5Z6	uncultured_Caudovirales_phage	4.8e-55	33.9
AVF21287.1\|1292187_1293090_+	hypothetical protein	NA	NA	NA	NA
AVF21288.1\|1293268_1294570_+	trigger factor Tig	NA	NA	NA	NA
AVF21289.1\|1294734_1295325_+\|protease	ATP-dependent Clp protease proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.2e-56	56.1
AVF21290.1\|1295340_1296600_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.5e-149	65.0
AVF21291.1\|1296704_1297826_+	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG	NA	NA	NA	NA
AVF21292.1\|1297876_1298575_-	N-acetylmuramoyl-L-alanine amidase-like protein	NA	NA	NA	NA
AVF21293.1\|1298799_1300518_+\|protease	Lon protease 2	A0A0R6PGP8	Moraxella_phage	3.6e-16	25.1
AVF21294.1\|1300667_1303001_+\|protease	Lon protease Lon	A0A0R6PGP8	Moraxella_phage	4.3e-169	41.5

DBSCAN-SWA_11

1360120 : 1428442

uncultured_Mediterranean_phage(18.75%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21353.1\|1360120_1361215_+\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AVF21354.1\|1361220_1362357_+\|tRNA	queuine tRNA-ribosyltransferase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	5.2e-88	46.4
AVF21355.1\|1362375_1362690_+	preprotein translocase subunit YajC-like protein	A0A1B1IVR5	uncultured_Mediterranean_phage	1.1e-08	39.8
AVF21356.1\|1362942_1363332_-	putative membrane protein	NA	NA	NA	NA
AVF21357.1\|1363529_1364216_+	putative membrane protein	NA	NA	NA	NA
AVF21358.1\|1364263_1365829_-	stage V sporulation protein B	NA	NA	NA	NA
AVF21359.1\|1365988_1366321_+	post-transcriptional regulator-like protein	NA	NA	NA	NA
AVF21360.1\|1366430_1367663_+	protein translocase subunit SecDF	NA	NA	NA	NA
AVF21361.1\|1367652_1368633_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.1e-20	30.9
AVF21362.1\|1368708_1369665_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
AVF21363.1\|1369688_1372130_+	Single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.4e-98	34.6
AVF21364.1\|1372126_1372639_+	adenine phosphoribosyltransferase Apt	A0A1V0SKE5	Klosneuvirus	1.2e-31	47.6
AVF21365.1\|1372705_1373971_-	uracil permease UraA	Q9KX94	Enterobacteria_phage	1.2e-72	41.0
AVF21366.1\|1374202_1376389_+	GTP pyrophosphokinase RelA	J9Q7H7	Salmonella_phage	7.6e-11	40.1
AVF21367.1\|1376421_1376874_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase Dtd	NA	NA	NA	NA
AVF21368.1\|1377017_1377194_+	hypothetical protein	NA	NA	NA	NA
AVF21369.1\|1377317_1378850_+	oxygen-independent coproporphyrinogen-III oxidase 2	NA	NA	NA	NA
AVF21370.1\|1378891_1380841_+	dihydrolipoamide dehydrogenase	NA	NA	NA	NA
AVF21371.1\|1380899_1382258_-	putative multidrug resistance protein NorM	NA	NA	NA	NA
AVF21372.1\|1382781_1383087_+	transcriptional regulator, HxlR family	NA	NA	NA	NA
AVF21373.1\|1383522_1384797_+\|tRNA	histidine--tRNA ligase HisS	NA	NA	NA	NA
AVF21374.1\|1384811_1386599_+\|tRNA	aspartate--tRNA ligase AspS	A0A2I2L4Y8	Orpheovirus	2.7e-14	29.3
AVF21375.1\|1386684_1387431_+	sulfur carrier protein ThiS adenylyltransferase ThiF	NA	NA	NA	NA
AVF21376.1\|1387732_1389037_+	putative AAA domain-containing protein YrvN	G3MBE0	Bacillus_virus	6.4e-98	47.1
AVF21377.1\|1389190_1390285_-\|tRNA	tRNA-specific 2-thiouridylase MnmA	NA	NA	NA	NA
AVF21378.1\|1390537_1390957_+	HTH-type transcriptional regulator CymR	NA	NA	NA	NA
AVF21379.1\|1390973_1392122_+	cysteine desulfurase IscS	Q2XUY6	environmental_halophage	2.2e-33	30.0
AVF21380.1\|1392181_1392697_+	PRC-barrel domain protein	NA	NA	NA	NA
AVF21381.1\|1392780_1392975_+	hypothetical protein	NA	NA	NA	NA
AVF21382.1\|1393165_1393645_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF21383.1\|1393671_1394802_+	putative membrane protein	NA	NA	NA	NA
AVF21384.1\|1395155_1397780_+\|tRNA	alanine--tRNA ligase AlaS	A0A1V0SK38	Klosneuvirus	1.5e-66	35.7
AVF21385.1\|1397877_1398141_+	hypothetical protein	NA	NA	NA	NA
AVF21386.1\|1398161_1398572_+	putative holliday junction resolvase	NA	NA	NA	NA
AVF21387.1\|1398583_1398892_+	hypothetical protein	NA	NA	NA	NA
AVF21388.1\|1398888_1399185_+	hypothetical protein	NA	NA	NA	NA
AVF21389.1\|1399252_1400320_+	aminodeoxychorismate lyase	NA	NA	NA	NA
AVF21390.1\|1400350_1401283_+\|protease	putative protease YrrN	NA	NA	NA	NA
AVF21391.1\|1401338_1402640_+\|protease	putative protease YrrO	Q6DW11	Phage_TP	7.4e-38	28.7
AVF21392.1\|1402853_1405001_+	methyl-accepting chemotaxis protein McpC	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-09	33.1
AVF21393.1\|1405138_1407007_+	penicillin-binding protein	NA	NA	NA	NA
AVF21394.1\|1407096_1407903_+	octanoyl-[GcvH]:protein N-octanoyltransferase LipL	NA	NA	NA	NA
AVF21395.1\|1408321_1408831_-\|transposase	transposase	NA	NA	NA	NA
AVF21396.1\|1409148_1409955_+	DSBA-like thioredoxin domain protein	NA	NA	NA	NA
AVF21397.1\|1410090_1410222_+	hypothetical protein	NA	NA	NA	NA
AVF21398.1\|1410559_1413652_+	phosphohydrolase	A0A126FC74	Lonomia_obliqua_multiple_nucleopolyhedrovirus	1.0e-37	27.5
AVF21399.1\|1413694_1414918_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21400.1\|1415214_1415688_+	Viral enhancin protein	NA	NA	NA	NA
AVF21401.1\|1416333_1417062_-	Endo-1,4-beta-xylanase Z precursor	NA	NA	NA	NA
AVF21402.1\|1417295_1418360_+	pyruvate dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
AVF21403.1\|1418409_1419390_+	pyruvate dehydrogenase E1 component subunit beta	NA	NA	NA	NA
AVF21404.1\|1419457_1420756_+	pyruvate dehydrogenase E2 dihydrolipoamide acyltransferase component	NA	NA	NA	NA
AVF21405.1\|1420760_1422176_+	dihydrolipoyl dehydrogenase PdhD	NA	NA	NA	NA
AVF21406.1\|1422420_1423161_+	glycerophosphodiester phosphodiesterase-like protein	NA	NA	NA	NA
AVF21407.1\|1423186_1424164_+	glycerate dehydrogenase HprA	M1HBE3	Paramecium_bursaria_Chlorella_virus	2.9e-26	33.3
AVF21408.1\|1424150_1425056_-	phospholipid kinase-like protein	NA	NA	NA	NA
AVF21409.1\|1425419_1425752_+	hypothetical protein	NA	NA	NA	NA
AVF21410.1\|1427531_1427867_-\|transposase	transposase	NA	NA	NA	NA
AVF21411.1\|1427884_1428442_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1500721 : 1546359

Paenibacillus_phage(41.82%)

terminase,integrase,capsid,portal,tail,protease

attL 1494361:1494375|attR 1521967:1521981

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1494361:1494375	attL	NA	NA	NA	NA
AVF21485.1\|1500721_1501954_-\|integrase	phage integrase-like protein	A0A0K2CZ62	Paenibacillus_phage	4.8e-180	75.1
AVF21486.1\|1502021_1502747_-	transcriptional regulator-like protein	Q786F1	Bacillus_phage	1.5e-11	42.2
AVF21487.1\|1503021_1503126_+	putative phage protein	NA	NA	NA	NA
AVF21488.1\|1503370_1504195_+	putative antirepressor, phage associated	A0A0C5AFE7	Paenibacillus_phage	1.1e-130	94.7
AVF21489.1\|1504403_1504664_+	hypothetical protein	NA	NA	NA	NA
AVF21490.1\|1504640_1504898_-	hypothetical protein	NA	NA	NA	NA
AVF21491.1\|1504997_1505375_+	hypothetical protein	R9VW30	Paenibacillus_phage	3.8e-59	89.6
AVF21492.1\|1505371_1505593_+	hypothetical protein	R9W0P6	Paenibacillus_phage	1.6e-30	90.4
AVF21493.1\|1505730_1505964_+	transition state regulatory protein AbrB	S5MA41	Brevibacillus_phage	5.8e-18	49.3
AVF21494.1\|1505993_1506158_+	hypothetical protein	NA	NA	NA	NA
AVF21495.1\|1506186_1506942_+	putative prophage antirepressor	A0A0C5AEJ9	Bacteriophage	1.5e-107	76.5
AVF21496.1\|1506938_1507247_+	hypothetical protein	NA	NA	NA	NA
AVF21497.1\|1507282_1507471_+	hypothetical protein	NA	NA	NA	NA
AVF21498.1\|1507467_1508151_+	putative phage anti-repressor	A0A2I7SCV5	Paenibacillus_phage	1.6e-55	73.8
AVF21499.1\|1508147_1508354_+	hypothetical protein	NA	NA	NA	NA
AVF21500.1\|1508316_1508508_+	hypothetical protein	NA	NA	NA	NA
AVF21501.1\|1508544_1508808_+	hypothetical protein	A0A0K2CZE9	Paenibacillus_phage	2.2e-13	56.3
AVF21502.1\|1508815_1509247_+	hypothetical protein	A0A0K2CYQ7	Paenibacillus_phage	1.9e-06	53.7
AVF21503.1\|1509243_1509822_+	putative sporulation protein YyaC	G3M9W0	Bacillus_virus	1.2e-24	41.2
AVF21504.1\|1509891_1511520_+	hypothetical protein	R9TQJ2	Paenibacillus_phage	5.5e-224	76.2
AVF21505.1\|1511523_1512348_+	hypothetical protein	A0A0A7S0A9	Clostridium_phage	1.9e-87	62.8
AVF21506.1\|1512328_1513141_+	phage related protein	R9TMF6	Paenibacillus_phage	2.0e-110	68.5
AVF21507.1\|1513156_1513489_+	hypothetical protein	A0A0K2CY25	Paenibacillus_phage	5.3e-57	98.2
AVF21508.1\|1513537_1514425_+	Replication initiation and membrane attachment	A0A0K2CY85	Paenibacillus_phage	8.1e-153	100.0
AVF21509.1\|1514387_1514951_+	phage-related protein	A0A0K2CYY7	Paenibacillus_phage	1.3e-84	98.7
AVF21510.1\|1515138_1515249_+	hypothetical protein	A0A0K2CYR7	Paenibacillus_phage	3.5e-10	91.7
AVF21511.1\|1515255_1515465_+	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	5.0e-29	86.8
AVF21512.1\|1515466_1515841_+	endodeoxyribonuclease RUS	A0A0K2CYQ8	Paenibacillus_phage	2.6e-44	66.9
AVF21513.1\|1515847_1515955_+	hypothetical protein	NA	NA	NA	NA
AVF21514.1\|1516031_1516397_+	hypothetical protein	A0A0K2CZ58	Paenibacillus_phage	1.5e-57	86.0
AVF21515.1\|1516411_1516933_+	hypothetical protein	NA	NA	NA	NA
AVF21516.1\|1516929_1517673_+	adenine-specific DNA methylase-like protein	A0A0E3IAX4	Synechococcus_phage	3.0e-68	52.8
AVF21517.1\|1517766_1518075_+	hypothetical protein	NA	NA	NA	NA
AVF21518.1\|1518537_1518708_+	hypothetical protein	NA	NA	NA	NA
AVF21519.1\|1518676_1519228_+	positive control sigma-like factor	A0A0K2CNQ1	Brevibacillus_phage	1.4e-46	59.6
AVF21520.1\|1519349_1519553_+	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	2.9e-26	89.6
AVF21521.1\|1519607_1519790_+	hypothetical protein	A0A0K2CZI7	Paenibacillus_phage	1.6e-10	60.3
AVF21522.1\|1519824_1519992_+	hypothetical protein	NA	NA	NA	NA
AVF21523.1\|1520050_1520791_+\|terminase	phage-related terminase-like protein small subunit	A0A2H4J4R0	uncultured_Caudovirales_phage	1.4e-44	47.5
AVF21524.1\|1520783_1522055_+\|terminase	phage-related terminase-like protein large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.5e-163	65.7
1521967:1521981	attR	NA	NA	NA	NA
AVF21525.1\|1522070_1523534_+\|portal	phage portal protein, SPP1 family	A0A0K2CNK4	Brevibacillus_phage	8.1e-166	59.3
AVF21526.1\|1523530_1524550_+	NAD(+)--arginine ADP-ribosyltransferase EFV	S5MTV5	Brevibacillus_phage	1.3e-109	57.6
AVF21527.1\|1524587_1525211_+	Phage minor structural protein GP20	A0A0K2CP96	Brevibacillus_phage	1.0e-61	59.8
AVF21528.1\|1525225_1525582_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.8e-42	73.3
AVF21529.1\|1525597_1526644_+\|capsid	putative major capsid protein	A0A0K2CP76	Brevibacillus_phage	5.4e-172	87.2
AVF21530.1\|1526655_1526889_+	hypothetical protein	NA	NA	NA	NA
AVF21531.1\|1526869_1527244_+	hypothetical protein	S5MP25	Brevibacillus_phage	2.1e-30	55.8
AVF21532.1\|1527245_1527605_+	hypothetical protein	S5M673	Brevibacillus_phage	6.4e-32	54.7
AVF21533.1\|1527604_1528015_+	phage protein	A0A0A7RTT0	Clostridium_phage	1.8e-38	56.6
AVF21534.1\|1528011_1528422_+	hypothetical protein	S5MUN8	Brevibacillus_phage	7.8e-26	46.8
AVF21535.1\|1528414_1528597_+	hypothetical protein	NA	NA	NA	NA
AVF21536.1\|1528597_1529929_+	phage protein	A0A0A7RTT5	Clostridium_phage	4.2e-113	48.4
AVF21537.1\|1529930_1530128_+	putative phage protein	S5MA61	Brevibacillus_phage	5.6e-06	61.0
AVF21538.1\|1530124_1530394_+	putative phage protein	A0A0K2CNG3	Brevibacillus_phage	3.5e-27	63.6
AVF21539.1\|1530420_1530846_+	phage protein	X5JAB6	Clostridium_phage	1.6e-26	44.8
AVF21540.1\|1530845_1531016_+	hypothetical protein	NA	NA	NA	NA
AVF21541.1\|1531069_1533178_+\|tail	putative tail length tape measure protein	A0A0K2CP22	Brevibacillus_phage	2.1e-143	42.5
AVF21542.1\|1533174_1533813_+	putative phage cell wall hydrolase	S5MUH0	Brevibacillus_phage	6.4e-51	49.1
AVF21543.1\|1533817_1534801_+	putative phage cell wall hydrolase	S5MNC9	Brevibacillus_phage	9.7e-107	56.2
AVF21544.1\|1534800_1535043_+	hypothetical protein	A0A0A8WJ65	Clostridium_phage	1.4e-11	42.7
AVF21545.1\|1535045_1535456_+	phage protein	A0A0A7RTU4	Clostridium_phage	2.7e-26	45.5
AVF21546.1\|1535448_1536525_+\|capsid	phage capsid assembly-like protein	A0A0K2CP27	Brevibacillus_phage	6.0e-102	51.8
AVF21547.1\|1536517_1537099_+	putative phage protein	S5MA71	Brevibacillus_phage	4.8e-37	45.9
AVF21548.1\|1537095_1537374_+	hypothetical protein	NA	NA	NA	NA
AVF21549.1\|1537377_1538781_+	phage structural protein	S5MNY5	Brevibacillus_phage	5.4e-10	37.5
AVF21550.1\|1538793_1539189_+	hypothetical protein	NA	NA	NA	NA
AVF21551.1\|1539181_1539340_+	hypothetical protein	NA	NA	NA	NA
AVF21552.1\|1539374_1539614_+	hypothetical protein	R9W0N4	Paenibacillus_phage	1.1e-35	98.7
AVF21553.1\|1539610_1540291_+	N-acetylmuramoyl-L-alanine amidase	A0A0C5AEW3	Paenibacillus_phage	2.1e-129	95.1
AVF21554.1\|1540297_1540762_+	hypothetical protein	A0A0K2CZJ8	Paenibacillus_phage	6.9e-63	71.4
AVF21555.1\|1540779_1541058_+	hypothetical protein	R9VWV2	Paenibacillus_phage	4.2e-39	80.6
AVF21556.1\|1541070_1541313_+	hypothetical protein	A0A0K2CZD0	Paenibacillus_phage	4.3e-32	97.4
AVF21557.1\|1541625_1542738_+	AAA ATPase	A0A1S5V1G7	Saudi_moumouvirus	1.5e-15	28.8
AVF21558.1\|1542757_1545037_+\|protease	type VII secretion-associated serine protease mycosin	NA	NA	NA	NA
AVF21559.1\|1545291_1546359_+	putative phage DNA-binding protein	A0A0A7RTT7	Clostridium_phage	2.2e-48	33.9

