CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP019653	Paenibacillus larvae subsp. larvae DSM 25430 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1	0
CP019652	Paenibacillus larvae subsp. larvae DSM 25430 chromosome, complete genome	1 crisprs	cmr1gr7,cas10,cmr3gr5,cmr4gr7,cmr5gr11,cmr6gr7,cas14j,csa3,c2c10_CAS-V-U3,DinG,DEDDh,cas3	2	6	36	1
CP019654	Paenibacillus larvae subsp. larvae DSM 25430 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10304 : 19765

Paenibacillus_phage(66.67%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG14359.1\|10304_11528_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14360.1\|11694_12465_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
AVG14361.1\|12636_13860_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14362.1\|14477_15701_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14363.1\|15743_16079_-	MurPQ operon repressor	NA	NA	NA	NA
AVG14364.1\|16114_16795_-	putative N-acetylmannosamine-6-phosphate 2-epimerase NanE	NA	NA	NA	NA
AVG14365.1\|16799_18332_-	PTS system glucose-specific EIICBA component PtsG	A0A2I7SAJ6	Vibrio_phage	6.5e-09	52.1
AVG14366.1\|18541_19765_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP019652

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP019652_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019652_1

1615730-1616296

Orphan

I-C

Consensus_repeat	Method
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CRT

8 spacers

The CRISPR arrays of CP019652_1

>merge|CP019652|1|1615730-1616296|PILER-CR,CRISPRCasFinder,CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAATTTGTTTCGATGCTATATTTATACGCATCAATAGTCGCATCCTACGCGGATGCGTGGATTGAAATAAGGGAGGGGATTTTCAGACTCAGTTTAGACTATACGTCGCATCCTACGCGGATGCGTGGATTGAAATATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTACGTCGCATCCTACGCGGATGCGTGGATTGAAATACTAGAGCAATGAGCATTAACGGGATTCCAATCAGTCGCATCCTACGCGGATGCGTGGATTGAAATAAGGGAGGGGATTTTCAGACTCAGTTTAGACTATACGTCGCATCCTACGCGGATGCGTGGATTGAAATATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTACGTCGCATCCTACGCGGATGCGTGGATTGAAATACTAGAGCAATGAGCATTAACGGGATTCCAATCAGTCGCATCCTACGCGGATGCGTGGATTGAAATCAATTAAGCCGACCGCCATATAGCGTGGCTATGTCGCATCCTACGCGAATAGTTGAATTGCAAAT

>CP019652|1|1|1615730-1616231|PILER-CR
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TTGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT

>CP019652|1|1|1615730-1616296|CRISPRCasFinder
GTCGCATCCTACGCGGATGCGTGGATTGAAATT	TGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	AGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	TTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	AGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	TTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAATA	CTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAATC	AATTAAGCCGACCGCCATATAGCGTGGCTAT
GTCGCATCCTACGCGAATAGTTGAATTGCAAAT

>CP019652|1|1|1615730-1616295|CRT
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	TTGTTTCGATGCTATATTTATACGCATCAATA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	AAGGGAGGGGATTTTCAGACTCAGTTTAGACTATAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ATTACAGGGGCAGGGAGGTACAGAAGATAGGAGGTAC
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	ACTAGAGCAATGAGCATTAACGGGATTCCAATCA
GTCGCATCCTACGCGGATGCGTGGATTGAAAT	CAATTAAGCCGACCGCCATATAGCGTGGCTAT
GTCGCATCCTACGCGAATAGTTGAATTGCAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP019652.1\|AVG12087.1\|1613141_1614365_-\|transposase	unknown	unknown	gnl\|CDD\|307151
CP019652.1\|AVG12088.1\|1614591_1615224_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	unknown	unknown	gnl\|CDD\|274926
CP019652.1\|AVG12082.1\|1608873_1609083_+\|cyanate-hydratase-CynS	unknown	unknown	gnl\|CDD\|235079
CP019652.1\|AVG12097.1\|1625834_1626326_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225283
CP019652.1\|AVG12095.1\|1620829_1621384_+\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|226614
CP019652.1\|AVG12083.1\|1609331_1609475_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377224
CP019652.1\|AVG12096.1\|1622883_1625832_+\|formate-dehydrogenase,-alpha-subunit	unknown	unknown	gnl\|CDD\|225918
CP019652.1\|AVG12085.1\|1611441_1611636_+\|hypothetical-protein	unknown	unknown	unknown
CP019652.1\|AVG12080.1\|1607375_1608122_+\|glutamine-transport-ATP-binding-protein-GlnQ	unknown	unknown	gnl\|CDD\|224051
CP019652.1\|AVG12092.1\|1618066_1618627_-\|transcriptional-regulator-like-protein	unknown	unknown	gnl\|CDD\|377906
CP019652.1\|AVG12081.1\|1608166_1608589_+\|peroxiredoxin,-OsmC-subfamily	unknown	unknown	gnl\|CDD\|224679
CP019652.1\|AVG12093.1\|1619105_1619462_-\|group-I-intron-endonuclease	unknown	unknown	gnl\|CDD\|198398
CP019652.1\|AVG12094.1\|1619482_1620241_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378279
CP019652.1\|AVG12079.1\|1605807_1606674_+\|cystine-binding-periplasmic-protein	unknown	unknown	gnl\|CDD\|270248
CP019652.1\|AVG12098.1\|1626342_1627146_+\|FdhD-like-protein	unknown	unknown	gnl\|CDD\|234823
CP019652.1\|AVG12086.1\|1611747_1612971_-\|transposase	unknown	unknown	gnl\|CDD\|307151
CP019652.1\|AVG12091.1\|1617676_1617976_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|225511
CP019652.1\|AVG12089.1\|1616566_1616989_-\|transposase-like-protein	unknown	unknown	gnl\|CDD\|222853
CP019652.1\|AVG12084.1\|1609508_1610432_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|131952
CP019652.1\|AVG12090.1\|1617298_1617619_-\|transposase-IS3/IS911-family-protein	unknown	unknown	gnl\|CDD\|379233

Protein	Function_ID	Function_description	E-value
CP019652.1\|AVG12087.1\|1613141_1614365_-\|transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.86261e-144
CP019652.1\|AVG12088.1\|1614591_1615224_+\|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	8.34787e-98
CP019652.1\|AVG12082.1\|1608873_1609083_+\|cyanate-hydratase-CynS	gnl\|CDD\|235079	PRK02866, PRK02866, cyanate hydratase; Validated.	3.98684e-48
CP019652.1\|AVG12097.1\|1625834_1626326_+\|hypothetical-protein	gnl\|CDD\|225283	COG2427, COG2427, Uncharacterized conserved protein [Function unknown].	9.5598e-20
CP019652.1\|AVG12095.1\|1620829_1621384_+\|putative-membrane-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.71031e-17
CP019652.1\|AVG12083.1\|1609331_1609475_-\|hypothetical-protein	gnl\|CDD\|377224	pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily. This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways. This family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins.	0.000424963
CP019652.1\|AVG12096.1\|1622883_1625832_+\|formate-dehydrogenase,-alpha-subunit	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
CP019652.1\|AVG12080.1\|1607375_1608122_+\|glutamine-transport-ATP-binding-protein-GlnQ	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.66551e-144
CP019652.1\|AVG12092.1\|1618066_1618627_-\|transcriptional-regulator-like-protein	gnl\|CDD\|377906	pfam07739, TipAS, TipAS antibiotic-recognition domain. This domain is found at the C-terminus of some MerR family transcription factors. The domain has an alpha-helical globin-like fold. The family includes Mta a central regulator of multidrug resistance in Bacillus subtilis.	2.27409e-09
CP019652.1\|AVG12081.1\|1608166_1608589_+\|peroxiredoxin,-OsmC-subfamily	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	3.01646e-33
CP019652.1\|AVG12093.1\|1619105_1619462_-\|group-I-intron-endonuclease	gnl\|CDD\|198398	cd10451, GIY-YIG_LuxR_like, GIY-YIG domain of LuxR and ArsR family transcriptional regulators, and uncharacterized hypothetical proteins found in bacteria. The family includes some bacterial LuxR and ArsR family transcriptional regulators. The a C-terminal conserved domain shows sequence similarity to the N-terminal catalytic GIY-YIG domains of intron-encoded homing endonucleases. Besides, they have an N-terminally fused transcriptional regulators module, comprising the winged helix-turn-helix (wHTH) domain and uncharacterized domain DUF2087. At this point, they are distinct from GIY-YIG homing endonucleases, which typically contain a variety of C-terminally fused nuclease-associated modular DNA-binding domains (NUMODs). Moreover, some key residues relevant to catalysis in GIY-YIG endonucleases are mutanted or absent in this family, which suggests that members in this family might lose the catalytic function that GIY-YIG endonucleases possess. This family also includes many uncharacterized hypothetical proteins that consist of a standalone GIY-YIG like domain.	1.51975e-40
CP019652.1\|AVG12094.1\|1619482_1620241_-\|hypothetical-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.68649e-28
CP019652.1\|AVG12079.1\|1605807_1606674_+\|cystine-binding-periplasmic-protein	gnl\|CDD\|270248	cd13530, PBP2_peptides_like, Peptide-binding protein and related homologs; type 2 periplasmic binding protein fold. This domain is found in solute binding proteins that serve as initial receptors in the ABC transport, signal transduction and channel gating. The PBP2 proteins share the same architecture as periplasmic binding proteins type 1, but have a different topology. They are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the family includes ionotropic glutamate receptors and unorthodox sensor proteins involved in signal transduction.	7.83243e-79
CP019652.1\|AVG12098.1\|1626342_1627146_+\|FdhD-like-protein	gnl\|CDD\|234823	PRK00724, PRK00724, formate dehydrogenase accessory sulfurtransferase FdhD.	6.36197e-114
CP019652.1\|AVG12090.1\|1617298_1617619_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	5.50062e-07
CP019652.1\|AVG12091.1\|1617676_1617976_-\|transposase-IS3/IS911-family-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.000117275
CP019652.1\|AVG12084.1\|1609508_1610432_+\|serine/threonine-protein-kinase	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9198e-15
CP019652.1\|AVG12089.1\|1616566_1616989_-\|transposase-like-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	6.79061e-06
CP019652.1\|AVG12086.1\|1611747_1612971_-\|transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.525e-144