DBSCAN-SWA_13

1718911 : 1730708

Paenibacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21715.1\|1718911_1719328_-	Metallopeptidase ImmA	A0A2P1JU12	Anoxybacillus_phage	4.6e-18	37.0
AVF21716.1\|1719359_1719770_-	helix-turn-helix family protein	F8J1E0	Lactobacillus_phage	6.6e-09	38.8
AVF21717.1\|1720302_1720812_-\|transposase	transposase	NA	NA	NA	NA
AVF21718.1\|1720829_1721387_-\|transposase	transposase	NA	NA	NA	NA
AVF21719.1\|1721941_1722442_+	hypothetical protein	R9VWV6	Paenibacillus_phage	7.1e-05	31.7
AVF21720.1\|1722778_1723327_+	hypothetical protein	A0A0C5AEH5	Bacteriophage	1.3e-73	81.4
AVF21721.1\|1723663_1723876_-	hypothetical protein	A0A2I7SC04	Paenibacillus_phage	7.1e-23	77.3
AVF21722.1\|1723879_1724149_-	hypothetical protein	A0A2I7SC25	Paenibacillus_phage	7.6e-38	97.7
AVF21723.1\|1724145_1724337_-	hypothetical protein	A0A2I7SC20	Paenibacillus_phage	1.6e-29	98.4
AVF21724.1\|1724833_1725055_+	putative transcriptional regulator	A0A0E3U244	Fusobacterium_phage	3.8e-11	44.4
AVF21725.1\|1725791_1725905_-	hypothetical protein	NA	NA	NA	NA
AVF21726.1\|1725940_1726585_-	hypothetical protein	NA	NA	NA	NA
AVF21727.1\|1726847_1726967_+	hypothetical protein	NA	NA	NA	NA
AVF21728.1\|1727013_1727133_+	hypothetical protein	NA	NA	NA	NA
AVF21729.1\|1727209_1727413_-	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	5.0e-26	88.1
AVF21730.1\|1727602_1727992_-	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	6.5e-06	49.3
AVF21731.1\|1728141_1728474_+	hypothetical protein	A0A2I7SCG0	Paenibacillus_phage	8.5e-31	90.5
AVF21732.1\|1729098_1729227_+	hypothetical protein	NA	NA	NA	NA
AVF21733.1\|1729334_1730708_+	N-acetylmuramoyl-L-alanine amidase	A0A2I7SC76	Paenibacillus_phage	3.7e-27	88.5

DBSCAN-SWA_14

1768139 : 1775584

Paenibacillus_phage(87.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21780.1\|1768139_1769351_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-224	99.0
AVF21781.1\|1769396_1769876_+	Epsilon-toxin type B precursor	NA	NA	NA	NA
AVF21782.1\|1770443_1770713_-	hypothetical protein	A0A2I7SC25	Paenibacillus_phage	7.6e-38	97.7
AVF21783.1\|1770709_1770901_-	hypothetical protein	A0A2I7SC20	Paenibacillus_phage	1.6e-29	98.4
AVF21784.1\|1771355_1771571_+	putative transcriptional regulator	A0A2I7SC05	Paenibacillus_phage	4.5e-33	98.6
AVF21785.1\|1772032_1772491_-	hypothetical protein	A0A0C5AER4	Bacteriophage	7.1e-20	39.6
AVF21786.1\|1772718_1773429_+	hypothetical protein	A0A0K2CYM6	Paenibacillus_phage	7.9e-34	39.9
AVF21787.1\|1773379_1773901_+	putative accessory genes regulator protein	A0A0K2CZ30	Paenibacillus_phage	6.2e-20	40.5
AVF21788.1\|1773942_1774452_-\|transposase	transposase	NA	NA	NA	NA
AVF21789.1\|1774469_1775027_-\|transposase	transposase	NA	NA	NA	NA
AVF21790.1\|1775197_1775584_+	LytTr DNA-binding domain protein	A0A0K2CYP4	Paenibacillus_phage	3.6e-25	50.0

DBSCAN-SWA_15

1784371 : 1842342

Paenibacillus_phage(95.95%)

capsid,portal,transposase,lysis,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF21800.1\|1784371_1785025_-	helix-turn-helix family protein	A0A2I7SCV6	Paenibacillus_phage	1.7e-70	66.0
AVF21801.1\|1785193_1785406_+	helix-turn-helix family protein	A0A1X9I583	Streptococcus_phage	1.1e-12	61.7
AVF21802.1\|1785452_1785743_+	DNA binding domain, excisionase family	A0A2I7SC15	Paenibacillus_phage	5.3e-37	81.1
AVF21803.1\|1785964_1786066_-	hypothetical protein	NA	NA	NA	NA
AVF21804.1\|1786191_1786818_+	hypothetical protein	A0A0K2CZL5	Paenibacillus_phage	1.9e-87	72.6
AVF21805.1\|1786839_1787016_+	hypothetical protein	NA	NA	NA	NA
AVF21806.1\|1787012_1787180_+	hypothetical protein	A0A0N9SIN5	Paenibacillus_phage	8.3e-19	90.6
AVF21807.1\|1787184_1787586_+	hypothetical protein	A0A0N7GFE9	Paenibacillus_phage	9.3e-32	63.5
AVF21808.1\|1787824_1788196_+	hypothetical protein	A0A0N9SJV6	Paenibacillus_phage	1.2e-17	39.8
AVF21809.1\|1788253_1788631_+	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	4.3e-39	70.9
AVF21810.1\|1788590_1788983_+	hypothetical protein	A0A0N9SSX1	Paenibacillus_phage	6.7e-59	90.8
AVF21811.1\|1788999_1789842_+	hypothetical protein	A0A0N9RZE9	Paenibacillus_phage	8.4e-83	62.0
AVF21812.1\|1789854_1789977_+	hypothetical protein	NA	NA	NA	NA
AVF21813.1\|1789979_1790507_+	hypothetical protein	A0A0N9SJU7	Paenibacillus_phage	3.3e-77	83.4
AVF21814.1\|1790517_1790784_+	hypothetical protein	A0A0N9RRC8	Paenibacillus_phage	2.7e-43	95.5
AVF21815.1\|1790791_1791562_+	putative DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	6.6e-143	95.3
AVF21816.1\|1791558_1792935_+	replicative DNA helicase	A0A0N9SIP5	Paenibacillus_phage	1.1e-254	96.9
AVF21817.1\|1792947_1793898_+	DNA primase	A0A0N9S7Y2	Paenibacillus_phage	4.9e-164	88.9
AVF21818.1\|1793950_1794514_+	hypothetical protein	A0A0N9SGJ9	Paenibacillus_phage	2.2e-87	96.8
AVF21819.1\|1794576_1795101_+	hypothetical protein	A0A0N9RTM1	Paenibacillus_phage	7.1e-56	69.5
AVF21820.1\|1795194_1795932_+	hypothetical protein	A0A0N9SJW5	Paenibacillus_phage	8.2e-135	95.5
AVF21821.1\|1796104_1796320_+	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	1.0e-24	80.6
AVF21822.1\|1796316_1796436_+	hypothetical protein	A0A0N7GFF1	Paenibacillus_phage	1.8e-07	74.4
AVF21823.1\|1796464_1796878_+	hypothetical protein	A0A0N9RZF9	Paenibacillus_phage	6.6e-73	96.4
AVF21824.1\|1796865_1797072_+	hypothetical protein	A0A0N9SJW4	Paenibacillus_phage	1.3e-24	78.3
AVF21825.1\|1797083_1797893_+	hypothetical protein	A0A0N9SIQ5	Paenibacillus_phage	6.5e-109	76.9
AVF21826.1\|1799691_1800024_+	hypothetical protein	A0A0N9SGL0	Paenibacillus_phage	6.7e-52	86.4
AVF21827.1\|1800013_1801180_+	DNA-directed DNA polymerase	A0A0N9RTM8	Paenibacillus_phage	2.3e-208	91.2
AVF21828.1\|1801180_1801378_+	hypothetical protein	A0A0N7GFF2	Paenibacillus_phage	6.6e-31	100.0
AVF21829.1\|1801374_1801989_+	DNA polymerase III PolC-like protein	A0A0N9SJX9	Paenibacillus_phage	4.1e-103	95.1
AVF21830.1\|1802021_1802993_+	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	1.0e-156	94.1
AVF21831.1\|1803270_1803501_+	crossover junction endodeoxyribonuclease	A0A0N9ST03	Paenibacillus_phage	1.6e-36	100.0
AVF21832.1\|1803497_1803671_+	hypothetical protein	NA	NA	NA	NA
AVF21833.1\|1803738_1804077_+	deoxyuridine 5'-triphosphate nucleotidohydrolase Dut	A0A0N9SJY5	Paenibacillus_phage	2.7e-56	100.0
AVF21834.1\|1804106_1804268_+	hypothetical protein	A0A0N9RRE2	Paenibacillus_phage	1.0e-26	100.0
AVF21835.1\|1804318_1804540_+	hypothetical protein	A0A0N9SIR4	Paenibacillus_phage	8.4e-35	100.0
AVF21836.1\|1804554_1804944_+	SprT-like family protein	A0A0N7GFF3	Paenibacillus_phage	3.1e-72	100.0
AVF21837.1\|1804945_1805263_+	Antitoxin MazE	A0A0N9S804	Paenibacillus_phage	1.3e-57	100.0
AVF21838.1\|1805256_1805721_+	putative prophage protein	A0A0N9SGM1	Paenibacillus_phage	1.3e-88	100.0
AVF21839.1\|1805724_1806600_+	hypothetical protein	A0A0N9RTN7	Paenibacillus_phage	2.0e-167	100.0
AVF21840.1\|1806583_1807144_+	deoxynucleoside monophosphate kinase	A0A0N9SJZ0	Paenibacillus_phage	1.8e-105	100.0
AVF21841.1\|1807100_1807484_-	hypothetical protein	A0A0N9SHP7	Paenibacillus_phage	3.9e-72	99.2
AVF21842.1\|1807610_1808777_+	Modification methylase TaqI	A0A0N9ST12	Paenibacillus_phage	1.5e-234	100.0
AVF21843.1\|1808790_1810068_+	modification methylase	A0A1P8CX25	Bacillus_phage	1.5e-75	39.7
AVF21844.1\|1810055_1810463_+	hypothetical protein	A0A0N9RZI0	Paenibacillus_phage	8.5e-57	84.4
AVF21845.1\|1810452_1810905_+	hypothetical protein	A0A0N7GFF4	Paenibacillus_phage	1.4e-60	75.3
AVF21846.1\|1812101_1812494_+	hypothetical protein	NA	NA	NA	NA
AVF21847.1\|1812790_1814014_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF21848.1\|1814194_1814413_+	hypothetical protein	A0A0N9SGN2	Paenibacillus_phage	6.8e-29	94.4
AVF21849.1\|1814402_1814570_+	hypothetical protein	A0A0N9RTP7	Paenibacillus_phage	6.6e-16	76.4
AVF21850.1\|1814571_1814991_+	putative phage-associated protein	A0A0N9SJZ8	Paenibacillus_phage	3.9e-73	95.7
AVF21851.1\|1814980_1815370_+	hypothetical protein	A0A0N7GFF5	Paenibacillus_phage	1.5e-66	100.0
AVF21852.1\|1816261_1816513_+	hypothetical protein	NA	NA	NA	NA
AVF21853.1\|1816505_1816685_+	hypothetical protein	A0A0N9SSS1	Paenibacillus_phage	1.3e-17	91.5
AVF21854.1\|1818575_1820087_+\|portal	phage portal protein, SPP1 family	A0A0N7GFE4	Paenibacillus_phage	4.9e-251	93.9
AVF21855.1\|1820083_1820947_+	putative phage protein	A0A0N9SJR1	Paenibacillus_phage	3.8e-131	83.6
AVF21856.1\|1821034_1821688_+	Phage minor structural protein GP20	A0A0N9SIL0	Paenibacillus_phage	4.1e-61	81.0
AVF21857.1\|1821743_1822679_+\|capsid	major capsid protein	A0A0N9S7T7	Paenibacillus_phage	2.7e-143	79.4
AVF21858.1\|1822693_1823077_+	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	2.2e-62	94.5
AVF21859.1\|1823077_1823410_+	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	4.1e-57	99.1
AVF21860.1\|1823406_1823832_+	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	2.9e-68	90.8
AVF21861.1\|1823828_1824203_+	hypothetical protein	A0A0N7GFE5	Paenibacillus_phage	1.6e-62	95.2
AVF21862.1\|1824215_1824785_+	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	3.7e-66	70.5
AVF21863.1\|1824851_1825109_+	hypothetical protein	A0A0K2CZ43	Paenibacillus_phage	8.1e-13	51.9
AVF21864.1\|1825111_1825489_+	hypothetical protein	A0A0N9SST2	Paenibacillus_phage	6.6e-56	92.8
AVF21865.1\|1825461_1825839_+	hypothetical protein	A0A0N9RZB8	Paenibacillus_phage	5.3e-21	72.0
AVF21866.1\|1825866_1826466_+\|tail	putative phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	1.3e-82	97.0
AVF21867.1\|1826466_1828761_+\|tail	putative phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	1.3e-149	45.6
AVF21868.1\|1828762_1830220_+\|tail	phage tail component	A0A0N9RRA9	Paenibacillus_phage	5.8e-281	96.3
AVF21869.1\|1830222_1832544_+	phage minor structural protein	A0A0N9SIL8	Paenibacillus_phage	0.0e+00	97.5
AVF21870.1\|1832540_1832978_+	phage-related protein	A0A0N9S7V6	Paenibacillus_phage	8.8e-76	98.6
AVF21871.1\|1832965_1833382_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	1.8e-70	100.0
AVF21872.1\|1833374_1833629_+	sporulation-specific N-acetylmuramoyl-L-alanine amidase CwlC	A0A0N9SGH1	Paenibacillus_phage	5.3e-41	100.0
AVF21873.1\|1833702_1834179_+	sporulation-specific N-acetylmuramoyl-L-alanine amidase CwlC	A0A0N9SGH1	Paenibacillus_phage	9.8e-89	98.7
AVF21874.1\|1834401_1834677_-	hypothetical protein	A0A0K2CZR1	Paenibacillus_phage	1.2e-19	60.9
AVF21875.1\|1834695_1835709_-	hypothetical protein	NA	NA	NA	NA
AVF21876.1\|1835848_1836094_+	putative transcriptional regulator	NA	NA	NA	NA
AVF21877.1\|1836134_1836506_-	hypothetical protein	A0A2I7SCF4	Paenibacillus_phage	3.5e-49	79.5
AVF21878.1\|1836509_1836860_-	phage protein	A0A2I7SCF2	Paenibacillus_phage	2.5e-49	84.5
AVF21879.1\|1836906_1837332_-	hypothetical protein	NA	NA	NA	NA
AVF21880.1\|1837505_1838132_-	hypothetical protein	A0A0N9SJT2	Paenibacillus_phage	2.0e-36	59.5
AVF21881.1\|1838205_1838592_-	hypothetical protein	A0A0N9SIM5	Paenibacillus_phage	1.0e-64	96.1
AVF21882.1\|1838903_1840646_+	type VI secretion system FHA domain protein	NA	NA	NA	NA
AVF21883.1\|1840785_1842342_+	ABC efflux transporter-like protein	A0A2K9L3Z8	Tupanvirus	4.4e-53	28.3

DBSCAN-SWA_16

1970356 : 2020835

Paenibacillus_phage(42.86%)

integrase,coat,tRNA,transposase,protease,bacteriocin

attL 1999045:1999059|attR 2025655:2025669

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22015.1\|1970356_1971646_-\|tRNA	seryl-tRNA ligase SerS	A0A1B1IVT2	uncultured_Mediterranean_phage	4.8e-53	31.5
AVF22016.1\|1972583_1974026_+	lysine-specific permease LysP	NA	NA	NA	NA
AVF22017.1\|1974364_1974631_+\|coat	inner spore coat-like protein	NA	NA	NA	NA
AVF22018.1\|1975018_1975642_+	hypothetical protein	NA	NA	NA	NA
AVF22019.1\|1975750_1975969_+	hypothetical protein	NA	NA	NA	NA
AVF22020.1\|1976533_1976650_+	short chain dehydrogenase	NA	NA	NA	NA
AVF22021.1\|1976778_1977675_+	polysaccharide deacetylase	NA	NA	NA	NA
AVF22022.1\|1977834_1979040_+	efflux transporter-like protein	A0A2H4PQR6	Staphylococcus_phage	3.1e-99	45.1
AVF22023.1\|1979111_1979783_-	Yip1 domain protein	NA	NA	NA	NA
AVF22024.1\|1979799_1980108_-	integral membrane protein	NA	NA	NA	NA
AVF22025.1\|1980310_1980517_-	hypothetical protein	NA	NA	NA	NA
AVF22026.1\|1980517_1981270_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-23	31.8
AVF22027.1\|1981257_1982946_-	hypothetical protein	NA	NA	NA	NA
AVF22028.1\|1983070_1983286_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
AVF22029.1\|1983710_1984145_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22030.1\|1984218_1984866_+	hypothetical protein	NA	NA	NA	NA
AVF22031.1\|1985021_1985285_+	uridylate kinase-like protein	NA	NA	NA	NA
AVF22032.1\|1985226_1985394_+	Uridylate kinase	NA	NA	NA	NA
AVF22033.1\|1985508_1986246_-	hypothetical protein	NA	NA	NA	NA
AVF22034.1\|1986531_1987821_+	Hemolysin C	NA	NA	NA	NA
AVF22035.1\|1988253_1989156_+	phenazine biosynthesis protein PhzF	NA	NA	NA	NA
AVF22036.1\|1989336_1989939_+	hypothetical protein	NA	NA	NA	NA
AVF22037.1\|1990023_1990476_+	putative disulfide bond formation protein	NA	NA	NA	NA
AVF22038.1\|1990606_1991293_+	putative disulfide bond formation protein	NA	NA	NA	NA
AVF22039.1\|1991381_1992215_+	HAD-superfamily hydrolase	NA	NA	NA	NA
AVF22040.1\|1992423_1992858_+	acetyltransferase, GNAT family	NA	NA	NA	NA
AVF22041.1\|1993453_1994134_-\|transposase	putative transposase	NA	NA	NA	NA
AVF22042.1\|1994232_1995264_-	HTH-type transcriptional regulator MalR	NA	NA	NA	NA
AVF22043.1\|1995663_1996947_+	maltose/maltodextrin-binding protein MalX	NA	NA	NA	NA
AVF22044.1\|1998268_1999114_+	putative arabinogalactan oligomer transport system permease protein GanQ	NA	NA	NA	NA
1999045:1999059	attL	NA	NA	NA	NA
AVF22045.1\|1999179_1999596_-	hypothetical protein	NA	NA	NA	NA
AVF22046.1\|1999780_2000275_+	spermine/spermidine acetyltransferase	NA	NA	NA	NA
AVF22047.1\|2000341_2001415_+	putative nitronate monooxygenase	NA	NA	NA	NA
AVF22048.1\|2001646_2002936_+	hydroxylamine reductase Hcp	NA	NA	NA	NA
AVF22049.1\|2003053_2003980_-	UDP-N-acetylenolpyruvoylglucosamine reductase MurB	NA	NA	NA	NA
AVF22050.1\|2004192_2004417_-	hypothetical protein	NA	NA	NA	NA
AVF22051.1\|2004905_2005268_+	hypothetical protein	NA	NA	NA	NA
AVF22052.1\|2005304_2006780_-	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
AVF22053.1\|2006970_2007924_+	D-alanyl-D-alanine carboxypeptidase DacB	A0A1P8VVG5	Erythrobacter_phage	9.7e-11	30.6
AVF22054.1\|2008002_2008176_+	hypothetical protein	NA	NA	NA	NA
AVF22055.1\|2008287_2009166_-	D-tagatose-1,6-bisphosphate aldolase subunit GatY	NA	NA	NA	NA
AVF22056.1\|2009223_2010657_-	PTS system fructose-specific EIIABC component FruA	NA	NA	NA	NA
AVF22057.1\|2010656_2011586_-	1-phosphofructokinase FruK	NA	NA	NA	NA
AVF22058.1\|2011756_2012539_+	phosphosugar-binding transcriptional regulator	NA	NA	NA	NA
AVF22059.1\|2012621_2013179_+	MutX-like protein	NA	NA	NA	NA
AVF22060.1\|2013173_2013578_-	small multidrug efflux transporter-like protein	NA	NA	NA	NA
AVF22061.1\|2013570_2013903_-	small multidrug efflux transporter-like protein	NA	NA	NA	NA
AVF22062.1\|2013908_2014448_-	transcriptional regulator, TetR family	NA	NA	NA	NA
AVF22063.1\|2015485_2016244_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF22064.1\|2016975_2017668_-\|integrase	putative integrase	A0A0K2CZ62	Paenibacillus_phage	4.1e-59	57.3
AVF22065.1\|2017722_2018247_-	helix-turn-helix protein	A0A0K2CZC9	Paenibacillus_phage	1.9e-45	79.1
AVF22066.1\|2018386_2018560_-	helix-turn-helix domain protein	A0A0K2CZS1	Paenibacillus_phage	2.9e-14	91.3
AVF22067.1\|2018759_2020835_+\|protease	minor extracellular protease Epr	NA	NA	NA	NA
2025655:2025669	attR	NA	NA	NA	NA

DBSCAN-SWA_17

2192155 : 2301300

Salmonella_phage(18.18%)