>CP019652.1|AVG12088.1|1614591_1615224_+|pyridoxamine-5'-phosphate-oxidase,-FMN-binding-family
MNLCFQDVLTEEKQVRELIGNSSEVAKHKSIHHIDSYCREFIAKTPLIFISTSDKEGNCDVSPRGDAAGFVLVLDDKHLVIPERPGNRRIDSVRNILSSPRIGLIFLIPGLEETLRINGRACITKNPELMNRMQAREKTPLLGIGVEVEECYVHCAKAFKRSQTWEAGSWLNQDLLPKVSKMLVAHVNREDFTEEIIAKGLKESYEKRLY
>CP019652.1|AVG12087.1|1613141_1614365_-|transposase
MAQYQINVDSQLLHQLFLGNSQDAGVAKLLESVLNQVLQAQVSEQVEADRYERTENRKAYRNGSYPHGLHTRVGTITLSVPRIRGGKFTTELFSRYQRSEQALILAMMEMVVNGVSTRKVSQVTEELCGTEFSKSTVSDLCKRLDPIVTAWNNRSLADSLFPFVLVDAMYLKVREDGRVRSRGIMIAIGVNTEGYREVLGLMLGDTESEASWSEFFSSLKGRGLRGVDLITSDDHGGLVRAVRQQLQGVTWQRCQTHFTRNVLEASPKALKDEIHGRLRSILDAPDTGTARFLLKQTLAAYEDKAGKAMGVLESGFDDATAVLMLPERYRKRLRTTNSVERLNEEVRRRERVIRIFPNRESVIRLIGALLMEQDEKWAAGKKYLDMTEYMEWRKDRPKSDAKVTRIM
>CP019652.1|AVG12086.1|1611747_1612971_-|transposase
MAQYQINVDSQLLHQLFLGNSQDAGVAKLLESVLNQVLQAQVSEQVEADRYERTENRKAYRNGSYPHGLHTRVGTITLSVPRIRGGKFTTELFSRYQRSEQALILAMMEMVVNGVSTRKVSQVTEELCGTEFSKSTVSDLCKRLDPIVTAWNNRSLADSLFPFVLVDAMYLKVREDGRVRSRGIMIAIGVNTEGYREVLGLMLGDTESEASWSEFFSSLKGRGLRGVDLITSDDHGGLVRAVRQQLQGVTWQRCQTHFTRNVLEASPKALKDEIHGRLRSILDAPDTGTARFLLKQTLAAYEDKAGKAMGVLESGFDDATAVLMLPERYRKRLRTTNSVERLNEEVRRRERVICIFPNRESVIRLIGALLMEQDEKWAAGKKYLDMTEYMEWRKDRPKSDAKVTRIM
>CP019652.1|AVG12085.1|1611441_1611636_+|hypothetical-protein
MFELIASGISAGNAAQVINAVFNGLSIVSALSLCAGIAGGAAWFLSNGIGYMIKWAGKKTIIDW
>CP019652.1|AVG12084.1|1609508_1610432_+|serine/threonine-protein-kinase
MNRPVGNIRAFRLSTDKGDFLVKPFSRRKTGPKLTTREQITRLSSYIQKLKESGYPHLPNWLVTKSGQYWVSHNGRPYYMTDWVEGSGIQSEEDYENLGRALATLHNNCKDSLPSMSRYTYKQTKLFKLQDQLFRLQLLTIRRNKSKGKWFREHGGLCIELANKSWSILRKPETKQIMEEEINHPALIHGDVTLPNIIIHPSRPFLIDWDLLRMGSTYYETAKTLLNTTNFDPANISALIKGYEQIKGLTPAERLLISAFFRLPVEAWRSARRIASGRRSPVFHILSRTWEKNLVPYDGWMNGHGNN
>CP019652.1|AVG12083.1|1609331_1609475_-|hypothetical-protein
MHLWHHFKNEQYWYGVTNPVFDLTLHTYKDGKEVEKSGTTRNMEKLE
>CP019652.1|AVG12082.1|1608873_1609083_+|cyanate-hydratase-CynS
MPPTDPLLYRFYEILLVYGPGMKEIIHEKFGDGIMSAIDFEMDIKRVPDPKGDRVLMMLNGKFLPYKKF
>CP019652.1|AVG12081.1|1608166_1608589_+|peroxiredoxin,-OsmC-subfamily
MKVTTTWQGKRAFTSVGPSGYSVTMDATAAYGGDGKGATPMELILAGLAGCMGIDITMILRSTLDTIQSIEIEAEGTRDEEPPKGFTAIDLVFKINGDVPDHRIWRAIELGKEKYCAVSDSLKADIRYKLILNGKEAVKP
>CP019652.1|AVG12080.1|1607375_1608122_+|glutamine-transport-ATP-binding-protein-GlnQ
MIQTAGLTKSFQDTVVLKDINLQVKQNEIVVLLGPSGSGKSTLLRCINGLEELSGGTVEVNGIHIDAKMPARQRRARILEIRRETGMVFQQFNLYPHKTALGNVIESLLVVKKMRREEALKIGEQLLDRVGLADKKDVYPSRLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPELVGEVLDVMQQLAKDGMTMLVVTHEMKFARKVADRIVFMDAGIIVEEADPDAFFESPQSERARKFLKILDHE
>CP019652.1|AVG12079.1|1605807_1606674_+|cystine-binding-periplasmic-protein
MKNKPRKSLILVLAAFLLVALALSGCGSSARDQAGSTPGVSDNTGNKNSRTLEQIKQSGVLKVGIMGTYAPYNFLNDKKEMDGFDADIAKEIAKKMGLKAEFVSQEFSGMIAGLQAGKFDTVISQMTITEDRQKQMDFTEPYITNQVKVIVKQDNNSITKLEDFKGKNIGVGLGTNDEAYLRNEALPKVGNFTIKTYDDVITSLQDLNNGRIDATINNMYALKPIVEKNGFKIKVVGEAVKSDKAAIAVTKGNTELRDALNQALKDLKADGTYKTIFTKWFCEEPPAE
>CP019652.1|AVG12089.1|1616566_1616989_-|transposase-like-protein
MIRRSRKKYASSTPQHVAENLLNREFAATKPNEKWVTDGNGIQIWSRSKGVFKRRFRLLWQYDCCLTFSGTPTIIASCFKPSTRRYKRHRAAGPCCIVTGAFNIPRKNSKRSWRKETSCRACLKLADVSIMAPWNPSGEP
>CP019652.1|AVG12090.1|1617298_1617619_-|transposase-IS3/IS911-family-protein
MTKGRKTTWQERLEIVQYCLTHNQDYRKTAEQYQASCQQVYQWVKKYQDGGQEALQDGRGRKKAEEELTDADRQKLAMKKMEAEIERLRAENALLKKLEELERRGR
>CP019652.1|AVG12091.1|1617676_1617976_-|transposase-IS3/IS911-family-protein
MSKVQYNAKEKFAMIEEIESGELGLMGVAYKYGISKSTLVKWRRRYDVYGLEGLEVRTKNRSYSAELKLQAVLDYLKGELSQCDIIHKYKIASRTQLSN
>CP019652.1|AVG12092.1|1618066_1618627_-|transcriptional-regulator-like-protein
MEKIKQLLEGESRLGILSDQKDLLLARKQRLDRLIQTLDESIESVVKGEVMDQSSMFKGFEGEQKWKNALAEHKEYLKETYGLDILEDRPIDVKDMNEKASRADRFMEEMAKALKAGMKFDDETVRGLIREHIDFLNQNVHATSAEDFALQARFFLDDDFHRNIMESRQTGLAYYLFTAAESYAVK
>CP019652.1|AVG12093.1|1619105_1619462_-|group-I-intron-endonuclease
MSRINKEHRAELQQAYKELKKRAAVYQIRNTMNGKLFIDSTLNLKTLNGEKFMLNMGTHNNRSLQQEWKEFGEDAFVFEVLEELKKPENEYVDIKDELKKLKDKWLGQVQPYGEKGYN
>CP019652.1|AVG12094.1|1619482_1620241_-|hypothetical-protein
MENPDLFWGSSLKELKQGYRELETHFVCILCGRAVEKGVIYQEYGIFYEAERFTRLHIEHTHGSVFDYLIQLDKKLTGLTDHQSSLLRLFYQGKNDSQIQQELGIGSVSTIRNHRFVLKEKERQAKVFLTMMELLKEKDRHAPEFVPLDPSAKMVDDRYNITKEENEKLLHKYFPEGTDGPLTSFRSLQEKHKLVVLKEMIKRFESGKIYTEKEVNRILAAAYEDYAILRRYLIEYRFLDRKPDGSQYWKKD
>CP019652.1|AVG12095.1|1620829_1621384_+|putative-membrane-protein
MHKTATIYQSFITFLHKIGFSMLVFKTALAAAISWWIALLFTPEYPPYLAPIAAVLIVNITVASTLIKAFYRIVGVIYGVLINLLIGSLVSNSTIAIFLSVLLGTALTSAFRLNNQIVSQVGVSAVMALAFLKTPYYGWGRIAETILGCLVAILVNVVIAPSNNLPKAARSIRKLSEISSNQIH
>CP019652.1|AVG12096.1|1622883_1625832_+|formate-dehydrogenase,-alpha-subunit
METVKFQLNGEEHETAEGTRILDFLLELGKDHPHICYSPITGPIQSCDTCMCEADGKLVRACSTTLKPGMRIRTSSEKAQIAQKEAMDRILENHMLYCTVCDNNNGNCKVHNTTEMLGIEHQSRPFRPKGYKKDMSNPFYRYDPDQCILCGRCVEACQDLQVNETLSIDWEREIPRVIWDDDKAINESSCVSCGHCVTVCPCNALMEKTMLGEAGFLTGMSEGLMNPMIDLVKAVEPGYSGIFAVSEMEAALRETRTKKTKTVCTFCGVGCSFEVWTKDRVILKIEPNEQAPVNSISTCVKGKFGWDFVNSDQRLTAPLIRRGDQFVPAGWDEAIDYIAERLGRIKEEHGGNALSFVASSKTTNEDTYLMQKLARQVFETNNVDNCSRYCQSPASDGLQNTVGYGGDSGTIRDIEQAGLVIIVGANSAEAHPVLATRVKRAHKLRGQKLIVADLHKHEMAERADLFIRPKQGTDFVWLTALAKYILDQGWHDEAFLRERVNNREEYEQMIEKYTISYAEKITGIPGEQLIQTAKMICEASGTCILWGMGVTQNVGGSHTSAAISNLLLVTGNYGRTGTGAYPLRGHNNVQGACDMGALPQWLPGYQKLADDEVRQKFEKAYGVRISPEPGLTNVGMVEAIHEGRLKGMYLMGEDMVWVDSNSNNVQEALAKLDFFVVQDVFLTKTAQFADVVLPACPSLEKDGTFTNTERRIQRLYRALEPLGDSKPDWWIIQQLANRMGANWAYKHPGDVMDEIASLVPTFAGVRYSRLEHWNSQHWPVREDGTDEPLLYTQRFNFPDGKARLSTAEYIPPVGYPSDFDLIVNNGRLLEHFHETNLTGKSKGINYKLPSVFVEISSELAGKRGLEDGSLVRLVSPYGSIKLHVLVTDRVEGNHIYVPMHSHSHENAINILSGNAVDMKTSTPAYKQTRARMEIIQKEGISPLPRHNHRFARRRPQTGVQVERKWERQDYEPIADVNVNGGQ
>CP019652.1|AVG12097.1|1625834_1626326_+|hypothetical-protein
MAKSITTITEPVLSEKEANEKAWAEVLEELSRNSEGLRSYIRLLQELHESGIMDTMKAALQSKEELAKVIVKEMNKPNNTNTINNLMAMAGTLSMLDSDVVKKMASSVSTGFHKAREENQTEEKIGLFDLMKALKDPDINRAVRFGLNFLKGMGQSLGEKGEK
>CP019652.1|AVG12098.1|1626342_1627146_+|FdhD-like-protein
MGLPVQITRRILRVQGNEAEKTEDQIVTEYPLTLVLNDREFATLVCTPEHLEELVAGFLCSEGAISGFEDIDDLAIDENTGFAYIKAAQTRPFYEQFHSKRVISSCCGKSRQSFYFHNDRHTVKKIPESGLSIRVEECFRLMEQMQEAARTFRLTGGVHNAALCDRKGVLLFRMDIGRHNALDKIYGHCLMHQIPLHDKIMVFSGRLSSEVLLKTARIGCGIVLSKSAPTQLALDLAEELNITTVGFLRHHTFNIYTGLKRIELGHI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP019652_1	1.1\|1615762\|32\|CP019652\|PILER-CR,CRT	1615762-1615793	32	CP019652.1	2659342-2659373	1	0.969
CP019652_1	1.8\|1615763\|31\|CP019652\|CRISPRCasFinder	1615763-1615793	31	CP019652.1	2659343-2659373	1	0.968