integrase,transposase,coat,protease

attL 2221533:2221571|attR 2225865:2225903

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22190.1\|2192155_2192914_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF22191.1\|2192935_2193835_+	phosphoenolpyruvate phosphomutase BcpB	NA	NA	NA	NA
AVF22192.1\|2193831_2194977_+	phosphonopyruvate decarboxylase BcpC	NA	NA	NA	NA
AVF22193.1\|2194991_2196137_+	putative cysteine desulfurase Csd	NA	NA	NA	NA
AVF22194.1\|2196117_2196861_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF22195.1\|2197071_2198268_+	acetylornithine aminotransferase ArgD	A0A1V0SKB7	Klosneuvirus	1.2e-26	27.6
AVF22196.1\|2198399_2199281_+	agmatinase SpeB	A0A1V0SJM8	Klosneuvirus	2.0e-26	35.7
AVF22197.1\|2199667_2200378_+	iron-regulated protein D	NA	NA	NA	NA
AVF22198.1\|2200436_2201771_+	iron-regulated protein D	NA	NA	NA	NA
AVF22199.1\|2201843_2202752_+	iron compound ABC transporter, iron compound-binding protein	NA	NA	NA	NA
AVF22200.1\|2202787_2203771_+	iron compound ABC transporter, permease protein	NA	NA	NA	NA
AVF22201.1\|2203760_2204510_+	iron compound ABC transporter, ATP-binding protein	G3M9Y6	Bacillus_virus	8.7e-15	26.1
AVF22202.1\|2204553_2205327_+	sortase, SrtB family	NA	NA	NA	NA
AVF22203.1\|2205411_2205729_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVF22204.1\|2205795_2205954_+	hypothetical protein	NA	NA	NA	NA
AVF22205.1\|2206266_2207385_+	citrate synthase 2	NA	NA	NA	NA
AVF22206.1\|2207410_2208826_+	2-methylcitrate dehydratase	NA	NA	NA	NA
AVF22207.1\|2208863_2209781_+	phosphonopyruvate hydrolase PphA	NA	NA	NA	NA
AVF22208.1\|2210192_2210732_-	hypothetical protein	NA	NA	NA	NA
AVF22209.1\|2210835_2211420_-	Aminoglycoside phosphotransferase	NA	NA	NA	NA
AVF22210.1\|2211488_2211728_-	hypothetical protein	NA	NA	NA	NA
AVF22211.1\|2211885_2212128_-	resolvase	NA	NA	NA	NA
AVF22212.1\|2213195_2213795_-	transcriptional regulator, Acidobacterial, PadR-family	NA	NA	NA	NA
AVF22213.1\|2213909_2214410_+	Phenolic acid decarboxylase PadC	NA	NA	NA	NA
AVF22214.1\|2214791_2215181_+	resolvase	A0A1B0V7I5	Salmonella_phage	8.4e-46	79.2
AVF22215.1\|2215183_2215687_+\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	9.2e-45	53.9
AVF22216.1\|2215738_2218159_+\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	66.5
AVF22217.1\|2218331_2218631_+	hypothetical protein	NA	NA	NA	NA
AVF22218.1\|2218590_2219070_+	putative cell-wall hydrolase	NA	NA	NA	NA
AVF22219.1\|2219493_2219838_-	hypothetical protein	NA	NA	NA	NA
AVF22220.1\|2220005_2221502_+	type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	A0A2L1IV91	Escherichia_phage	3.4e-143	54.4
AVF22221.1\|2221494_2221611_+	hypothetical protein	NA	NA	NA	NA
2221533:2221571	attL	NA	NA	NA	NA
AVF22222.1\|2221674_2224590_-\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	3.5e-205	40.9
AVF22223.1\|2224868_2225567_+\|integrase	phage integrase family protein	A0A1B1P7C7	Bacillus_phage	1.7e-44	43.2
AVF22224.1\|2225596_2225764_+	hypothetical protein	NA	NA	NA	NA
AVF22225.1\|2226119_2226818_+	hypothetical protein	A0A0P0ZG22	Escherichia_phage	7.1e-104	75.0
2225865:2225903	attR	NA	NA	NA	NA
AVF22226.1\|2227025_2227952_+	hypothetical protein	NA	NA	NA	NA
AVF22227.1\|2228469_2229000_-\|transposase	transposase	NA	NA	NA	NA
AVF22228.1\|2228996_2229509_-\|transposase	transposase	NA	NA	NA	NA
AVF22229.1\|2231167_2232067_-	transcriptional regulator, LysR family	A0A2P0ZL89	Lactobacillus_phage	2.1e-07	25.4
AVF22230.1\|2232167_2232593_+	putative transcriptional regulator	NA	NA	NA	NA
AVF22231.1\|2233685_2234885_+	putative malonyl CoA-acyl carrier protein transacylase	NA	NA	NA	NA
AVF22232.1\|2234915_2246219_+	putative non-ribosomal peptide ligase/ polyketide synthase hybrid	A0A2K9KZV5	Tupanvirus	3.5e-107	26.8
AVF22233.1\|2246323_2247007_+\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.5e-119	97.8
AVF22234.1\|2247144_2247897_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF22235.1\|2248121_2250731_+	putative phosphoenolpyruvate synthase Pps	A0A1V0SGR7	Hokovirus	1.2e-42	35.3
AVF22236.1\|2250926_2251235_+	hypothetical protein	NA	NA	NA	NA
AVF22237.1\|2251730_2252705_-	hypothetical protein	NA	NA	NA	NA
AVF22238.1\|2252748_2253399_-	putative ABC transporter	A0A2H4PQG7	Staphylococcus_phage	3.4e-31	38.3
AVF22239.1\|2253411_2254215_-	hypothetical protein	NA	NA	NA	NA
AVF22240.1\|2254211_2255018_-	putative membrane protein	NA	NA	NA	NA
AVF22241.1\|2255004_2255817_-	putative membrane protein	NA	NA	NA	NA
AVF22242.1\|2255884_2256352_-	putative membrane protein	NA	NA	NA	NA
AVF22243.1\|2256653_2257373_-	hypothetical protein	NA	NA	NA	NA
AVF22244.1\|2258348_2259056_-	trehalose operon transcriptional repressor	NA	NA	NA	NA
AVF22245.1\|2259086_2260496_-	Aryl-phospho-beta-D-glucosidase BglC	A0A0B5JD41	Pandoravirus	1.2e-57	29.7
AVF22246.1\|2260809_2261394_-	TetR family transcriptional regulator	NA	NA	NA	NA
AVF22247.1\|2261566_2262148_+	fatty acid metabolism regulator protein FadR	NA	NA	NA	NA
AVF22248.1\|2262170_2263373_+	multidrug resistance protein	NA	NA	NA	NA
AVF22249.1\|2263531_2264914_-	putative transporter	NA	NA	NA	NA
AVF22250.1\|2265554_2265929_-	hypothetical protein	NA	NA	NA	NA
AVF22251.1\|2266282_2267914_-	2-hydroxyglutaryl-CoA dehydratase, D-component	NA	NA	NA	NA
AVF22252.1\|2267946_2271417_-	CoA-substrate-specific enzyme activase	NA	NA	NA	NA
AVF22253.1\|2271482_2271911_-	magnesium transporter-like protein	NA	NA	NA	NA
AVF22254.1\|2272429_2272588_+	hypothetical protein	NA	NA	NA	NA
AVF22255.1\|2273075_2273717_+	colanic acid/biofilm transcriptional regulator	NA	NA	NA	NA
AVF22256.1\|2273976_2274741_-	3-oxoacyl-[acyl-carrier-protein] reductase FabG	A0A0N9R355	Chrysochromulina_ericina_virus	7.5e-30	35.2
AVF22257.1\|2275704_2275827_-	hypothetical protein	NA	NA	NA	NA
AVF22258.1\|2275823_2276642_-	putative MFS-type transporter	NA	NA	NA	NA
AVF22259.1\|2276980_2277475_+	hypothetical protein	NA	NA	NA	NA
AVF22260.1\|2277730_2278036_+	hypothetical protein	NA	NA	NA	NA
AVF22261.1\|2278441_2279053_-	hypothetical protein	A0A2K9L5M2	Tupanvirus	1.2e-22	35.4
AVF22262.1\|2279064_2279949_-	hypothetical protein	NA	NA	NA	NA
AVF22263.1\|2280817_2281915_-	Nitroreductase family protein	NA	NA	NA	NA
AVF22264.1\|2282043_2282799_-\|protease	putative serine protease HtrA	W5SAB9	Pithovirus	1.2e-11	34.7
AVF22265.1\|2283267_2283531_-	Cytochrome P450(BM-3)	NA	NA	NA	NA
AVF22266.1\|2283643_2284273_+	Purine efflux pump PbuE	NA	NA	NA	NA
AVF22267.1\|2284341_2284827_+	Purine efflux pump PbuE	NA	NA	NA	NA
AVF22268.1\|2284849_2285608_-	putative transcriptional regulator	NA	NA	NA	NA
AVF22269.1\|2285786_2286518_+	exodeoxyribonuclease III (xth)	NA	NA	NA	NA
AVF22270.1\|2286555_2288013_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVF22271.1\|2288096_2288660_-	hypothetical protein	NA	NA	NA	NA
AVF22272.1\|2288784_2289681_-	CDF family cation diffusion facilitator	NA	NA	NA	NA
AVF22273.1\|2290318_2290465_-	hypothetical protein	NA	NA	NA	NA
AVF22274.1\|2290663_2291032_+	hypothetical protein	NA	NA	NA	NA
AVF22275.1\|2291222_2291957_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AVF22276.1\|2292012_2292798_-	N-acetylmuramic acid deacetylase-like protein	NA	NA	NA	NA
AVF22277.1\|2292911_2294429_-	membrane protein	NA	NA	NA	NA
AVF22278.1\|2294507_2295626_-	two-component response regulator	NA	NA	NA	NA
AVF22279.1\|2296097_2296370_-	ribonuclease inhibitor-like protein	NA	NA	NA	NA
AVF22280.1\|2296390_2296810_-	ribonuclease	NA	NA	NA	NA
AVF22281.1\|2297333_2298764_-	hydrolase-like protein	A0A2N9QVZ6	Dishui_lake_phycodnavirus	1.3e-06	36.6
AVF22282.1\|2298838_2300038_-	NAD(FAD)-dependent dehydrogenase	NA	NA	NA	NA
AVF22283.1\|2300244_2301300_-\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	2.5e-15	29.6

DBSCAN-SWA_18

2326480 : 2333194

Paenibacillus_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22307.1\|2326480_2326987_-	hypothetical protein	R9VWV6	Paenibacillus_phage	8.5e-06	33.3
AVF22308.1\|2328049_2328193_-	hypothetical protein	NA	NA	NA	NA
AVF22309.1\|2328179_2329538_-	putative DNA-binding protein	A0A0K2CP77	Brevibacillus_phage	2.0e-73	34.7
AVF22310.1\|2329811_2330357_+	hypothetical protein	NA	NA	NA	NA
AVF22311.1\|2330328_2330547_+	hypothetical protein	NA	NA	NA	NA
AVF22312.1\|2330654_2330897_-	hypothetical protein	A0A2I7SC00	Paenibacillus_phage	2.6e-29	91.2
AVF22313.1\|2330906_2331416_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7SCE7	Paenibacillus_phage	2.0e-79	93.3
AVF22314.1\|2331544_2331817_-	hypothetical protein	R9W0N4	Paenibacillus_phage	1.6e-30	94.7
AVF22315.1\|2331970_2333194_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_19

2477261 : 2503749

Paenibacillus_phage(77.78%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22430.1\|2477261_2477942_+\|transposase	putative transposase	NA	NA	NA	NA
AVF22431.1\|2478115_2478820_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.1e-56	51.1
AVF22432.1\|2478969_2480697_-	glycine betaine transport system permease protein OpuAB	NA	NA	NA	NA
AVF22433.1\|2480693_2481893_-	glycine betaine transport ATP-binding protein OpuAA	G3M9Y6	Bacillus_virus	1.8e-30	39.5
AVF22434.1\|2482192_2482771_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22435.1\|2483037_2484522_+	putative aldehyde dehydrogenase DhaS	NA	NA	NA	NA
AVF22436.1\|2484571_2485744_-	spore autolysin-like protein	NA	NA	NA	NA
AVF22437.1\|2485759_2485939_-	hypothetical protein	NA	NA	NA	NA
AVF22438.1\|2485989_2486100_+	hypothetical protein	NA	NA	NA	NA
AVF22439.1\|2486896_2488147_-	carbohydrate kinase, YjeF related protein	NA	NA	NA	NA
AVF22440.1\|2488162_2489122_-	glycerophosphodiester phosphodiesterase family protein	NA	NA	NA	NA
AVF22441.1\|2489331_2490420_-	putative dipeptidase YkvY	NA	NA	NA	NA
AVF22442.1\|2490615_2491614_-	Phosphate/sulfate permease	NA	NA	NA	NA
AVF22443.1\|2491947_2492115_+	thioredoxin-disulfide reductase	NA	NA	NA	NA
AVF22444.1\|2492159_2492801_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
AVF22445.1\|2492764_2492953_-	hypothetical protein	A0A2I7SCW2	Paenibacillus_phage	3.7e-23	93.0
AVF22446.1\|2492942_2493140_-	hypothetical protein	A0A2I7SCV7	Paenibacillus_phage	1.9e-17	66.2
AVF22447.1\|2493281_2493614_+	hypothetical protein	NA	NA	NA	NA
AVF22448.1\|2493610_2493787_+	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	8.5e-22	89.7
AVF22449.1\|2494284_2494842_+\|transposase	transposase	NA	NA	NA	NA
AVF22450.1\|2494859_2495369_+\|transposase	transposase	NA	NA	NA	NA
AVF22451.1\|2495372_2496413_-	putative lethal factor domain protein	A0A1V0E017	Clostridioides_phage	1.9e-07	26.2
AVF22452.1\|2496743_2497592_-	toxin-like protein	A0A0K2CYN4	Paenibacillus_phage	9.5e-10	30.5
AVF22453.1\|2497726_2498950_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF22454.1\|2501269_2501947_-	toxin-like protein	NA	NA	NA	NA
AVF22455.1\|2502043_2502436_-	toxin-like protein	NA	NA	NA	NA
AVF22456.1\|2502576_2503749_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	5.6e-218	99.7

DBSCAN-SWA_20

2602187 : 2657900

Paenibacillus_phage(96.1%)

terminase,capsid,portal,tRNA,tail,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22555.1\|2602187_2603582_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	2.9e-40	27.6
AVF22556.1\|2603751_2604294_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
AVF22557.1\|2604472_2605801_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TrmFO	NA	NA	NA	NA
AVF22558.1\|2605813_2607904_-	DNA topoisomerase 1	A0A2K9L5F8	Tupanvirus	1.8e-110	40.9
AVF22559.1\|2608288_2609161_-	DNA processing Smf single strand binding protein-like protein	S6BFL3	Thermus_phage	1.2e-36	41.5
AVF22560.1\|2609264_2610200_-	succinyl-CoA ligase [ADP-forming] subunit alpha	NA	NA	NA	NA
AVF22561.1\|2610256_2611417_-	succinyl-CoA ligase [ADP-forming] subunit beta	NA	NA	NA	NA
AVF22562.1\|2611804_2612065_-	hypothetical protein	NA	NA	NA	NA
AVF22563.1\|2612096_2612492_-	hypothetical protein	NA	NA	NA	NA
AVF22564.1\|2612673_2613675_+	Mg chelatase-like protein	NA	NA	NA	NA
AVF22565.1\|2613796_2614132_+	antitoxin HipB	A0A0K2CYN0	Paenibacillus_phage	1.1e-54	100.0
AVF22566.1\|2614171_2614459_-	hypothetical protein	A0A0K2CYG5	Paenibacillus_phage	8.4e-35	98.7
AVF22567.1\|2614409_2614517_-	hypothetical protein	A0A0K2CYK6	Paenibacillus_phage	4.8e-12	100.0
AVF22568.1\|2614694_2615051_-	LytTr DNA-binding domain protein	A0A0K2CYP4	Paenibacillus_phage	1.0e-61	100.0
AVF22569.1\|2615057_2615186_-	hypothetical protein	A0A0K2CYW0	Paenibacillus_phage	3.6e-14	100.0
AVF22570.1\|2615182_2615698_-	putative accessory genes regulator protein	A0A0K2CZ30	Paenibacillus_phage	1.8e-88	100.0
AVF22571.1\|2615690_2616359_-	hypothetical protein	A0A0K2CYM6	Paenibacillus_phage	3.5e-108	100.0
AVF22572.1\|2616612_2617134_+	Telomeric repeat-binding factor 2	A0A0K2CYG1	Paenibacillus_phage	3.3e-69	100.0
AVF22573.1\|2617603_2617831_-	hypothetical protein	A0A0K2CYV5	Paenibacillus_phage	8.6e-35	100.0
AVF22574.1\|2618299_2618485_+	hypothetical protein	A0A0K2CZ26	Paenibacillus_phage	8.3e-28	100.0
AVF22575.1\|2618570_2618834_+	hypothetical protein	A0A0K2CYM1	Paenibacillus_phage	3.8e-42	100.0
AVF22576.1\|2619145_2622073_-	hypothetical protein	A0A0K2CYN4	Paenibacillus_phage	0.0e+00	100.0
AVF22577.1\|2622925_2623369_-	hypothetical protein	A0A0K2CYV0	Paenibacillus_phage	5.8e-75	100.0
AVF22578.1\|2623352_2623706_-	hypothetical protein	R9W0N7	Paenibacillus_phage	4.8e-64	100.0
AVF22579.1\|2623725_2624694_-	hypothetical protein	A0A0K2CYL7	Paenibacillus_phage	1.6e-178	100.0
AVF22580.1\|2624880_2625135_-	hypothetical protein	R9W000	Paenibacillus_phage	2.7e-37	100.0
AVF22581.1\|2625147_2625423_-	hypothetical protein	R9VWV2	Paenibacillus_phage	7.2e-52	100.0
AVF22582.1\|2625419_2626097_-	N-acetylmuramoyl-L-alanine amidase	A0A0K2CYU5	Paenibacillus_phage	6.2e-137	100.0
AVF22583.1\|2626093_2626333_-	hypothetical protein	R9W0N4	Paenibacillus_phage	2.8e-36	100.0
AVF22584.1\|2626313_2626475_-	hypothetical protein	A0A0K2CZ44	Paenibacillus_phage	8.8e-26	100.0
AVF22585.1\|2626471_2626813_-	hypothetical protein	A0A0K2CZC5	Paenibacillus_phage	9.9e-59	100.0
AVF22586.1\|2626822_2627896_-	phage structural protein	A0A0K2CZJ3	Paenibacillus_phage	7.1e-212	99.7
AVF22587.1\|2627901_2629020_-	hypothetical protein	A0A0K2CZQ1	Paenibacillus_phage	2.0e-212	100.0
AVF22588.1\|2629022_2629889_-	Phage-related protein	A0A0K2CZA8	Paenibacillus_phage	4.0e-165	100.0
AVF22589.1\|2629889_2633594_-\|tail	phage tail tape measure protein, TP901 family, core region	A0A0K2CYK9	Paenibacillus_phage	0.0e+00	100.0
AVF22590.1\|2633827_2634199_-	hypothetical protein	A0A0K2CZI8	Paenibacillus_phage	2.9e-64	100.0
AVF22591.1\|2634270_2634867_-\|tail	phage major tail protein, phi13 family	A0A0K2CZP8	Paenibacillus_phage	3.9e-111	100.0
AVF22592.1\|2634902_2635232_-	hypothetical protein	A0A0K2CZA4	Paenibacillus_phage	4.4e-56	100.0
AVF22593.1\|2635228_2635621_-	phage protein, HK97 gp10 family	A0A0K2CZ33	Paenibacillus_phage	4.3e-66	100.0
AVF22594.1\|2635617_2635938_-\|head,tail	putative phage head-tail adaptor	A0A0K2CZB5	Paenibacillus_phage	3.0e-57	100.0
AVF22595.1\|2635934_2636198_-	putative phage protein (possible DNA packaging)	A0A0K2CZI4	Paenibacillus_phage	4.2e-41	100.0
AVF22596.1\|2636323_2637466_-\|capsid	phage major capsid protein, HK97 family	A0A0K2CZ99	Paenibacillus_phage	6.6e-208	99.5
AVF22597.1\|2637462_2638218_-\|protease	ATP-dependent Clp protease proteolytic subunit ClpP	A0A0K2CZ28	Paenibacillus_phage	4.6e-133	100.0
AVF22598.1\|2638168_2639404_-\|portal	phage portal protein, HK97 family	A0A0K2CZB0	Paenibacillus_phage	3.5e-239	99.8
AVF22599.1\|2639418_2641146_-\|terminase	Phage terminase-like protein, large subunit	A0A0K2CZH9	Paenibacillus_phage	0.0e+00	100.0
AVF22600.1\|2641123_2641438_-\|terminase	putative phage terminase, small subunit, P27 family	A0A0K2CZ94	Paenibacillus_phage	1.6e-50	100.0
AVF22601.1\|2641575_2641944_-	HNH endonuclease	A0A0K2CYS9	Paenibacillus_phage	8.7e-61	100.0
AVF22602.1\|2641903_2642218_-	hypothetical protein	A0A0K2CZ01	Paenibacillus_phage	1.9e-48	100.0
AVF22603.1\|2642397_2642601_+	YcfA-like protein	A0A0K2CYR6	Paenibacillus_phage	1.5e-33	100.0
AVF22604.1\|2642631_2643048_+	Antitoxin HicB	A0A0K2CYJ8	Paenibacillus_phage	9.2e-75	100.0
AVF22605.1\|2643102_2643447_-	hypothetical protein	A0A0K2CYS5	Paenibacillus_phage	4.5e-59	100.0
AVF22606.1\|2643652_2644090_-	phage transcriptional regulator, ArpU family	A0A0K2CYZ6	Paenibacillus_phage	3.7e-74	100.0
AVF22607.1\|2644218_2644362_-	hypothetical protein	A0A0K2CZ63	Paenibacillus_phage	3.0e-17	100.0
AVF22608.1\|2644358_2644604_-	hypothetical protein	A0A0K2CYR3	Paenibacillus_phage	1.6e-39	100.0
AVF22609.1\|2644596_2644830_-	hypothetical protein	A0A0K2CYJ4	Paenibacillus_phage	4.3e-37	100.0
AVF22610.1\|2644881_2645064_-	hypothetical protein	A0A0K2CYS1	Paenibacillus_phage	7.7e-26	100.0
AVF22611.1\|2645047_2645830_-	modification methylase	A0A0K2CYZ1	Paenibacillus_phage	7.4e-158	100.0
AVF22612.1\|2645846_2646212_-	hypothetical protein	A0A0K2CZ58	Paenibacillus_phage	4.7e-67	100.0
AVF22613.1\|2646393_2646768_-	Holliday junction resolvase	A0A0K2CYQ8	Paenibacillus_phage	1.4e-66	100.0
AVF22614.1\|2646760_2646979_-	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	3.7e-35	100.0
AVF22615.1\|2646985_2647096_-	hypothetical protein	A0A0K2CYR7	Paenibacillus_phage	4.9e-12	100.0
AVF22616.1\|2647097_2647730_-	phage-related protein	A0A0K2CYY7	Paenibacillus_phage	2.5e-116	100.0
AVF22617.1\|2647809_2648592_-	DnaD domain protein	A0A0K2CZ53	Paenibacillus_phage	1.9e-137	100.0
AVF22618.1\|2648671_2649004_-	hypothetical protein	A0A0K2CYQ2	Paenibacillus_phage	2.8e-58	100.0
AVF22619.1\|2649000_2649390_-	hypothetical protein	A0A0K2CYI4	Paenibacillus_phage	1.5e-66	100.0
AVF22620.1\|2649398_2649803_-	single-stranded DNA-binding protein	A0A0K2CYR2	Paenibacillus_phage	7.8e-71	100.0
AVF22621.1\|2649792_2650431_-	ERF superfamily protein	A0A0K2CYY2	Paenibacillus_phage	5.9e-113	100.0
AVF22622.1\|2650433_2650982_-	Mu-like prophage host-nuclease inhibitor protein Gam	A0A0K2CZ48	Paenibacillus_phage	4.3e-96	100.0
AVF22623.1\|2650978_2651242_-	hypothetical protein	A0A0K2CYP7	Paenibacillus_phage	2.6e-43	100.0
AVF22624.1\|2651341_2651482_-	hypothetical protein	A0A0K2CYI0	Paenibacillus_phage	3.1e-19	100.0
AVF22625.1\|2651459_2651804_-	hypothetical protein	A0A0K2CYQ7	Paenibacillus_phage	3.8e-58	100.0
AVF22626.1\|2651890_2652403_+	hypothetical protein	A0A0K2CYX7	Paenibacillus_phage	2.9e-94	100.0
AVF22627.1\|2652392_2652650_-	hypothetical protein	A0A0K2CZ43	Paenibacillus_phage	1.7e-42	100.0
AVF22628.1\|2652642_2653218_-	hypothetical protein	A0A0K2CYP2	Paenibacillus_phage	1.1e-102	100.0
AVF22629.1\|2653214_2653967_-	putative prophage antirepressor	A0A0K2CY14	Paenibacillus_phage	3.9e-140	100.0
AVF22630.1\|2653971_2654145_-	hypothetical protein	R9VY98	Paenibacillus_phage	6.0e-28	100.0
AVF22631.1\|2654128_2654359_-	hypothetical protein	R9W0P6	Paenibacillus_phage	1.0e-35	100.0
AVF22632.1\|2654355_2654733_-	hypothetical protein	R9VW30	Paenibacillus_phage	1.2e-65	100.0
AVF22633.1\|2654739_2654943_-	hypothetical protein	R9W009	Paenibacillus_phage	2.2e-34	100.0
AVF22634.1\|2654963_2655233_-	hypothetical protein	A0A0K2CYH1	Paenibacillus_phage	8.4e-45	100.0
AVF22635.1\|2655247_2655445_-	hypothetical protein	A0A0K2CYD7	Paenibacillus_phage	2.8e-29	100.0
AVF22636.1\|2655561_2655783_-	anaerobic benzoate catabolism transcriptional regulator	A0A0K2CYW6	Paenibacillus_phage	1.7e-35	100.0
AVF22637.1\|2655877_2656216_+	helix-turn-helix family protein	A0A0K2CZ35	Paenibacillus_phage	9.2e-57	100.0
AVF22638.1\|2656217_2657900_+	putative DNA recombinase CisA	A0A0K2CYN0	Paenibacillus_phage	0.0e+00	100.0

DBSCAN-SWA_21

2690996 : 2717335

Paenibacillus_phage(22.22%)

integrase,transposase

attL 2685952:2685968|attR 2715513:2715529

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2685952:2685968	attL	NA	NA	NA	NA
AVF22678.1\|2690996_2691308_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVF22679.1\|2691346_2692156_+\|transposase	putative transposase	NA	NA	NA	NA
AVF22680.1\|2693556_2693907_-	hypothetical protein	A0A0K2CYS5	Paenibacillus_phage	1.4e-28	60.0
AVF22681.1\|2694637_2695117_+	hypothetical protein	NA	NA	NA	NA
AVF22682.1\|2695888_2695999_-	hypothetical protein	NA	NA	NA	NA
AVF22683.1\|2695998_2696223_-	helix-turn-helix protein	NA	NA	NA	NA
AVF22684.1\|2696369_2696921_+	LexA repressor-like protein	R9VW28	Paenibacillus_phage	3.6e-18	33.3
AVF22685.1\|2697086_2697422_+\|integrase	phage integrase-like protein	S5MNZ2	Brevibacillus_phage	6.8e-12	43.2
AVF22686.1\|2697537_2698023_+\|integrase	phage integrase-like protein	S5MNZ2	Brevibacillus_phage	1.7e-27	57.9
AVF22687.1\|2698889_2699093_+	hypothetical protein	NA	NA	NA	NA
AVF22688.1\|2699351_2700056_-	FMN reductase (NAD(P)H)	NA	NA	NA	NA
AVF22689.1\|2700206_2701478_-	NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AVF22690.1\|2701612_2702944_-	ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein	NA	NA	NA	NA
AVF22691.1\|2703354_2703756_-	ABC transporter-like protein	A0A1B0RXA0	Streptococcus_phage	4.4e-05	30.0
AVF22692.1\|2703752_2703875_-	hypothetical protein	NA	NA	NA	NA
AVF22693.1\|2703871_2704033_-	hypothetical protein	NA	NA	NA	NA
AVF22694.1\|2704101_2704440_-	YolD-like protein	NA	NA	NA	NA
AVF22695.1\|2704436_2705684_-	DNA polymerase IV 2	NA	NA	NA	NA
AVF22696.1\|2706239_2707295_-	arsenite resistance protein ArsB	NA	NA	NA	NA
AVF22697.1\|2707323_2707671_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22698.1\|2708333_2708696_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22699.1\|2708905_2711038_+	putative cadmium-transporting ATPase CadA	E4ZFI9	Streptococcus_phage	1.0e-164	44.6
AVF22700.1\|2711263_2711941_+	transcriptional regulatory protein ResD	W8CYM9	Bacillus_phage	2.8e-65	54.3
AVF22701.1\|2711972_2713352_+	alkaline phosphatase synthesis sensor protein PhoR	W8CYF6	Bacillus_phage	4.0e-58	41.0
AVF22702.1\|2713430_2714537_+	acidobacterial duplicated orphan permease	NA	NA	NA	NA
AVF22703.1\|2714536_2715220_+	putative ABC transporter ATP-binding protein YvrO	G9BWD6	Planktothrix_phage	5.3e-35	39.0
AVF22704.1\|2715112_2715325_-	hypothetical protein	NA	NA	NA	NA
AVF22705.1\|2715467_2715761_+	hypothetical protein	NA	NA	NA	NA
2715513:2715529	attR	NA	NA	NA	NA
AVF22706.1\|2715616_2716018_-	hypothetical protein	NA	NA	NA	NA
AVF22707.1\|2716250_2716808_+\|transposase	transposase	NA	NA	NA	NA
AVF22708.1\|2716825_2717335_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2796370 : 2862217

Paenibacillus_phage(56.25%)