1. spacer 1.1|1615762|32|CP019652|PILER-CR,CRT matches to position: 2659342-2659373, mismatch: 1, identity: 0.969

ttgtttcgatgctatatttatacgcatcaata	CRISPR spacer
ttgtttcgatgctatatttgtacgcatcaata	Protospacer
*******************.************

2. spacer 1.8|1615763|31|CP019652|CRISPRCasFinder matches to position: 2659343-2659373, mismatch: 1, identity: 0.968

tgtttcgatgctatatttatacgcatcaata	CRISPR spacer
tgtttcgatgctatatttgtacgcatcaata	Protospacer
******************.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP019652_1	1.3\|1615894\|37\|CP019652\|PILER-CR,CRT	1615894-1615930	37	KT361653	Paenibacillus phage Paisley, complete genome	41256-41292	0	1.0
CP019652_1	1.3\|1615894\|37\|CP019652\|PILER-CR,CRT	1615894-1615930	37	NC_028746	Paenibacillus phage Harrison, complete genome	41333-41369	0	1.0
CP019652_1	1.6\|1616097\|37\|CP019652\|PILER-CR,CRT	1616097-1616133	37	KT361653	Paenibacillus phage Paisley, complete genome	41256-41292	0	1.0
CP019652_1	1.6\|1616097\|37\|CP019652\|PILER-CR,CRT	1616097-1616133	37	NC_028746	Paenibacillus phage Harrison, complete genome	41333-41369	0	1.0
CP019652_1	1.10\|1615895\|36\|CP019652\|CRISPRCasFinder	1615895-1615930	36	KT361653	Paenibacillus phage Paisley, complete genome	41257-41292	0	1.0
CP019652_1	1.10\|1615895\|36\|CP019652\|CRISPRCasFinder	1615895-1615930	36	NC_028746	Paenibacillus phage Harrison, complete genome	41334-41369	0	1.0
CP019652_1	1.13\|1616098\|36\|CP019652\|CRISPRCasFinder	1616098-1616133	36	KT361653	Paenibacillus phage Paisley, complete genome	41257-41292	0	1.0
CP019652_1	1.13\|1616098\|36\|CP019652\|CRISPRCasFinder	1616098-1616133	36	NC_028746	Paenibacillus phage Harrison, complete genome	41334-41369	0	1.0
CP019652_1	1.15\|1616233\|31\|CP019652\|CRISPRCasFinder	1616233-1616263	31	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35867-35897	2	0.935
CP019652_1	1.15\|1616233\|31\|CP019652\|CRISPRCasFinder	1616233-1616263	31	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29492-29522	2	0.935
CP019652_1	1.15\|1616233\|31\|CP019652\|CRISPRCasFinder	1616233-1616263	31	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30453-30483	2	0.935
CP019652_1	1.15\|1616233\|31\|CP019652\|CRISPRCasFinder	1616233-1616263	31	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30454-30484	2	0.935
CP019652_1	1.16\|1616232\|32\|CP019652\|CRT	1616232-1616263	32	NZ_CP020329	Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence	35866-35897	3	0.906
CP019652_1	1.16\|1616232\|32\|CP019652\|CRT	1616232-1616263	32	NZ_CP019796	Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence	29491-29522	3	0.906
CP019652_1	1.16\|1616232\|32\|CP019652\|CRT	1616232-1616263	32	NZ_CP019661	Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence	30452-30483	3	0.906
CP019652_1	1.16\|1616232\|32\|CP019652\|CRT	1616232-1616263	32	NZ_CP019658	Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence	30453-30484	3	0.906
CP019652_1	1.15\|1616233\|31\|CP019652\|CRISPRCasFinder	1616233-1616263	31	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18377-18407	4	0.871
CP019652_1	1.16\|1616232\|32\|CP019652\|CRT	1616232-1616263	32	NZ_CP019720	Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence	18376-18407	5	0.844

1. spacer 1.3|1615894|37|CP019652|PILER-CR,CRT matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

2. spacer 1.3|1615894|37|CP019652|PILER-CR,CRT matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

3. spacer 1.6|1616097|37|CP019652|PILER-CR,CRT matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

4. spacer 1.6|1616097|37|CP019652|PILER-CR,CRT matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

attacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
attacaggggcagggaggtacagaagataggaggtac	Protospacer
*************************************

5. spacer 1.10|1615895|36|CP019652|CRISPRCasFinder matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

6. spacer 1.10|1615895|36|CP019652|CRISPRCasFinder matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

7. spacer 1.13|1616098|36|CP019652|CRISPRCasFinder matches to KT361653 (Paenibacillus phage Paisley, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

8. spacer 1.13|1616098|36|CP019652|CRISPRCasFinder matches to NC_028746 (Paenibacillus phage Harrison, complete genome) position: , mismatch: 0, identity: 1.0

ttacaggggcagggaggtacagaagataggaggtac	CRISPR spacer
ttacaggggcagggaggtacagaagataggaggtac	Protospacer
************************************

9. spacer 1.15|1616233|31|CP019652|CRISPRCasFinder matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

10. spacer 1.15|1616233|31|CP019652|CRISPRCasFinder matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

11. spacer 1.15|1616233|31|CP019652|CRISPRCasFinder matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

12. spacer 1.15|1616233|31|CP019652|CRISPRCasFinder matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.935