terminase,integrase,portal,coat,transposase,lysis,tail,head,holin

attL 2788419:2788435|attR 2842942:2842958

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2788419:2788435	attL	NA	NA	NA	NA
AVF22787.1\|2796370_2797594_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF22788.1\|2797955_2799215_+	glycosyl transferase	NA	NA	NA	NA
AVF22789.1\|2799807_2801370_-	bacillolysin	NA	NA	NA	NA
AVF22790.1\|2802210_2803779_+	spore germination protein KA	NA	NA	NA	NA
AVF22791.1\|2803867_2804206_+\|transposase	transposase family protein	NA	NA	NA	NA
AVF22792.1\|2804166_2805018_+\|transposase	transposase-like protein	A0A1B1P773	Bacillus_phage	1.7e-35	35.1
AVF22793.1\|2805501_2805849_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.5e-57	99.1
AVF22794.1\|2807099_2807447_-	hypothetical protein	A0A0C5AN23	Paenibacillus_phage	1.1e-31	92.5
AVF22795.1\|2807989_2808427_+	hypothetical protein	NA	NA	NA	NA
AVF22796.1\|2808690_2809362_-	N-acetylmuramoyl-L-alanine amidase	A0A0C5AEW3	Paenibacillus_phage	4.4e-127	94.6
AVF22797.1\|2809460_2809868_-\|holin,lysis	toxin secretion/phage lysis holin	D0R7H7	Paenibacillus_phage	3.2e-32	52.9
AVF22798.1\|2809902_2810070_-	hypothetical protein	A0A0C5ABK5	Bacteriophage	2.3e-16	87.0
AVF22799.1\|2810195_2810396_-	hypothetical protein	A0A0C5AE97	Paenibacillus_phage	3.9e-15	62.5
AVF22800.1\|2810407_2811172_-	hypothetical protein	A0A0C5AEQ0	Bacteriophage	1.5e-70	80.9
AVF22801.1\|2811171_2812650_-	hypothetical protein	A0A1B2APX2	Phage_Wrath	6.8e-120	55.4
AVF22802.1\|2812649_2813348_-	Phage-related protein	A0A1B2APY0	Phage_Wrath	2.4e-43	41.8
AVF22803.1\|2813350_2816551_-	tape measure domain protein	M1IEW1	Bacillus_virus	6.7e-56	43.2
AVF22804.1\|2816571_2816919_-	hypothetical protein	A0A097PAX1	Streptococcus_pyogenes_phage	2.1e-19	44.6
AVF22805.1\|2816996_2817302_-	hypothetical protein	NA	NA	NA	NA
AVF22806.1\|2817301_2817826_-\|tail	phage major tail protein, TP901-1 family	A0A097PBF4	Streptococcus_pyogenes_phage	1.6e-52	72.8
AVF22807.1\|2817839_2818250_-	hypothetical protein	A0A097PAW5	Streptococcus_pyogenes_phage	3.9e-33	44.9
AVF22808.1\|2818254_2818590_-	hypothetical protein	A0A097PAT9	Streptococcus_pyogenes_phage	2.4e-09	37.2
AVF22809.1\|2818595_2818901_-	hypothetical protein	NA	NA	NA	NA
AVF22810.1\|2818897_2819221_-\|head,tail	Phage gp6-like head-tail connector protein	NA	NA	NA	NA
AVF22811.1\|2819223_2820120_-	hypothetical protein	A7J297	Streptococcus_phage	4.3e-69	52.1
AVF22812.1\|2820132_2820729_-	hypothetical protein	NA	NA	NA	NA
AVF22813.1\|2820809_2821652_-\|head	phage head morphogenesis protein, SPP1 gp7 family	S5MTV5	Brevibacillus_phage	3.8e-35	34.2
AVF22814.1\|2821611_2823021_-\|portal	phage portal protein, SPP1 family	A0A097PAT2	Streptococcus_pyogenes_phage	2.4e-114	50.7
AVF22815.1\|2823021_2824317_-\|terminase	phage terminase, large subunit, PBSX family	A0A1L2JY46	Aeribacillus_phage	3.9e-140	58.6
AVF22816.1\|2824300_2825080_-\|terminase	phage-related terminase-like protein small subunit	A0A1L2JY44	Aeribacillus_phage	6.4e-53	52.3
AVF22817.1\|2825135_2825303_-	hypothetical protein	NA	NA	NA	NA
AVF22818.1\|2825318_2825687_-	hypothetical protein	R9VWV2	Paenibacillus_phage	6.1e-38	76.3
AVF22819.1\|2825655_2825898_-	hypothetical protein	A0A1C8E971	Bacillus_phage	1.3e-28	85.5
AVF22820.1\|2825953_2826160_-	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	2.2e-29	93.9
AVF22821.1\|2826292_2826721_-	phage transcriptional regulator, RinA family	A0A0K2CZI2	Paenibacillus_phage	1.9e-75	100.0
AVF22822.1\|2826717_2826912_-	hypothetical protein	A0A0K2CZP1	Paenibacillus_phage	3.2e-30	100.0
AVF22823.1\|2826945_2828046_-	RNA polymerase sigma-F factor SigF	A0A0K2CZU8	Paenibacillus_phage	6.6e-213	100.0
AVF22824.1\|2828047_2828269_-	hypothetical protein	A0A0K2CZG3	Paenibacillus_phage	9.9e-36	100.0
AVF22825.1\|2828272_2828668_-	Holliday junction resolvase	A0A0K2CZ96	Paenibacillus_phage	2.0e-71	100.0
AVF22826.1\|2828657_2829011_-	hypothetical protein	A0A0K2CZH7	Paenibacillus_phage	2.1e-64	100.0
AVF22827.1\|2829222_2831529_-	Regulatory protein RepA	A0A0K2CZ75	Paenibacillus_phage	0.0e+00	100.0
AVF22828.1\|2831688_2833269_-	UvrABC system protein B	A0A0K2CZF8	Paenibacillus_phage	4.7e-305	100.0
AVF22829.1\|2833278_2833785_-	hypothetical protein	A0A0K2CZ91	Paenibacillus_phage	1.8e-93	100.0
AVF22830.1\|2833809_2834886_-	hypothetical protein	A0A0K2CZH1	Paenibacillus_phage	5.1e-210	100.0
AVF22831.1\|2834888_2836199_-	putative ATP-binding protein involved in virulence	A0A0K2CZN2	Paenibacillus_phage	1.4e-180	99.8
AVF22832.1\|2836264_2836975_-	hypothetical protein	A0A0K2CZT8	Paenibacillus_phage	3.6e-127	100.0
AVF22833.1\|2837011_2837383_-	hypothetical protein	A0A0K2CZF3	Paenibacillus_phage	5.7e-60	100.0
AVF22834.1\|2837415_2837700_-	transition state regulatory protein AbrB	A0A0K2CZ86	Paenibacillus_phage	2.1e-46	95.7
AVF22835.1\|2837696_2837927_-	hypothetical protein	A0A2I7SC43	Paenibacillus_phage	1.8e-32	88.2
AVF22836.1\|2837942_2838194_-	hypothetical protein	A0A0K2CYH1	Paenibacillus_phage	2.8e-10	46.9
AVF22837.1\|2838210_2838459_-	hypothetical protein	NA	NA	NA	NA
AVF22838.1\|2838428_2838611_-	DNA binding domain, excisionase family	NA	NA	NA	NA
AVF22839.1\|2839063_2839396_+	putative phage protein	A0A0K2CZS1	Paenibacillus_phage	2.8e-18	34.5
AVF22840.1\|2839403_2839868_+	hypothetical protein	A0A2I7SC21	Paenibacillus_phage	1.1e-49	58.8
AVF22841.1\|2839947_2841087_+\|integrase	phage integrase family protein	A0A1B0T6A8	Bacillus_phage	2.2e-62	39.7
AVF22842.1\|2841139_2841505_-	hypothetical protein	NA	NA	NA	NA
AVF22843.1\|2842082_2843888_-	oligoendopeptidase, pepF/M3 family	NA	NA	NA	NA
2842942:2842958	attR	NA	NA	NA	NA
AVF22844.1\|2844255_2844549_+	hypothetical protein	NA	NA	NA	NA
AVF22845.1\|2844676_2845378_-	hypothetical protein	NA	NA	NA	NA
AVF22846.1\|2845405_2845789_-	bacterial globin family protein	NA	NA	NA	NA
AVF22847.1\|2845844_2845943_-	hypothetical protein	NA	NA	NA	NA
AVF22848.1\|2846100_2847351_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
AVF22849.1\|2847494_2848301_+	putative inorganic polyphosphate/ATP-NAD kinase PpnK	NA	NA	NA	NA
AVF22850.1\|2848499_2849159_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	4.9e-62	54.3
AVF22851.1\|2849351_2850116_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	4.5e-35	43.8
AVF22852.1\|2849977_2850397_-	hypothetical protein	NA	NA	NA	NA
AVF22853.1\|2850434_2851319_-	lipoyl synthase LipA	NA	NA	NA	NA
AVF22854.1\|2851507_2852593_+	peptidase, M23 family	A0A7K9	Microcystis_virus	5.1e-08	37.0
AVF22855.1\|2852647_2853397_-	spore formation-associated protein	NA	NA	NA	NA
AVF22856.1\|2853929_2854034_-	hypothetical protein	NA	NA	NA	NA
AVF22857.1\|2854116_2855022_-	transcriptional regulator	NA	NA	NA	NA
AVF22858.1\|2855600_2856353_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF22859.1\|2857262_2858201_-	O-acetylserine sulfhydrylase CysK	C3U2M1	Lactococcus_phage	4.9e-84	55.4
AVF22860.1\|2858224_2859043_-	RNA methyltransferase, TrmH family	NA	NA	NA	NA
AVF22861.1\|2859045_2859705_-	Ktr system potassium uptake protein C	NA	NA	NA	NA
AVF22862.1\|2859861_2860071_+	small, acid-soluble spore protein I	NA	NA	NA	NA
AVF22863.1\|2860331_2861093_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVF22864.1\|2861089_2862217_-\|coat	spore coat protein SA	NA	NA	NA	NA

DBSCAN-SWA_23

2912109 : 2969879

Paenibacillus_phage(44.44%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF22905.1\|2912109_2912397_-\|tRNA	aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C	NA	NA	NA	NA
AVF22906.1\|2912612_2913677_+	sensor-like protein	NA	NA	NA	NA
AVF22907.1\|2913771_2914152_-	hypothetical protein	NA	NA	NA	NA
AVF22908.1\|2914319_2914694_-	aminopeptidase-like protein	NA	NA	NA	NA
AVF22909.1\|2914802_2915426_-	metallo-beta-lactamase domain protein	A0A1X9I5D3	Streptococcus_phage	3.3e-28	40.3
AVF22910.1\|2915449_2916016_-	hypothetical protein	NA	NA	NA	NA
AVF22911.1\|2916131_2916737_-	membrane phosphatase-like protein	NA	NA	NA	NA
AVF22912.1\|2916867_2917383_+	Cytochrome c oxidase subunit 2	NA	NA	NA	NA
AVF22913.1\|2917583_2917772_+	hypothetical protein	NA	NA	NA	NA
AVF22914.1\|2918119_2918698_+	transcriptional regulator, TetR family	NA	NA	NA	NA
AVF22915.1\|2918835_2919651_+	phage infection protein Pip	NA	NA	NA	NA
AVF22916.1\|2919708_2921142_+	hypothetical protein	NA	NA	NA	NA
AVF22917.1\|2921412_2922204_+	polysaccharide deacetylase, PdaB family	NA	NA	NA	NA
AVF22918.1\|2922225_2922918_+	putative L,D-transpeptidase YkuD	NA	NA	NA	NA
AVF22919.1\|2923270_2923816_-	putative sporulation protein YyaC	G3M9W0	Bacillus_virus	7.0e-22	37.4
AVF22920.1\|2924024_2924141_+	hypothetical protein	NA	NA	NA	NA
AVF22921.1\|2924249_2924954_-	copper homeostasis protein CutC	NA	NA	NA	NA
AVF22922.1\|2925510_2927394_+	putative lantibiotic biosynthesis protein	A0A2H4PQG8	Staphylococcus_phage	4.7e-49	26.2
AVF22923.1\|2927430_2929749_+	putative lantibiotic biosynthesis protein	NA	NA	NA	NA
AVF22924.1\|2929820_2930075_+	putative lantibiotic biosynthesis protein	NA	NA	NA	NA
AVF22925.1\|2930363_2931680_-	DAACS family dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
AVF22926.1\|2931798_2931942_-	hypothetical protein	NA	NA	NA	NA
AVF22927.1\|2931967_2932951_-	hypothetical protein	NA	NA	NA	NA
AVF22928.1\|2932975_2933272_-	hypothetical protein	NA	NA	NA	NA
AVF22929.1\|2933292_2935236_-	sodium/proton antiporter, CPA1 family	NA	NA	NA	NA
AVF22930.1\|2935360_2935639_-	hypothetical protein	NA	NA	NA	NA
AVF22931.1\|2936411_2937191_-	hypothetical protein	NA	NA	NA	NA
AVF22932.1\|2937426_2938884_+	cardiolipin synthase	NA	NA	NA	NA
AVF22933.1\|2939069_2940155_-	micrococcal nuclease	NA	NA	NA	NA
AVF22934.1\|2940765_2941539_-	phosphosugar-binding transcriptional regulator	NA	NA	NA	NA
AVF22935.1\|2941614_2942808_-	protein MalY	NA	NA	NA	NA
AVF22936.1\|2942833_2944393_-	PTS system maltose- and glucose-specific EIICB component MalX	NA	NA	NA	NA
AVF22937.1\|2945158_2945407_+	hypothetical protein	NA	NA	NA	NA
AVF22938.1\|2945413_2945677_+	hypothetical protein	NA	NA	NA	NA
AVF22939.1\|2945860_2946802_-	hypothetical protein	NA	NA	NA	NA
AVF22940.1\|2946983_2947598_+	Anti-sigma-V factor RsiV	NA	NA	NA	NA
AVF22941.1\|2947820_2949041_-	anion ABC transporter-like protein	NA	NA	NA	NA
AVF22942.1\|2949046_2949736_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22943.1\|2949935_2950226_-	putative dienelactone hydrolase	NA	NA	NA	NA
AVF22944.1\|2950692_2951121_+	pyruvate formate-lyase-activating enzyme	NA	NA	NA	NA
AVF22945.1\|2951115_2951880_-	putative phosphoglycolate phosphatase	NA	NA	NA	NA
AVF22946.1\|2952131_2953355_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF22947.1\|2953459_2953618_-	hypothetical protein	NA	NA	NA	NA
AVF22948.1\|2953692_2954430_-	hypothetical protein	NA	NA	NA	NA
AVF22949.1\|2954614_2954839_+	hypothetical protein	NA	NA	NA	NA
AVF22950.1\|2954937_2955552_+	RNA polymerase sigma-B factor SigB	NA	NA	NA	NA
AVF22951.1\|2957750_2959121_+	arylsulfatase regulator Fe-S oxidoreductase	NA	NA	NA	NA
AVF22952.1\|2959098_2959686_+	putative coenzyme A biosynthesis bifunctional protein CoaBC	NA	NA	NA	NA
AVF22953.1\|2959657_2960944_+	major facilitator superfamily MFS_1 protein	NA	NA	NA	NA
AVF22954.1\|2961177_2961627_+\|transposase	transposase IS3/IS911 family protein	A0A0C5AJ29	Paenibacillus_phage	2.7e-24	47.1
AVF22955.1\|2962208_2962796_-\|transposase	transposase-like protein	A0A2I7SC85	Paenibacillus_phage	2.3e-95	96.2
AVF22956.1\|2963045_2963327_-\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	2.4e-42	98.9
AVF22957.1\|2963514_2963847_-	hypothetical protein	NA	NA	NA	NA
AVF22958.1\|2964165_2964435_+	Antitoxin MazE	NA	NA	NA	NA
AVF22959.1\|2964428_2964761_+	mRNA interferase NdoA	NA	NA	NA	NA
AVF22960.1\|2965012_2965303_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF22961.1\|2965299_2967810_+	coenzyme A disulfide reductase	NA	NA	NA	NA
AVF22962.1\|2967915_2968212_+	hypothetical protein	NA	NA	NA	NA
AVF22963.1\|2968728_2969016_+\|transposase	transposase IS3/IS911 family protein	Q6H9S5	Enterobacteria_phage	6.9e-05	44.7
AVF22964.1\|2969063_2969879_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-58	45.4