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaagccgaccgccatatagcgcggctat	Protospacer
* **********************.******

13. spacer 1.16|1616232|32|CP019652|CRT matches to NZ_CP020329 (Paenibacillus larvae subsp. pulvifaciens strain CCM 38 plasmid pPLP2.1, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

14. spacer 1.16|1616232|32|CP019652|CRT matches to NZ_CP019796 (Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 plasmid pPLP2, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

15. spacer 1.16|1616232|32|CP019652|CRT matches to NZ_CP019661 (Paenibacillus larvae subsp. larvae strain Eric_IV plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

16. spacer 1.16|1616232|32|CP019652|CRT matches to NZ_CP019658 (Paenibacillus larvae subsp. larvae strain Eric_III plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.906

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
tacttaagccgaccgccatatagcgcggctat	Protospacer
.* **********************.******

17. spacer 1.15|1616233|31|CP019652|CRISPRCasFinder matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.871

aattaagccgaccgccatatagcgtggctat	CRISPR spacer
cttaaagccgaccgccatatagcgcggctat	Protospacer
  * ********************.******

18. spacer 1.16|1616232|32|CP019652|CRT matches to NZ_CP019720 (Paenibacillus larvae subsp. larvae strain Eric_V plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

caattaagccgaccgccatatagcgtggctat	CRISPR spacer
acttaaagccgaccgccatatagcgcggctat	Protospacer
   * ********************.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

115570 : 175933

Paenibacillus_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10602.1\|115570_116794_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG10603.1\|117052_117349_+	S-layer protein	NA	NA	NA	NA
AVG10604.1\|118104_120612_+	protein translocase subunit SecA	NA	NA	NA	NA
AVG10605.1\|120773_121772_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.9e-05	38.7
AVG10606.1\|121847_122720_+	putative membrane protein	M1Q1P6	Streptococcus_phage	7.7e-31	32.0
AVG10607.1\|122949_124011_+	N-acetyl-gamma-glutamyl-phosphate reductase ArgC	NA	NA	NA	NA
AVG10608.1\|124084_125311_+	arginine biosynthesis bifunctional protein ArgJ	NA	NA	NA	NA
AVG10609.1\|125368_126163_+	acetylglutamate kinase ArgB	NA	NA	NA	NA
AVG10610.1\|126216_127416_+	acetylornithine aminotransferase ArgD	A0A1V0SKB7	Klosneuvirus	2.1e-31	27.9
AVG10611.1\|127434_128394_+	ornithine carbamoyltransferase ArgF	Q84489	Paramecium_bursaria_Chlorella_virus	1.0e-23	29.2
AVG10612.1\|128419_129646_+	argininosuccinate synthase ArgG	NA	NA	NA	NA
AVG10613.1\|129733_131143_+	argininosuccinate lyase ArgH	NA	NA	NA	NA
AVG10614.1\|131317_132769_-	putative vancomycin resistance protein	NA	NA	NA	NA
AVG10615.1\|133180_133873_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	6.5e-25	34.5
AVG10616.1\|133862_134783_+	cell division protein FtsX	NA	NA	NA	NA
AVG10617.1\|134935_136207_+	cell wall endopeptidase, family M23/M37	A0A075BS18	Microcystis_phage	2.9e-18	47.4
AVG10618.1\|136307_137741_+\|protease	carboxy-terminal processing protease CtpB	A0A0R6PIZ1	Moraxella_phage	2.1e-25	29.7
AVG10619.1\|137879_139166_+	cell division topological determinant MinJ	NA	NA	NA	NA
AVG10620.1\|139814_140588_-	putative flagellar motor protein	NA	NA	NA	NA
AVG10621.1\|140562_141360_-	motility protein A	NA	NA	NA	NA
AVG10622.1\|141611_143606_+	UvrABC system protein B	NA	NA	NA	NA
AVG10623.1\|143791_146674_+	UvrABC system protein A	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	58.2
AVG10624.1\|146925_147381_+	hypothetical protein	NA	NA	NA	NA
AVG10625.1\|147472_149089_-	ferredoxin--nitrite reductase NirA	NA	NA	NA	NA
AVG10626.1\|149331_149532_+	hypothetical protein	NA	NA	NA	NA
AVG10627.1\|149723_150692_-	AP endonuclease, family 2	NA	NA	NA	NA
AVG10628.1\|153276_154782_+\|protease	putative protease YrrO	Q6DW11	Phage_TP	2.3e-27	33.3
AVG10629.1\|155531_155855_+	SPBc2 prophage-derived uncharacterized protein YolA precursor	NA	NA	NA	NA
AVG10630.1\|155969_157193_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10631.1\|157431_158718_-	adenylosuccinate ligase PurA	A0A160ER07	Powai_lake_megavirus	3.2e-73	37.0
AVG10632.1\|158878_160240_-	replicative DNA helicase DnaC	A0A1P8VVQ6	Streptococcus_phage	8.4e-117	50.2
AVG10633.1\|160264_160711_-	50S ribosomal protein L9	NA	NA	NA	NA
AVG10634.1\|160707_162663_-	DHHA1 domain protein	NA	NA	NA	NA
AVG10635.1\|162680_163598_-	putative membrane protein	NA	NA	NA	NA
AVG10636.1\|164002_164338_-	hypothetical protein	NA	NA	NA	NA
AVG10637.1\|164516_165740_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8
AVG10638.1\|165922_166198_+	hypothetical protein	A0A0K2CYS5	Paenibacillus_phage	5.8e-25	66.7
AVG10639.1\|166423_167086_+	hypothetical protein	NA	NA	NA	NA
AVG10640.1\|167387_168635_+	peptidase, M23 family	A0A7K9	Microcystis_virus	1.2e-16	44.5
AVG10641.1\|168869_169589_+	transcriptional regulatory protein WalR	W8CYM9	Bacillus_phage	1.2e-37	37.5
AVG10642.1\|169589_171416_+	sensor histidine kinase YycG	A0A1V0SGX0	Hokovirus	3.0e-24	26.6
AVG10643.1\|171412_172726_+	Two-component system YycF/YycG regulatory protein YycH	NA	NA	NA	NA
AVG10644.1\|172758_173526_+	YycH protein	NA	NA	NA	NA
AVG10645.1\|173572_174379_+	putative metallo-hydrolase YycJ	A0A2I7SDH3	Paenibacillus_phage	1.3e-40	36.1
AVG10646.1\|174347_174557_-	hypothetical protein	NA	NA	NA	NA
AVG10647.1\|174724_175933_+\|protease	putative serine protease YyxA	A0A1B1IRD3	uncultured_Mediterranean_phage	1.2e-10	28.4

DBSCAN-SWA_2

181569 : 240649

Paenibacillus_phage(21.43%)