DBSCAN-SWA_24

2980389 : 3024807

Bacillus_phage(40.0%)

integrase,transposase,protease

attL 2969952:2969985|attR 3029863:3029896

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2969952:2969985	attL	NA	NA	NA	NA
AVF22973.1\|2980389_2980512_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVF22974.1\|2981230_2981593_-\|integrase	integrase catalytic region	NA	NA	NA	NA
AVF22975.1\|2982039_2982291_+	DNA polymerase IV 2	NA	NA	NA	NA
AVF22976.1\|2982522_2982639_-	hypothetical protein	NA	NA	NA	NA
AVF22977.1\|2983329_2983617_+	IclR family transcriptional regulator	NA	NA	NA	NA
AVF22978.1\|2983679_2983931_-	hypothetical protein	NA	NA	NA	NA
AVF22979.1\|2984288_2985302_+	transcriptional regulatory protein	NA	NA	NA	NA
AVF22980.1\|2985305_2985815_-\|transposase	transposase	NA	NA	NA	NA
AVF22981.1\|2986132_2987785_+	Beta-xylosidase	NA	NA	NA	NA
AVF22982.1\|2987969_2989136_+	amidohydrolase-like protein	NA	NA	NA	NA
AVF22983.1\|2989207_2990395_+	putative MFS-type transporter YitG	NA	NA	NA	NA
AVF22984.1\|2990454_2990745_+	putative L-serine dehydratase, alpha chain	NA	NA	NA	NA
AVF22985.1\|2991320_2991695_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	5.0e-64	92.7
AVF22986.1\|2991842_2992160_+\|transposase	transposase IS3/IS911	NA	NA	NA	NA
AVF22987.1\|2992374_2992938_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	2.6e-24	41.0
AVF22988.1\|2994543_2994642_-	hypothetical protein	NA	NA	NA	NA
AVF22989.1\|2995019_2996390_-	putrescine importer PuuP	NA	NA	NA	NA
AVF22990.1\|2996480_2997593_-	alanine dehydrogenase Ald	NA	NA	NA	NA
AVF22991.1\|2998279_2998369_-	hypothetical protein	NA	NA	NA	NA
AVF22992.1\|2999205_2999682_-	hypothetical protein	NA	NA	NA	NA
AVF22993.1\|2999837_3000068_-	hypothetical protein	NA	NA	NA	NA
AVF22994.1\|3000599_3001100_-	hypothetical protein	NA	NA	NA	NA
AVF22995.1\|3001181_3001676_+	hypothetical protein	NA	NA	NA	NA
AVF22996.1\|3002862_3003060_-	hypothetical protein	NA	NA	NA	NA
AVF22997.1\|3003615_3004107_+	hypothetical protein	NA	NA	NA	NA
AVF22998.1\|3004149_3004326_+	hypothetical protein	NA	NA	NA	NA
AVF22999.1\|3004424_3004517_-	hypothetical protein	NA	NA	NA	NA
AVF23000.1\|3004859_3005060_-	hypothetical protein	NA	NA	NA	NA
AVF23001.1\|3005283_3005694_+	hypothetical protein	NA	NA	NA	NA
AVF23002.1\|3006369_3007512_-\|protease	minor extracellular protease Epr	A0A1B0T6A2	Bacillus_phage	7.2e-45	37.4
AVF23003.1\|3007556_3007943_-	hypothetical protein	NA	NA	NA	NA
AVF23004.1\|3008047_3008422_-	hypothetical protein	NA	NA	NA	NA
AVF23005.1\|3009113_3009263_-	hypothetical protein	NA	NA	NA	NA
AVF23006.1\|3011340_3011493_-	hypothetical protein	NA	NA	NA	NA
AVF23007.1\|3013421_3013673_+	hypothetical protein	NA	NA	NA	NA
AVF23008.1\|3013749_3014187_+	hypothetical protein	NA	NA	NA	NA
AVF23009.1\|3014319_3014691_-	DNA polymerase III PolC-like protein	A2I2Z6	Vibrio_virus	4.3e-15	44.0
AVF23010.1\|3014958_3015258_-\|integrase	integrase family protein	NA	NA	NA	NA
AVF23011.1\|3015511_3016036_-	hypothetical protein	NA	NA	NA	NA
AVF23012.1\|3016163_3017696_-	NADH dehydrogenase AhpF	A0A2I2L5E1	Orpheovirus	5.7e-37	32.4
AVF23013.1\|3017704_3018268_-	alkyl hydroperoxide reductase subunit C	NA	NA	NA	NA
AVF23014.1\|3018410_3018578_-	Virus attachment protein p12 family protein	NA	NA	NA	NA
AVF23015.1\|3018591_3020340_-	ferrous iron transport protein B	NA	NA	NA	NA
AVF23016.1\|3020450_3020579_-	ferrous iron transport protein B	NA	NA	NA	NA
AVF23017.1\|3020575_3020803_-	FeoA family protein	NA	NA	NA	NA
AVF23018.1\|3021598_3022477_-	HTH-type transcriptional regulator GltC	NA	NA	NA	NA
AVF23019.1\|3022588_3023746_+	putative transporter protein	NA	NA	NA	NA
AVF23020.1\|3024004_3024517_+\|transposase	transposase	NA	NA	NA	NA
AVF23021.1\|3024513_3024807_+\|transposase	transposase	NA	NA	NA	NA
3029863:3029896	attR	NA	NA	NA	NA

DBSCAN-SWA_25

3031305 : 3077219

Paenibacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23029.1\|3031305_3032058_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF23030.1\|3032195_3032879_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	4.5e-119	96.5
AVF23031.1\|3033282_3034599_-	putative membrane protein	NA	NA	NA	NA
AVF23032.1\|3035252_3035429_-	sensor histidine kinase ResE	NA	NA	NA	NA
AVF23033.1\|3035534_3036650_-	toxin-like protein	A0A1V0E026	Clostridioides_phage	2.3e-43	41.7
AVF23034.1\|3036659_3036884_-	toxin-like protein	NA	NA	NA	NA
AVF23035.1\|3037005_3037197_-	toxin-like protein	NA	NA	NA	NA
AVF23036.1\|3037249_3037822_-	toxin-like protein	Q331X8	Clostridium_botulinum_C_phage	4.3e-30	40.2
AVF23037.1\|3037782_3037995_-	hypothetical protein	NA	NA	NA	NA
AVF23038.1\|3038182_3040630_-	3-oxoacyl-[acyl-carrier-protein] synthase	NA	NA	NA	NA
AVF23039.1\|3040641_3041688_-	aminomethyltransferase GcvT	NA	NA	NA	NA
AVF23040.1\|3041737_3042247_-\|transposase	transposase	NA	NA	NA	NA
AVF23041.1\|3042264_3042822_-\|transposase	transposase	NA	NA	NA	NA
AVF23042.1\|3045728_3046688_-	hypothetical protein	NA	NA	NA	NA
AVF23043.1\|3047278_3047470_+\|transposase	transposase-like protein	A0A0C5AEB1	Paenibacillus_phage	4.3e-11	64.8
AVF23044.1\|3048183_3048390_+	cold shock-like protein CspLB	Q9AZD3	Lactococcus_phage	4.6e-19	64.6
AVF23045.1\|3048490_3048769_+	DNA-binding protein HU 1	M4SRV7	Rhodobacter_phage	7.2e-07	38.3
AVF23046.1\|3049805_3050444_+	channel protein, hemolysin III family	NA	NA	NA	NA
AVF23047.1\|3050839_3051562_-	ubiquinone/menaquinone biosynthesis methyltransferase	NA	NA	NA	NA
AVF23048.1\|3051579_3052221_-	bacterial transferase hexapeptide repeat protein	NA	NA	NA	NA
AVF23049.1\|3053472_3054339_-	glycosyltransferase-like protein	A0A1V0SAH6	Catovirus	8.2e-09	32.4
AVF23050.1\|3054556_3056086_+	Hyaluronan synthase	A0A0N7G7L1	Chrysochromulina_ericina_virus	2.0e-42	32.4
AVF23051.1\|3056466_3057558_-	PTS system, fructose-specific, IIB component/PTS system, fructose subfamily, IIC component	NA	NA	NA	NA
AVF23052.1\|3057572_3057920_-	PTS system, fructose-specific, IIB component/PTS system, fructose subfamily, IIC component	NA	NA	NA	NA
AVF23053.1\|3057916_3058381_-	PTS system, fructose subfamily, IIA component	NA	NA	NA	NA
AVF23054.1\|3058409_3060293_-	PTS system fructose-specific EIIABC component FruA	NA	NA	NA	NA
AVF23055.1\|3060320_3061199_-	D-tagatose-1,6-bisphosphate aldolase subunit GatY	NA	NA	NA	NA
AVF23056.1\|3061218_3061977_-	putative transcriptional regulator ManR	NA	NA	NA	NA
AVF23057.1\|3061961_3063050_-	transcriptional regulator MtlR	NA	NA	NA	NA
AVF23058.1\|3063293_3064298_-	5-dehydro-2-deoxygluconokinase IolC	NA	NA	NA	NA
AVF23059.1\|3064299_3064950_-	KHG/KDPG aldolase	NA	NA	NA	NA
AVF23060.1\|3065015_3066410_-	Uronate isomerase	NA	NA	NA	NA
AVF23061.1\|3066430_3066943_-	glucuronide transporter	NA	NA	NA	NA
AVF23062.1\|3066943_3067918_-	Glucuronide permease	NA	NA	NA	NA
AVF23063.1\|3068034_3069105_-	Mannonate dehydratase	NA	NA	NA	NA
AVF23064.1\|3069095_3069440_-	Mannitol-1-phosphate/altronate dehydrogenase	NA	NA	NA	NA
AVF23065.1\|3069433_3070459_-	Polyol:NADP oxidoreductase	NA	NA	NA	NA
AVF23066.1\|3071032_3071701_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVF23067.1\|3072478_3074794_-	magnesium-transporting ATPase, P-type 1	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	4.9e-32	24.7
AVF23068.1\|3075743_3076403_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	5.4e-61	53.3
AVF23069.1\|3076595_3077219_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	3.7e-35	43.8

DBSCAN-SWA_26

3437950 : 3444707

Staphylococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23432.1\|3437950_3438595_-	segregation and condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	8.2e-14	31.9
AVF23433.1\|3438560_3439343_-	segregation and condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.7e-09	34.2
AVF23434.1\|3439773_3440244_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.1e-42	57.9
AVF23435.1\|3440279_3441509_-	riboflavin biosynthesis protein RibBA	A0A2H4PQS2	Staphylococcus_phage	8.1e-111	51.0
AVF23436.1\|3441543_3442209_-	riboflavin synthase alpha chain RibE	A0A2H4PQS5	Staphylococcus_phage	3.4e-39	43.3
AVF23437.1\|3442212_3443346_-	riboflavin biosynthesis protein RibD	A0A2H4PQS8	Staphylococcus_phage	1.6e-52	35.5
AVF23438.1\|3444269_3444707_-	peptidyl-prolyl cis-trans isomerase B	A0A1B1IVS0	uncultured_Mediterranean_phage	1.6e-21	45.3

DBSCAN-SWA_27

3476359 : 3487395

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23471.1\|3476359_3476986_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	4.6e-54	53.8
AVF23472.1\|3477212_3477815_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	3.6e-35	43.8
AVF23473.1\|3478570_3479071_-	Phenolic acid decarboxylase PadC	NA	NA	NA	NA
AVF23474.1\|3479185_3479785_+	transcriptional regulator, Acidobacterial, PadR-family	NA	NA	NA	NA
AVF23475.1\|3480139_3480358_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF23476.1\|3480826_3481228_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.7e-38	60.3
AVF23477.1\|3481377_3481632_-	hypothetical protein	NA	NA	NA	NA
AVF23478.1\|3481658_3482168_-	hypothetical protein	NA	NA	NA	NA
AVF23479.1\|3482601_3483354_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVF23480.1\|3484339_3484729_-	hypothetical protein	NA	NA	NA	NA
AVF23481.1\|3484966_3485461_-	hypothetical protein	NA	NA	NA	NA
AVF23482.1\|3486243_3486531_+\|transposase	transposase IS3/IS911 family protein	A0A1P8CWP5	Bacillus_phage	3.1e-05	37.8
AVF23483.1\|3486918_3487395_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	8.4e-40	53.4

DBSCAN-SWA_28

3491927 : 3517339

Paenibacillus_phage(81.82%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23488.1\|3491927_3492194_-\|coat	spore coat peptide assembly protein	NA	NA	NA	NA
AVF23489.1\|3492466_3492679_-\|coat	Spore coat associated protein JA (CotJA)	NA	NA	NA	NA
AVF23490.1\|3492859_3493543_+\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	9.7e-122	99.1
AVF23491.1\|3493680_3494433_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	9.3e-134	97.9
AVF23492.1\|3494592_3495963_-	Magnesium and cobalt efflux protein CorC	NA	NA	NA	NA
AVF23493.1\|3496015_3497140_-	radical SAM domain protein	NA	NA	NA	NA
AVF23494.1\|3497507_3498359_-	undecaprenyl-diphosphatase UppP	NA	NA	NA	NA
AVF23495.1\|3498503_3499919_-	putative metallophosphoesterase YunD	NA	NA	NA	NA
AVF23496.1\|3500355_3501072_-	hypothetical protein	NA	NA	NA	NA
AVF23497.1\|3501264_3501597_+	putative membrane protein	NA	NA	NA	NA
AVF23498.1\|3501675_3502722_+	metal dependent phosphohydrolase	NA	NA	NA	NA
AVF23499.1\|3502916_3503312_-	hypothetical protein	NA	NA	NA	NA
AVF23500.1\|3503716_3503980_-	hypothetical protein	NA	NA	NA	NA
AVF23501.1\|3503999_3505043_-	hypothetical protein	NA	NA	NA	NA
AVF23502.1\|3505315_3505549_+	hypothetical protein	NA	NA	NA	NA
AVF23503.1\|3505803_3506130_-\|transposase	transposase	NA	NA	NA	NA
AVF23504.1\|3506516_3507347_-\|transposase	transposase-like protein	A0A2I7SC85	Paenibacillus_phage	2.2e-152	98.9
AVF23505.1\|3507352_3507589_-\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	2.2e-33	98.7
AVF23506.1\|3507824_3508229_-	hypothetical protein	A0A2I7SDE8	Paenibacillus_phage	8.7e-70	100.0
AVF23507.1\|3508492_3509473_-	toxin-like protein	A0A2I7SDE4	Paenibacillus_phage	1.4e-68	81.6
AVF23508.1\|3509600_3509771_-	toxin-like protein	A0A2I7SCU7	Paenibacillus_phage	2.9e-19	86.0
AVF23509.1\|3509781_3510081_-	toxin-like protein	A0A0K2CXS6	Paenibacillus_phage	1.1e-45	93.9
AVF23510.1\|3510680_3510947_-	hypothetical protein	A0A0C5AEH5	Bacteriophage	7.5e-30	76.1
AVF23511.1\|3511741_3512080_-	hypothetical protein	NA	NA	NA	NA
AVF23512.1\|3512101_3512380_-	hypothetical protein	NA	NA	NA	NA
AVF23513.1\|3512500_3513724_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF23514.1\|3513716_3514085_-	hypothetical protein	NA	NA	NA	NA
AVF23515.1\|3514421_3515417_-	amidinotransferase family protein	NA	NA	NA	NA
AVF23516.1\|3515869_3516172_-	hypothetical protein	J7KJ12	Streptococcus_phage	9.8e-10	45.0
AVF23517.1\|3516284_3517013_-\|transposase	putative transposase	NA	NA	NA	NA
AVF23518.1\|3517051_3517339_-\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA

DBSCAN-SWA_29

3648160 : 3674070

Bacillus_phage(28.57%)

integrase,tRNA,transposase

attL 3655586:3655645|attR 3674921:3675935

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23647.1\|3648160_3650611_-\|tRNA	phenylalanine--tRNA ligase beta chain PheT	NA	NA	NA	NA
AVF23648.1\|3650634_3651663_-\|tRNA	phenylalanine--tRNA ligase alpha chain PheS	A0A2K9L3A8	Tupanvirus	1.7e-29	37.9
AVF23649.1\|3652764_3653280_-	type I signal peptidase-like protein	NA	NA	NA	NA
AVF23650.1\|3653447_3654371_+	putative oxidoreductase YajO	NA	NA	NA	NA
AVF23651.1\|3654477_3654774_+\|transposase	transposase family protein	NA	NA	NA	NA
AVF23652.1\|3655009_3655588_+\|transposase	transposase-like protein	A0A1B1P773	Bacillus_phage	3.1e-36	41.1
3655586:3655645	attL	NA	NA	NA	NA
AVF23653.1\|3655718_3656150_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A2I6AZV9	Macacine_betaherpesvirus	6.5e-23	47.9
AVF23654.1\|3656577_3658305_-\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	7.4e-94	36.6
AVF23655.1\|3658318_3659224_-\|integrase	phage integrase family protein	A0A0A7AR08	Bacillus_phage	1.4e-91	57.0
AVF23656.1\|3659367_3659748_-	hypothetical protein	NA	NA	NA	NA
AVF23657.1\|3660664_3661567_+	hypothetical protein	NA	NA	NA	NA
AVF23658.1\|3661585_3661687_+	hypothetical protein	NA	NA	NA	NA
AVF23659.1\|3662824_3663619_-	methyltransferase type 11	NA	NA	NA	NA
AVF23660.1\|3663692_3664136_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVF23661.1\|3664399_3664558_-	Arsenate reductase	NA	NA	NA	NA
AVF23662.1\|3665139_3666057_-	D-ribose-binding protein RbsB	NA	NA	NA	NA
AVF23663.1\|3666075_3667044_-	ribose transport system permease protein RbsC	NA	NA	NA	NA
AVF23664.1\|3667045_3668527_-	ribose import ATP-binding protein RbsA	G3M9Y6	Bacillus_virus	4.1e-16	27.6
AVF23665.1\|3668541_3668940_-	D-ribose pyranase RbsD	NA	NA	NA	NA
AVF23666.1\|3668941_3669820_-	ribokinase RbsK	NA	NA	NA	NA
AVF23667.1\|3669812_3670802_-	ribose operon repressor	NA	NA	NA	NA
AVF23668.1\|3671879_3672056_+	hypothetical protein	NA	NA	NA	NA
AVF23669.1\|3672100_3673450_+	putative DNA-binding protein	A0A0K2CP77	Brevibacillus_phage	7.6e-70	34.9
AVF23670.1\|3673453_3673594_+	hypothetical protein	NA	NA	NA	NA
AVF23671.1\|3673752_3674070_+\|transposase	transposase IS3/IS911	NA	NA	NA	NA
3674921:3675935	attR	NA	NA	NA	NA

DBSCAN-SWA_30

3793106 : 3824272

Paenibacillus_phage(50.0%)

integrase,transposase,protease

attL 3793978:3793992|attR 3816409:3816423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23805.1\|3793106_3793442_-\|transposase	transposase	NA	NA	NA	NA
AVF23806.1\|3793548_3794592_+	glycosyl transferase	NA	NA	NA	NA
3793978:3793992	attL	NA	NA	NA	NA
AVF23807.1\|3795048_3795447_-	hypothetical protein	NA	NA	NA	NA
AVF23808.1\|3795459_3797421_-	toxin-like protein	A0A2I7SCU7	Paenibacillus_phage	8.8e-192	80.5
AVF23809.1\|3797775_3798381_-	putative ADP-ribosyltransferase	Q331X8	Clostridium_botulinum_C_phage	7.5e-33	41.8
AVF23810.1\|3798907_3801520_-	toxin-like protein	A0A1V0E026	Clostridioides_phage	4.4e-98	34.4
AVF23811.1\|3801590_3802781_-	toxin-like protein	NA	NA	NA	NA
AVF23812.1\|3803692_3804139_-	hypothetical protein	NA	NA	NA	NA
AVF23813.1\|3804717_3804876_+	hypothetical protein	NA	NA	NA	NA
AVF23814.1\|3804862_3805555_-	hypothetical protein	D2XR29	Bacillus_phage	4.4e-45	43.7
AVF23815.1\|3805625_3805871_-	hypothetical protein	A0A2I7SC00	Paenibacillus_phage	2.8e-31	92.6
AVF23816.1\|3805880_3806552_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7SD00	Paenibacillus_phage	1.4e-128	95.5
AVF23817.1\|3806548_3806785_-	hypothetical protein	R9W0N4	Paenibacillus_phage	6.0e-31	98.6
AVF23818.1\|3807094_3807382_-	hypothetical protein	E2ELK3	Clostridium_phage	3.8e-19	51.6
AVF23819.1\|3807393_3807984_-	phage structural protein	NA	NA	NA	NA
AVF23820.1\|3808283_3808547_+	hypothetical protein	NA	NA	NA	NA
AVF23821.1\|3808553_3809048_+	LexA repressor-like protein	NA	NA	NA	NA
AVF23822.1\|3809060_3809351_+\|integrase	phage integrase family protein	S5MNZ2	Brevibacillus_phage	1.8e-16	54.5
AVF23823.1\|3809338_3810037_+\|integrase	phage integrase-like protein	A0A2I7SC08	Paenibacillus_phage	1.9e-72	58.4
AVF23824.1\|3810758_3811229_-	SprT-like protein	NA	NA	NA	NA
AVF23825.1\|3811327_3811684_+	hypothetical protein	NA	NA	NA	NA
AVF23826.1\|3812261_3812459_-	thermophilic serine proteinase	NA	NA	NA	NA
AVF23827.1\|3812455_3813460_-\|protease	minor extracellular protease Epr	A0A217EQY2	Bacillus_phage	7.5e-38	38.4
AVF23828.1\|3813715_3813943_-	hypothetical protein	NA	NA	NA	NA
AVF23829.1\|3814364_3814502_-	hypothetical protein	NA	NA	NA	NA
AVF23830.1\|3814534_3814993_-	hypothetical protein	NA	NA	NA	NA
AVF23831.1\|3815375_3815957_+	ECF subfamily RNA polymerase sigma-24 factor	NA	NA	NA	NA
AVF23832.1\|3816158_3818447_-	hypothetical protein	NA	NA	NA	NA
3816409:3816423	attR	NA	NA	NA	NA
AVF23833.1\|3818534_3818885_-	mRNA interferase NdoA	A0A2P0ZKX3	Lactobacillus_phage	6.9e-15	38.6
AVF23834.1\|3818888_3819170_-	putative transcriptional regulator, CopG family	NA	NA	NA	NA
AVF23835.1\|3819404_3820592_-	alanine racemase Alr	NA	NA	NA	NA
AVF23836.1\|3820759_3822016_-	sporulation protein YdcC	NA	NA	NA	NA
AVF23837.1\|3822560_3822767_-	hypothetical protein	NA	NA	NA	NA
AVF23838.1\|3823508_3823883_+\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	1.1e-47	68.9
AVF23839.1\|3823978_3824272_+\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	3.7e-14	43.8

DBSCAN-SWA_31

3828026 : 3889644

Paenibacillus_phage(25.0%)

integrase,coat,tRNA,transposase,bacteriocin

attL 3856816:3856830|attR 3894864:3894878

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF23845.1\|3828026_3828353_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
AVF23846.1\|3828672_3829506_+	sensor protein DegS	NA	NA	NA	NA
AVF23847.1\|3829474_3830143_+	oxygen regulatory protein NreC	NA	NA	NA	NA
AVF23848.1\|3830393_3831122_+\|transposase	transposase mutator type	A0A218MNI5	uncultured_virus	4.9e-15	68.3
AVF23849.1\|3831212_3832118_-	CRISPR-associated protein, Cmr3 family	NA	NA	NA	NA
AVF23850.1\|3832120_3833794_-	CRISPR-associated RAMP Crm2 family protein	NA	NA	NA	NA
AVF23851.1\|3833793_3834726_-	CRISPR-associated RAMP Cmr1 family protein	NA	NA	NA	NA
AVF23852.1\|3834748_3835630_-	hypothetical protein	NA	NA	NA	NA
AVF23853.1\|3835783_3836050_-	hypothetical protein	NA	NA	NA	NA
AVF23854.1\|3836846_3837023_-	hypothetical protein	NA	NA	NA	NA
AVF23855.1\|3839301_3839928_+	transporter-like protein	NA	NA	NA	NA
AVF23856.1\|3840490_3840799_-	ECF subfamily RNA polymerase sigma-24 factor	NA	NA	NA	NA
AVF23857.1\|3841041_3841896_-\|coat	spore coat polysaccharide biosynthesis protein SpsK	NA	NA	NA	NA
AVF23858.1\|3841892_3842852_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	5.1e-76	46.0
AVF23859.1\|3842848_3843406_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.1e-38	43.6
AVF23860.1\|3844866_3845682_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase CwlC	D6QWP2	uncultured_phage	5.3e-42	53.5
AVF23861.1\|3845913_3846618_-	putative membrane protein	NA	NA	NA	NA
AVF23862.1\|3846873_3847170_-	TrpR like protein, YerC/YecD	NA	NA	NA	NA
AVF23863.1\|3847456_3848773_-	putative tyrosine permease, NhaC family	NA	NA	NA	NA
AVF23864.1\|3848932_3849748_-	pyridoxine kinase PdxK	NA	NA	NA	NA
AVF23865.1\|3849857_3851720_-	decarboxylase	NA	NA	NA	NA
AVF23866.1\|3851777_3853226_-	putative transporter	NA	NA	NA	NA
AVF23867.1\|3854351_3855053_-	Replication protein	NA	NA	NA	NA
AVF23868.1\|3855084_3856347_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	2.2e-87	42.1
3856816:3856830	attL	NA	NA	NA	NA
AVF23869.1\|3856896_3858285_-	Na(+)/H(+) antiporter NhaC	NA	NA	NA	NA
AVF23870.1\|3858355_3860224_-	decarboxylase	NA	NA	NA	NA
AVF23871.1\|3860235_3861687_-	amino acid antiporter	NA	NA	NA	NA
AVF23872.1\|3862444_3862687_+	hypothetical protein	NA	NA	NA	NA
AVF23873.1\|3862733_3862910_+	hypothetical protein	NA	NA	NA	NA
AVF23874.1\|3863382_3863802_-	putative DNA-binding protein	NA	NA	NA	NA
AVF23875.1\|3864923_3865142_+	hypothetical protein	NA	NA	NA	NA
AVF23876.1\|3865290_3865533_-	hypothetical protein	A0A2I7SCT4	Paenibacillus_phage	1.2e-31	93.8
AVF23877.1\|3865559_3865712_-	N-acetylmuramoyl-l-alanine amidase	NA	NA	NA	NA
AVF23878.1\|3865669_3865921_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7QIN4	Bacillus_phage	2.1e-10	52.0
AVF23879.1\|3865904_3866069_-	hypothetical protein	NA	NA	NA	NA
AVF23880.1\|3866070_3866295_-	hypothetical protein	A0A0C5AEG8	Bacteriophage	2.1e-25	85.7
AVF23881.1\|3866662_3867886_-	putative lethal factor domain protein	NA	NA	NA	NA
AVF23882.1\|3868023_3871050_-	toxin-like protein	A0A1V0E026	Clostridioides_phage	1.7e-88	37.6
AVF23883.1\|3871121_3872372_-	toxin-like protein	NA	NA	NA	NA
AVF23884.1\|3873165_3874695_+	spore germination protein KA	NA	NA	NA	NA
AVF23885.1\|3874691_3875795_+	spore germination protein YndE	NA	NA	NA	NA
AVF23886.1\|3875791_3876286_+	spore germination receptor subunit-like protein	NA	NA	NA	NA
AVF23887.1\|3876552_3877224_+	N-acetylmuramoyl-L-alanine amidase	A0A0K2CXQ8	Paenibacillus_phage	9.5e-130	96.4
AVF23888.1\|3877465_3879241_-	GlcNAc-binding protein A	NA	NA	NA	NA
AVF23889.1\|3879989_3880205_-\|transposase	transposase	NA	NA	NA	NA
AVF23890.1\|3880511_3880880_-	hypothetical protein	NA	NA	NA	NA
AVF23891.1\|3881372_3881774_-	YmaF family protein	NA	NA	NA	NA
AVF23892.1\|3881985_3882111_+	hypothetical protein	NA	NA	NA	NA
AVF23893.1\|3882079_3882547_-	hypothetical protein	NA	NA	NA	NA
AVF23894.1\|3883678_3884902_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVF23895.1\|3885194_3885410_-	hypothetical protein	NA	NA	NA	NA
AVF23896.1\|3885564_3885873_+	helix-turn-helix family protein	O03970	Lactobacillus_phage	1.5e-10	34.1
AVF23897.1\|3885990_3886428_+\|integrase	integrase	A0A0C5AN64	Paenibacillus_phage	1.0e-36	56.8
AVF23898.1\|3886516_3888145_-	60 kDa chaperonin	A0A219YK78	uncultured_virus	8.1e-159	59.1
AVF23899.1\|3888234_3888516_-	10 kDa chaperonin	A0A221S3C8	uncultured_virus	2.4e-18	52.2
AVF23900.1\|3888590_3888845_-	hypothetical protein	NA	NA	NA	NA
AVF23901.1\|3888837_3889644_-	Sec-independent protein translocase protein TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.5e-12	27.7
3894864:3894878	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: CP019651.1|AVF22634.1|2654963_2655233_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: CP019651.1|AVF22635.1|2655247_2655445_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP019651.1|AVF22634.1|2654963_2655233_-|hypothetical-protein

2654963_2655233_-

89 aa aa

HTH_XRE

Identity	Hit_domain_coverage
0.41379310344827586	1.0

2602187-2657900

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP019651_4	Orphan	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	2650347-2650313	0
CP019651_4	Orphan	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	2650347-2650312	0

1. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to CP019651 position: 2650347-2650313, mismatch: 0

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaa	Protospacer
***********************************

2. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to CP019651 position: 2650347-2650312, mismatch: 0

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaat	Protospacer
************************************

CP019651.1|AVF22635.1|2655247_2655445_-|hypothetical-protein

2655247_2655445_-

65 aa aa

HTH_XRE

Identity	Hit_domain_coverage
0.41379310344827586	1.0

2602187-2657900

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP019651_4	Orphan	4.2\|2036399\|35\|CP019651\|CRT,PILER-CR	2036399-2036433	35	2650347-2650313	0
CP019651_4	Orphan	4.7\|2036399\|36\|CP019651\|CRISPRCasFinder	2036399-2036434	36	2650347-2650312	0

1. spacer 4.2|2036399|35|CP019651|CRT,PILER-CR matches to CP019651 position: 2650347-2650313, mismatch: 0

aacaattacaaatatgcaactgaagcagatgtaaa	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaa	Protospacer
***********************************

2. spacer 4.7|2036399|36|CP019651|CRISPRCasFinder matches to CP019651 position: 2650347-2650312, mismatch: 0

aacaattacaaatatgcaactgaagcagatgtaaat	CRISPR spacer
aacaattacaaatatgcaactgaagcagatgtaaat	Protospacer
************************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP019651

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information