holin,transposase,integrase

attL 179706:179722|attR 190597:190613

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
179706:179722	attL	NA	NA	NA	NA
AVG10654.1\|181569_181704_-\|integrase	phage integrase family protein	NA	NA	NA	NA
AVG10655.1\|182027_183251_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10656.1\|183976_185173_+	processive diacylglycerol glucosyltransferase UgtP	NA	NA	NA	NA
AVG10657.1\|185400_185784_-	putative MFS-type transporter YdgK	NA	NA	NA	NA
AVG10658.1\|186041_186740_-\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
AVG10659.1\|186797_187253_-\|holin	antiholin-like protein LrgA	NA	NA	NA	NA
AVG10660.1\|187394_188141_-	sensory transduction protein LytT	NA	NA	NA	NA
AVG10661.1\|188133_189900_-	sensor protein LytS	Q9EYF3	Enterobacteria_phage	4.6e-75	32.9
AVG10662.1\|189901_190462_-	Acetyltransferase YpeA	NA	NA	NA	NA
AVG10663.1\|190577_191600_-	tagatose 1,6-diphosphate aldolase	NA	NA	NA	NA
190597:190613	attR	NA	NA	NA	NA
AVG10664.1\|192179_192980_-	1,4-dihydroxy-2-naphthoate octaprenyltransferase	NA	NA	NA	NA
AVG10665.1\|193069_193498_-	transporter, EamA family	NA	NA	NA	NA
AVG10666.1\|193902_194880_+	putative oxidoreductase YajO	NA	NA	NA	NA
AVG10667.1\|194981_195164_-	hypothetical protein	NA	NA	NA	NA
AVG10668.1\|195485_196724_+	peptidase T	NA	NA	NA	NA
AVG10669.1\|196807_197245_-	hypothetical protein	NA	NA	NA	NA
AVG10670.1\|197425_197863_-	hypothetical protein	NA	NA	NA	NA
AVG10671.1\|198172_199453_+	methyltransferase-like protein	A0A1C9C5J0	Heterosigma_akashiwo_virus	3.8e-42	29.5
AVG10672.1\|199449_199989_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.8e-23	34.4
AVG10673.1\|199985_200909_+	NAD-dependent epimerase/dehydratase family protein	M1H4P8	Acanthocystis_turfacea_Chlorella_virus	3.0e-17	27.4
AVG10674.1\|200905_201928_+	Methyltransferase domain protein	NA	NA	NA	NA
AVG10675.1\|202109_202877_+	cephalosporin hydroxylase family protein	NA	NA	NA	NA
AVG10676.1\|202895_203618_+	hypothetical protein	NA	NA	NA	NA
AVG10677.1\|203648_204302_+	hypothetical protein	NA	NA	NA	NA
AVG10678.1\|204351_205122_+	glucose-1-phosphate cytidylyltransferase RfbF	NA	NA	NA	NA
AVG10679.1\|205106_206213_+	CDP-glucose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	6.4e-14	25.8
AVG10680.1\|206276_207326_-	putative glycosyltransferase WscE	NA	NA	NA	NA
AVG10681.1\|207285_208008_-	hypothetical protein	NA	NA	NA	NA
AVG10682.1\|208189_209047_+	methyltransferase type 11	NA	NA	NA	NA
AVG10683.1\|209095_209776_+	hypothetical protein	NA	NA	NA	NA
AVG10684.1\|209790_210615_+	hypothetical protein	NA	NA	NA	NA
AVG10685.1\|210675_211443_-	methyltransferase, FkbM family	NA	NA	NA	NA
AVG10686.1\|211667_212801_+	glycosyl transferase family 2	NA	NA	NA	NA
AVG10687.1\|212805_213927_+	glycosyltransferase, group 1 family protein	NA	NA	NA	NA
AVG10688.1\|214009_215536_-	phage-related pre-neck appendage-like protein	A0A1W6JQM0	Staphylococcus_phage	6.9e-19	37.4
AVG10689.1\|215719_216853_+	glycosyltransferase-like protein	A0A1V0SAH6	Catovirus	5.7e-10	40.2
AVG10690.1\|216714_217485_-	putative 8-amino-7-oxononanoate synthase BioF	NA	NA	NA	NA
AVG10691.1\|217638_218862_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
AVG10692.1\|219066_220227_+	ABC-2 family transporter protein	NA	NA	NA	NA
AVG10693.1\|220287_221124_+	ABC-type multidrug transport system, ATPase component	A0A2H4PQG7	Staphylococcus_phage	1.1e-21	33.3
AVG10694.1\|221480_222179_+	heptaprenylglyceryl phosphate synthase PcrB	NA	NA	NA	NA
AVG10695.1\|222327_224658_+	ATP-dependent DNA helicase PcrA	A7KV33	Bacillus_phage	3.4e-134	41.9
AVG10696.1\|224746_226768_+	DNA ligase LigA	Q332J4	Clostridium_botulinum_C_phage	6.9e-99	35.3
AVG10697.1\|232890_233208_-	hypothetical protein	NA	NA	NA	NA
AVG10698.1\|233295_234873_-	putative glucose dehydrogenase	NA	NA	NA	NA
AVG10699.1\|234865_235462_-	hypothetical protein	NA	NA	NA	NA
AVG10700.1\|235467_235860_-	hypothetical protein	NA	NA	NA	NA
AVG10701.1\|236048_236954_+	putative undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase TagO	NA	NA	NA	NA
AVG10702.1\|237035_238142_+	lipoyl synthase-like protein	NA	NA	NA	NA
AVG10703.1\|238240_239362_+	maltodextrin import ATP-binding protein MsmX	Q6GZ03	Mycoplasma_phage	2.7e-20	32.3
AVG10704.1\|239425_240649_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_3

264761 : 311221

Paenibacillus_phage(36.36%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10734.1\|264761_265985_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10735.1\|266278_266860_-\|protease	ATP-dependent Clp protease proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	7.4e-54	57.6
AVG10736.1\|267395_268424_+	central glycolytic genes regulator	NA	NA	NA	NA
AVG10737.1\|268480_269485_+	glyceraldehyde-3-phosphate dehydrogenase Gap	NA	NA	NA	NA
AVG10738.1\|269623_270805_+	phosphoglycerate kinase Pgk	NA	NA	NA	NA
AVG10739.1\|270826_271579_+	triosephosphate isomerase TpiA	NA	NA	NA	NA
AVG10740.1\|271580_273119_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AVG10741.1\|273275_274568_+	enolase Eno	W6LP63	Streptococcus_phage	1.1e-171	71.9
AVG10742.1\|274636_275350_+	hypothetical protein	NA	NA	NA	NA
AVG10743.1\|275482_275719_+	Preprotein translocase band 1 subunit	NA	NA	NA	NA
AVG10744.1\|276006_278511_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.5e-92	40.9
AVG10745.1\|279094_279574_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	8.2e-43	54.5
AVG10746.1\|280522_280963_-	hypothetical protein	NA	NA	NA	NA
AVG10747.1\|282818_283202_+	hypothetical protein	NA	NA	NA	NA
AVG10748.1\|283306_284530_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10749.1\|288553_289423_-	catechol-2,3-dioxygenase	NA	NA	NA	NA
AVG10750.1\|289450_291073_+	putative cardiolipin synthase	NA	NA	NA	NA
AVG10751.1\|291294_292518_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10752.1\|292652_293048_+	hypothetical protein	NA	NA	NA	NA
AVG10753.1\|293341_294367_+	O-demethylpuromycin-O-methyltransferase DmpM	NA	NA	NA	NA
AVG10754.1\|294493_295333_-	penicillin-binding protein 1F	NA	NA	NA	NA
AVG10755.1\|295624_296641_+	mannose-1-phosphate guanylyltransferase RfbM	NA	NA	NA	NA
AVG10756.1\|296688_297642_+	putative GDP-mannose 4,6-dehydratase	J7Q7J8	Aeropyrum_coil-shaped_virus	2.7e-53	34.0
AVG10757.1\|297642_298695_+	glycosyltransferase	NA	NA	NA	NA
AVG10758.1\|298827_299034_-	putative cold-inducible protein	NA	NA	NA	NA
AVG10759.1\|299129_299330_-	cold shock-like protein CspLB	Q9AZD3	Lactococcus_phage	6.9e-20	70.8
AVG10760.1\|300180_300405_+	4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase	NA	NA	NA	NA
AVG10761.1\|300349_301012_+	4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase KduI	NA	NA	NA	NA
AVG10762.1\|301050_301815_+	putative HTH-type transcriptional regulator YulB	A0A077SK06	Escherichia_phage	9.5e-17	31.2
AVG10763.1\|301849_302599_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	NA	NA	NA	NA
AVG10764.1\|302676_303981_-	xanthine permease PbuX	NA	NA	NA	NA
AVG10765.1\|303973_304588_-	xanthine phosphoribosyltransferase Xpt	NA	NA	NA	NA
AVG10766.1\|305079_308217_+	glycosyl hydrolase, family 5	NA	NA	NA	NA
AVG10767.1\|308615_309188_+	meso-diaminopimelate D-dehydrogenase Ddh	NA	NA	NA	NA
AVG10768.1\|309326_309965_-\|transposase	putative transposase	NA	NA	NA	NA
AVG10769.1\|309997_311221_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	6.2e-228	99.8

DBSCAN-SWA_4

365885 : 593163

228

Paenibacillus_phage(44.44%)

protease,tRNA,coat,bacteriocin,integrase,transposase

attL 353644:353658|attR 469035:470424

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
353644:353658	attL	NA	NA	NA	NA
AVG10816.1\|365885_366764_+\|protease	chaperone-like protein/protease-like protein	NA	NA	NA	NA
353644:353658	attL	NA	NA	NA	NA
AVG10817.1\|366779_367289_+	putative ribosomal-protein-alanine acetyltransferase RimI	NA	NA	NA	NA
AVG10818.1\|367310_368330_+\|tRNA	putative tRNA threonylcarbamoyladenosine biosynthesis protein Gcp	A0A0R6PI74	Moraxella_phage	4.3e-65	39.7
AVG10819.1\|368462_369044_-	Glycerate 2-kinase	NA	NA	NA	NA
AVG10820.1\|369075_369603_-	Glycerate kinase	W6LM47	Streptococcus_phage	9.7e-13	52.8
AVG10821.1\|370041_370383_-	carbohydrate diacid transcriptional activator CdaR	NA	NA	NA	NA
AVG10822.1\|370342_370456_-	Sugar diacid regulator	NA	NA	NA	NA
AVG10823.1\|370670_370820_+	hypothetical protein	NA	NA	NA	NA
AVG10824.1\|371092_372109_+	peptidase U61 LD-carboxypeptidase A	NA	NA	NA	NA
AVG10825.1\|372204_374136_-	putative ABC transporter ATP-binding protein YdiF	A0A2K9L3Z8	Tupanvirus	1.5e-58	30.7
AVG10826.1\|374188_374305_+	hypothetical protein	NA	NA	NA	NA
AVG10827.1\|374416_375046_+	5-formyltetrahydrofolate cyclo-ligase-like protein	NA	NA	NA	NA
AVG10828.1\|375104_375557_+	molybdenum cofactor biosynthesis protein C	NA	NA	NA	NA
AVG10829.1\|375575_376067_+	molybdopterin adenylyltransferase Mog	NA	NA	NA	NA
AVG10830.1\|376063_377074_+	molybdene to molybdopterin ligation enzyme-like protein	NA	NA	NA	NA
AVG10831.1\|377105_377369_+	twin-arginine translocation protein, TatA/E family subunit	NA	NA	NA	NA
AVG10832.1\|377368_378175_+	Sec-independent protein translocase protein TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.5e-12	27.7
AVG10833.1\|378167_378422_+	hypothetical protein	NA	NA	NA	NA
AVG10834.1\|378496_378778_+	10 kDa chaperonin	A0A221S3C8	uncultured_virus	2.4e-18	52.2
AVG10835.1\|378867_380496_+	60 kDa chaperonin	A0A219YK78	uncultured_virus	1.4e-158	59.1
AVG10836.1\|380584_380920_-\|integrase	integrase	A0A0C5AN64	Paenibacillus_phage	2.8e-29	61.4
AVG10837.1\|381033_381147_-	hypothetical protein	NA	NA	NA	NA
AVG10838.1\|381139_381448_-	helix-turn-helix family protein	O03970	Lactobacillus_phage	1.5e-10	34.1
AVG10839.1\|381602_381818_+	hypothetical protein	NA	NA	NA	NA
AVG10840.1\|381732_382206_-	hypothetical protein	NA	NA	NA	NA
AVG10841.1\|383023_383338_-	LexA repressor-like protein	NA	NA	NA	NA
AVG10842.1\|383402_384626_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10843.1\|384801_385296_-	spore germination receptor subunit-like protein	NA	NA	NA	NA
AVG10844.1\|385292_386393_-	spore germination protein YndE	NA	NA	NA	NA
386286:386300	attR	NA	NA	NA	NA
AVG10845.1\|386389_387817_-	spore germination protein KA	NA	NA	NA	NA
386286:386300	attR	NA	NA	NA	NA
AVG10846.1\|388716_389967_+	toxin-like protein	NA	NA	NA	NA
AVG10847.1\|390038_391520_+	toxin-like protein	A0A1V0E026	Clostridioides_phage	2.3e-75	37.4
AVG10848.1\|391486_391735_+	Clostridial binary toxin B/anthrax toxin PA	A0A1V0E026	Clostridioides_phage	2.1e-05	41.2
AVG10849.1\|391849_393073_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10850.1\|393686_395165_+	amino acid antiporter	NA	NA	NA	NA
AVG10851.1\|395176_397045_+	decarboxylase	NA	NA	NA	NA
AVG10852.1\|397115_398504_+	Na(+)/H(+) antiporter NhaC	NA	NA	NA	NA
AVG10853.1\|399053_400316_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.3e-87	42.3
AVG10854.1\|400347_401049_+	Replication protein	NA	NA	NA	NA
AVG10855.1\|401519_402743_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10856.1\|403476_404925_+	putative transporter	NA	NA	NA	NA
AVG10857.1\|404982_406845_+	decarboxylase	NA	NA	NA	NA
AVG10858.1\|406954_407662_+	pyridoxine kinase PdxK	NA	NA	NA	NA
AVG10859.1\|407860_409246_+	putative tyrosine permease, NhaC family	NA	NA	NA	NA
AVG10860.1\|409532_409829_+	TrpR like protein, YerC/YecD	NA	NA	NA	NA
AVG10861.1\|410084_410789_+	putative membrane protein	NA	NA	NA	NA
AVG10862.1\|411018_411834_+	sporulation-specific N-acetylmuramoyl-L-alanine amidase CwlC	D6QWP2	uncultured_phage	6.9e-42	53.5
AVG10863.1\|413294_413852_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.1e-38	43.6
AVG10864.1\|413848_414808_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.3e-76	46.0
AVG10865.1\|414804_415659_+\|coat	spore coat polysaccharide biosynthesis protein SpsK	NA	NA	NA	NA
AVG10866.1\|415915_416209_+	ECF subfamily RNA polymerase sigma-24 factor	NA	NA	NA	NA
AVG10867.1\|417275_418499_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10868.1\|418491_418794_-	hypothetical protein	NA	NA	NA	NA
AVG10869.1\|419722_420499_+	putative DNA-binding protein	NA	NA	NA	NA
AVG10870.1\|421636_422860_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10871.1\|422924_423044_+	LexA repressor-like protein	NA	NA	NA	NA
AVG10872.1\|423441_423708_+	hypothetical protein	NA	NA	NA	NA
AVG10873.1\|423861_424743_+	hypothetical protein	NA	NA	NA	NA
AVG10874.1\|424765_425698_+	CRISPR-associated RAMP Cmr1 family protein	NA	NA	NA	NA
AVG10875.1\|425697_427371_+	CRISPR-associated RAMP Crm2 family protein	NA	NA	NA	NA
AVG10876.1\|427373_428495_+	CRISPR-associated protein, Cmr3 family	NA	NA	NA	NA
AVG10877.1\|428487_428796_+	CRISPR-associated RAMP protein, Cmr4 family	NA	NA	NA	NA
AVG10878.1\|428831_429404_+	CRISPR-associated RAMP protein, Cmr4 family	NA	NA	NA	NA
AVG10879.1\|429387_429792_+	CRISPR-associated protein, Cmr5 family	NA	NA	NA	NA
AVG10880.1\|429754_430624_+	CRISPR-associated RAMP Cmr6 family protein	NA	NA	NA	NA
AVG10881.1\|430919_431084_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	5.0e-08	56.8
AVG10882.1\|431080_431809_-\|transposase	transposase mutator type	A0A218MNI5	uncultured_virus	4.9e-15	68.3
AVG10883.1\|432076_432634_+\|transposase	transposase	NA	NA	NA	NA
AVG10884.1\|432651_433161_+\|transposase	transposase	NA	NA	NA	NA
AVG10885.1\|433466_434138_+	ABC-transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.6e-12	29.7
AVG10886.1\|434134_434305_+	hypothetical protein	NA	NA	NA	NA
AVG10887.1\|434324_434618_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	3.7e-14	43.8
AVG10888.1\|434713_435088_-\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	5.1e-48	69.7
AVG10889.1\|436223_437447_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
AVG10890.1\|437978_439235_+	sporulation protein YdcC	NA	NA	NA	NA
AVG10891.1\|439402_440590_+	alanine racemase Alr	NA	NA	NA	NA
AVG10892.1\|440824_441106_+	putative transcriptional regulator, CopG family	NA	NA	NA	NA
AVG10893.1\|441109_441460_+	mRNA interferase NdoA	A0A2P0ZKX3	Lactobacillus_phage	6.9e-15	38.6
AVG10894.1\|441547_443836_+	hypothetical protein	NA	NA	NA	NA
AVG10895.1\|444037_444619_-	ECF subfamily RNA polymerase sigma-24 factor	NA	NA	NA	NA
AVG10896.1\|445000_445459_+	hypothetical protein	NA	NA	NA	NA
AVG10897.1\|445491_445629_+	hypothetical protein	NA	NA	NA	NA
AVG10898.1\|446050_446278_+	hypothetical protein	NA	NA	NA	NA
AVG10899.1\|446533_447538_+\|protease	minor extracellular protease Epr	A0A217EQY2	Bacillus_phage	7.5e-38	38.4
AVG10900.1\|447534_447732_+	thermophilic serine proteinase	NA	NA	NA	NA
AVG10901.1\|448309_448666_-	hypothetical protein	NA	NA	NA	NA
AVG10902.1\|448764_449235_+	SprT-like protein	NA	NA	NA	NA
AVG10903.1\|449955_450654_-\|integrase	phage integrase-like protein	A0A2I7SC08	Paenibacillus_phage	3.6e-71	58.0
AVG10904.1\|450723_450924_-\|integrase	phage integrase-like protein	S5MNZ2	Brevibacillus_phage	7.9e-08	52.9
AVG10905.1\|450936_451545_-	LexA repressor-like protein	NA	NA	NA	NA
AVG10906.1\|451609_452833_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10907.1\|453396_453987_+	phage structural protein	NA	NA	NA	NA
AVG10908.1\|453998_454286_+	hypothetical protein	E2ELK3	Clostridium_phage	3.8e-19	51.6
AVG10909.1\|454644_455868_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10910.1\|455895_456168_+	DNA processing Smf single strand binding protein-like protein	A0A0K2CZQ0	Paenibacillus_phage	2.7e-11	96.8
AVG10911.1\|456263_456710_-	Thiol-disulfide oxidoreductase YkuV	NA	NA	NA	NA
AVG10912.1\|456724_456979_-	hypothetical protein	NA	NA	NA	NA
AVG10913.1\|457040_457229_-	hypothetical protein	NA	NA	NA	NA
AVG10914.1\|457198_458680_-\|bacteriocin	putative bacteriocin-skfA transport system permease protein SkfF	NA	NA	NA	NA
AVG10915.1\|458672_459395_-	SkfA peptide export ATP-binding protein SkfE	A0A2H4PQG7	Staphylococcus_phage	1.9e-19	31.1
AVG10916.1\|459407_459830_-	abortive infection protein	NA	NA	NA	NA
AVG10917.1\|459949_461173_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10918.1\|461215_462298_-	Sporulation-killing factor biosynthesis protein SkfC	NA	NA	NA	NA
AVG10919.1\|462311_463526_-	molybdenum cofactor biosynthesis protein A	NA	NA	NA	NA
AVG10920.1\|463599_463785_-	Sporulation-killing factor SkfA	NA	NA	NA	NA
AVG10921.1\|464159_464564_+	D-mannose binding lectin	NA	NA	NA	NA
AVG10922.1\|465349_465676_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVG10923.1\|465814_466117_-	hypothetical protein	NA	NA	NA	NA
AVG10924.1\|466756_468796_-	methyl-accepting chemotaxis protein signaling domain protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-11	43.3
AVG10925.1\|469079_470303_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10926.1\|470407_471022_-	putative membrane protein	NA	NA	NA	NA
AVG10927.1\|471200_472424_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10928.1\|472846_473059_-	hypothetical protein	NA	NA	NA	NA
AVG10929.1\|473267_473702_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG10930.1\|473698_476866_+	putative membrane protein YdgH	NA	NA	NA	NA
AVG10931.1\|477064_477652_+	peptide deformylase 2	E3SLL2	Synechococcus_phage	1.2e-11	36.8
AVG10932.1\|477706_478675_+	peptide methionine sulfoxide reductase MsrA/MsrB	NA	NA	NA	NA
AVG10933.1\|479000_479570_+	sodium/hydrogen exchanger family protein	NA	NA	NA	NA
AVG10934.1\|479379_479841_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVG10935.1\|480027_481092_+	major facilitator superfamily MFS_1 protein	NA	NA	NA	NA
AVG10936.1\|481622_482051_+	transcriptional regulator, BadM/Rrf2 family	NA	NA	NA	NA
AVG10937.1\|482282_483008_+	transcriptional regulator, GntR family	NA	NA	NA	NA
AVG10938.1\|483216_483690_+	N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 2	NA	NA	NA	NA
AVG10939.1\|483708_484476_+	putative N-acetylgalactosamine permease IIC component 2	NA	NA	NA	NA
AVG10940.1\|484465_485338_+	N-acetylgalactosamine permease IID component AgaD	NA	NA	NA	NA
AVG10941.1\|485355_485778_+	PTS system mannose-specific component IIAB-like protein	NA	NA	NA	NA
AVG10942.1\|485842_489538_-	amino acid adenylation protein	A0A2K9KZV5	Tupanvirus	2.3e-76	30.8
AVG10943.1\|489622_491380_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-15	30.7
AVG10944.1\|492630_494265_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AVG10945.1\|494740_495970_-	acetyltransferase	NA	NA	NA	NA
AVG10946.1\|496414_497482_-	thiamine biosynthesis lipoprotein ApbE	NA	NA	NA	NA
AVG10947.1\|497781_498162_+	putative membrane protein	NA	NA	NA	NA
AVG10948.1\|498148_498709_+	heptaprenyl diphosphate synthase related protein	NA	NA	NA	NA
AVG10949.1\|498744_499578_+	energy-coupling factor transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-20	33.7
AVG10950.1\|499553_500420_+	energy-coupling factor transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-13	28.9
AVG10951.1\|500436_501240_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AVG10952.1\|501372_503295_+	peptidase U32	NA	NA	NA	NA
AVG10953.1\|503330_504605_+	aminotransferase class-III	A0A1V0SKB7	Klosneuvirus	8.9e-28	27.4
AVG10954.1\|504618_506058_+	3-octaprenyl-4hydroxybenzoate decarboxylase	NA	NA	NA	NA
AVG10955.1\|506047_506914_+	4-hydroxybenzoate polyprenyltransferase	NA	NA	NA	NA
AVG10956.1\|507261_507591_-	Two-component sensor histidine kinase YkoG-like protein	NA	NA	NA	NA
AVG10957.1\|507600_507906_-	heavy metal sensor kinase	NA	NA	NA	NA
AVG10958.1\|507902_508349_-	Two-component response regulator YkoH-like protein	A0A0K2CZQ0	Paenibacillus_phage	7.7e-11	96.8
AVG10959.1\|508376_509600_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10960.1\|509684_510455_+	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
AVG10961.1\|510441_512319_+	ABC transporter, permease protein	NA	NA	NA	NA
AVG10962.1\|512362_513586_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10963.1\|513650_513785_+	LexA repressor-like protein	NA	NA	NA	NA
AVG10964.1\|514336_514591_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	4.5e-40	95.3
AVG10965.1\|514721_515096_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	1.2e-65	97.6
AVG10966.1\|515576_517559_+	peptidoglycan-N-acetylmuramate O-acetyltransferase	B5WZU0	Pseudomonas_phage	2.9e-41	32.2
AVG10967.1\|517575_518079_+	hypothetical protein	NA	NA	NA	NA
AVG10968.1\|518520_518841_+\|transposase	transposase	A0A0C5AJ29	Paenibacillus_phage	1.2e-50	99.1
AVG10969.1\|518978_519731_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	6.4e-135	98.7
AVG10970.1\|519807_520098_-	hypothetical protein	NA	NA	NA	NA
AVG10971.1\|520338_520938_-	putative beta-lactamase	NA	NA	NA	NA
AVG10972.1\|521326_522223_+	Major membrane immunogen, membrane-anchored lipoprotein	NA	NA	NA	NA
AVG10973.1\|522368_524246_+	NADH dehydrogenase Ndh	NA	NA	NA	NA
AVG10974.1\|524371_524821_+	hypothetical protein	NA	NA	NA	NA
AVG10975.1\|524836_525814_+	heptaprenyl diphosphate synthase component 2	NA	NA	NA	NA
AVG10976.1\|526474_527308_+\|transposase	transposase	NA	NA	NA	NA
AVG10977.1\|527791_528091_+\|transposase	transposase	A0A218MNI5	uncultured_virus	1.2e-23	52.7
AVG10978.1\|527971_528325_-	hypothetical protein	NA	NA	NA	NA
AVG10979.1\|528800_530024_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10980.1\|530171_530435_+	lethal factor domain protein	NA	NA	NA	NA
AVG10981.1\|530530_530968_+	toxin-like protein	NA	NA	NA	NA
AVG10982.1\|531079_532303_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG10983.1\|532614_532752_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVG10984.1\|533448_535158_-\|tRNA	arginine--tRNA ligase ArgS	A0A2I2L3K1	Orpheovirus	3.1e-76	32.3
AVG10985.1\|535700_536372_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.5e-66	57.8
AVG10986.1\|536368_536854_+	queuosine biosynthesis protein QueD	J9PV91	Bacillus_phage	7.7e-57	68.2
AVG10987.1\|536846_537584_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	4.2e-54	41.8
AVG10988.1\|537637_538129_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.2e-49	63.1
AVG10989.1\|538537_539341_+	Methyltransferase domain protein	NA	NA	NA	NA
AVG10990.1\|539465_540908_+	putative dipeptidase YtjP	NA	NA	NA	NA
AVG10991.1\|541047_542271_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG10992.1\|542560_542962_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AVG10993.1\|543067_544489_-	Na(+)/H(+) antiporter NhaC	NA	NA	NA	NA
AVG10994.1\|544724_545273_+	RNA polymerase sigma factor SigW-like protein	NA	NA	NA	NA
AVG10995.1\|545256_545877_+	hypothetical protein	NA	NA	NA	NA
AVG10996.1\|546683_546788_+	hypothetical protein	NA	NA	NA	NA
AVG10997.1\|546881_547394_+	Double zinc ribbon	NA	NA	NA	NA
AVG10998.1\|547805_548438_+	regulatory protein TenI	NA	NA	NA	NA
AVG10999.1\|548421_549234_+	FAD-dependent glycine oxidase-like protein	NA	NA	NA	NA
AVG11000.1\|549290_549494_+	sulfur carrier protein ThiS	NA	NA	NA	NA
AVG11001.1\|549495_550296_+	thiazole synthase ThiG	NA	NA	NA	NA
AVG11002.1\|550292_551219_+	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase ThiD	NA	NA	NA	NA
AVG11003.1\|551190_551337_+	hypothetical protein	NA	NA	NA	NA
AVG11004.1\|551356_551617_+	Thiamine-phosphate synthase	NA	NA	NA	NA
AVG11005.1\|553544_553781_+	hypothetical protein	NA	NA	NA	NA
AVG11006.1\|553885_555109_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11007.1\|555307_555436_+	putative transposon DNA-invertase Bin3	NA	NA	NA	NA
AVG11008.1\|555464_555875_+	resolvase	A0A0F7LA37	Escherichia_phage	2.7e-10	36.2
AVG11009.1\|556665_556833_-\|transposase	transposase family protein	NA	NA	NA	NA
AVG11010.1\|556861_556963_-	hypothetical protein	NA	NA	NA	NA
AVG11011.1\|557197_557575_+\|bacteriocin	putative bacteriocin	NA	NA	NA	NA
AVG11012.1\|558320_558440_+\|bacteriocin	putative bacteriocin	NA	NA	NA	NA
AVG11013.1\|558433_559129_+	ABC transporter	G9BWD6	Planktothrix_phage	7.8e-18	33.3
AVG11014.1\|559125_559482_+	hypothetical protein	NA	NA	NA	NA
AVG11015.1\|559846_561820_+	hypothetical protein	NA	NA	NA	NA
AVG11016.1\|562160_562763_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	2.5e-44	51.0
AVG11017.1\|562936_563626_-\|transposase	putative transposase	NA	NA	NA	NA
AVG11018.1\|563736_564042_-	hypothetical protein	NA	NA	NA	NA
AVG11019.1\|564366_565356_+	outer membrane protein RomA	NA	NA	NA	NA
AVG11020.1\|565531_566668_-	PBS lyase HEAT-like repeat protein	NA	NA	NA	NA
AVG11021.1\|566686_566788_-	hypothetical protein	NA	NA	NA	NA
AVG11022.1\|566945_567530_-	guanylate kinase-like protein	A0A0K2FM14	Brevibacillus_phage	2.9e-10	27.8
AVG11023.1\|568083_569076_+	cytochrome c oxidase subunit 2	NA	NA	NA	NA
AVG11024.1\|569202_571689_+	cytochrome c oxidase subunit 1	NA	NA	NA	NA
AVG11025.1\|571693_572008_+	cytochrome C oxidase subunit IV	NA	NA	NA	NA
AVG11026.1\|572134_573001_+	putative cytochrome c oxidase assembly factor CtaG	NA	NA	NA	NA
AVG11027.1\|573234_573453_+\|transposase	transposase, IS605 family	NA	NA	NA	NA
AVG11028.1\|573620_574844_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11029.1\|575792_576698_+	ABC transporter, ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-23	30.0
AVG11030.1\|576690_577959_+	putative membrane protein	NA	NA	NA	NA
AVG11031.1\|578293_579931_+	L-2,4-diaminobutyrate decarboxylase	NA	NA	NA	NA
AVG11032.1\|580155_580953_-	multidrug resistance protein	NA	NA	NA	NA
AVG11033.1\|580953_581439_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVG11034.1\|581681_582800_+\|transposase	putative transposase InsK for insertion sequence element IS150	NA	NA	NA	NA
AVG11035.1\|582792_584016_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11036.1\|584043_585438_+\|transposase	transposase	A0A2I7SCM7	Paenibacillus_phage	4.9e-11	96.9
AVG11037.1\|585486_586665_-	cystathionine beta-lyase PatB	NA	NA	NA	NA
AVG11038.1\|586847_587654_-	polysaccharide deacetylase	NA	NA	NA	NA
AVG11039.1\|588101_588935_-	hypothetical protein	NA	NA	NA	NA
AVG11040.1\|589062_590301_+	3-oxoacyl-[acyl-carrier-protein] synthase 2	NA	NA	NA	NA
AVG11041.1\|590783_591353_+	putative maltose O-acetyltransferase Maa	NA	NA	NA	NA
AVG11042.1\|591622_591919_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG11043.1\|591939_593163_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_5

596280 : 637430

Paenibacillus_phage(46.15%)

holin,transposase,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11048.1\|596280_597504_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11049.1\|597734_597986_+	Sigma-O factor regulatory protein RsoA	NA	NA	NA	NA
AVG11050.1\|598605_599010_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	5.1e-30	55.3
AVG11051.1\|599366_599792_+	putative toxin-antitoxin system, toxin component	NA	NA	NA	NA
AVG11052.1\|599793_600165_+	transcriptional regulator, ArsR family	NA	NA	NA	NA
AVG11053.1\|600425_600743_+	methylated-DNA-protein- cysteinemethyltransferase	NA	NA	NA	NA
AVG11054.1\|600893_601118_+	hypothetical protein	NA	NA	NA	NA
AVG11055.1\|601699_602185_+	hypothetical protein	NA	NA	NA	NA
AVG11056.1\|602595_603078_+	hypothetical protein	NA	NA	NA	NA
AVG11057.1\|603985_605026_+	putative oxidoreductase YvaA	NA	NA	NA	NA
AVG11058.1\|605303_606365_+	glyceraldehyde-3-phosphate dehydrogenase 2	NA	NA	NA	NA
AVG11059.1\|606488_607079_+	transcriptional regulator, TetR family	NA	NA	NA	NA
AVG11060.1\|607144_608362_+	major facilitator superfamily MFS_1 protein	NA	NA	NA	NA
AVG11061.1\|608619_609603_+	Homoserine kinase	NA	NA	NA	NA
AVG11062.1\|609934_610837_+	carboxylate/amino acid/amine transporter	NA	NA	NA	NA
AVG11063.1\|610833_611625_-	hypothetical protein	NA	NA	NA	NA
AVG11064.1\|612024_612756_+	glyoxalase family protein	NA	NA	NA	NA
AVG11065.1\|612806_613289_+	hypothetical protein	NA	NA	NA	NA
AVG11066.1\|613362_613884_-	putative cell-wall hydrolase	NA	NA	NA	NA
AVG11067.1\|614041_615421_-	sensor histidine kinase YkoH	A0A1V0SGX0	Hokovirus	5.7e-20	32.4
AVG11068.1\|615410_616112_-	response regulator ArlR	W8CYM9	Bacillus_phage	7.3e-32	36.1
AVG11069.1\|616313_617066_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	9.3e-134	98.3
AVG11070.1\|617203_617887_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.7e-118	96.9
AVG11071.1\|617979_618573_-	undecaprenyl-diphosphatase BcrC	NA	NA	NA	NA
AVG11072.1\|618821_619529_+	ABC-type transporter ATP-binding protein EcsA	A0A2H4PQG7	Staphylococcus_phage	2.2e-15	28.1
AVG11073.1\|619574_619763_+	ABC transporter-like protein	NA	NA	NA	NA
AVG11074.1\|620075_621089_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	1.3e-18	30.6
AVG11075.1\|621346_621436_+	hypothetical protein	NA	NA	NA	NA
AVG11076.1\|621544_622057_+	ABC transporter-like protein	NA	NA	NA	NA
AVG11077.1\|622129_622498_+	hypothetical protein	NA	NA	NA	NA
AVG11078.1\|622596_623820_-	tricarballylate dehydrogenase	A0A2H4PQX1	Staphylococcus_phage	1.0e-28	60.2
AVG11079.1\|623864_624887_-	Ser/Thr phosphatase family protein	NA	NA	NA	NA
AVG11080.1\|625026_625713_+	hypothetical protein	NA	NA	NA	NA
AVG11081.1\|625972_626263_+	putative membrane protein	NA	NA	NA	NA
AVG11082.1\|626317_626983_+	phage shock protein A, PspA	NA	NA	NA	NA
AVG11083.1\|626989_627508_+	phage shock protein C, PspC	NA	NA	NA	NA
AVG11084.1\|627510_628233_+	PspA/IM30 family protein	NA	NA	NA	NA
AVG11085.1\|628350_629217_+	prolipoprotein diacylglyceryl transferase Lgt	NA	NA	NA	NA
AVG11086.1\|629220_629574_+	hypothetical protein	NA	NA	NA	NA
AVG11087.1\|629715_630147_+	bacillithiol system oxidoreductase, YphP/YqiW family	NA	NA	NA	NA
AVG11088.1\|630593_631400_+	NH(3)-dependent NAD(+) ligase	G3MA24	Bacillus_virus	1.3e-53	45.2
AVG11089.1\|631604_632531_+	putative ABC transporter ATP-binding protein YhcH	A0A2H4PQG7	Staphylococcus_phage	1.0e-36	36.9
AVG11090.1\|632514_633429_+	putative membrane protein	NA	NA	NA	NA
AVG11091.1\|633523_633916_+	holo-[acyl-carrier-protein] synthase AcpS	NA	NA	NA	NA
AVG11092.1\|633994_634483_-	hypothetical protein	NA	NA	NA	NA
AVG11093.1\|634665_635889_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11094.1\|636057_636186_+	site-specific recombinase XerD	NA	NA	NA	NA
AVG11095.1\|636206_637430_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8

DBSCAN-SWA_6

646413 : 706018

Paenibacillus_phage(72.0%)

holin,transposase,coat,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11107.1\|646413_647637_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11108.1\|647862_648435_+	hypothetical protein	NA	NA	NA	NA
AVG11109.1\|648615_649449_+	FeS assembly ATPase SufC	W8CYL7	Bacillus_phage	2.2e-06	25.3
AVG11110.1\|649516_650812_+	FeS assembly protein SufD	NA	NA	NA	NA
AVG11111.1\|650808_652035_+	putative cysteine desulfurase Csd	Q2XUY6	environmental_halophage	2.1e-111	46.2
AVG11112.1\|652021_652459_+	SUF system FeS assembly protein, NifU family	A0A218MKD1	uncultured_virus	1.1e-12	31.2
AVG11113.1\|652483_653881_+	FeS cluster assembly protein SufB	NA	NA	NA	NA
AVG11114.1\|654458_655682_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11115.1\|655743_656091_-	hypothetical protein	NA	NA	NA	NA
AVG11116.1\|656361_656541_-	hypothetical protein	NA	NA	NA	NA
AVG11117.1\|656559_657294_-	hypothetical protein	NA	NA	NA	NA
AVG11118.1\|658503_658905_+	putative DNA-binding protein	NA	NA	NA	NA
AVG11119.1\|659180_659843_+	phage structural protein	A0A2I7SC02	Paenibacillus_phage	5.1e-11	46.7
AVG11120.1\|660308_660548_+	hypothetical protein	R9W0N4	Paenibacillus_phage	4.1e-35	96.2
AVG11121.1\|660544_661216_+	N-acetylmuramoyl-L-alanine amidase	A0A0K2CXQ8	Paenibacillus_phage	3.9e-131	97.3
AVG11122.1\|661296_661539_+	hypothetical protein	A0A2I7SC00	Paenibacillus_phage	6.2e-31	90.0
AVG11123.1\|662188_662302_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVG11124.1\|662328_662487_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVG11125.1\|662525_663254_+\|transposase	putative transposase	NA	NA	NA	NA
AVG11126.1\|663366_663639_+	hypothetical protein	J7KJ12	Streptococcus_phage	1.1e-07	47.9
AVG11127.1\|663743_664967_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	3.1e-227	99.8
AVG11128.1\|665089_665848_+	cell wall-associated hydrolase	NA	NA	NA	NA
AVG11129.1\|665854_667078_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11130.1\|667248_667485_+\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	2.2e-33	98.7
AVG11131.1\|667526_668321_+\|transposase	transposase-like protein	A0A2I7SC85	Paenibacillus_phage	1.5e-145	98.5
AVG11132.1\|668707_669034_+\|transposase	transposase	NA	NA	NA	NA
AVG11133.1\|669794_670838_+	hypothetical protein	NA	NA	NA	NA
AVG11134.1\|670857_671163_+	hypothetical protein	NA	NA	NA	NA
AVG11135.1\|671525_671924_+	hypothetical protein	NA	NA	NA	NA
AVG11136.1\|672012_673236_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11137.1\|673512_674481_-	metal dependent phosphohydrolase	NA	NA	NA	NA
AVG11138.1\|674590_675814_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11139.1\|676033_676366_-	putative membrane protein	NA	NA	NA	NA
AVG11140.1\|676558_677527_+	hypothetical protein	NA	NA	NA	NA
AVG11141.1\|677711_679127_+	putative metallophosphoesterase YunD	NA	NA	NA	NA
AVG11142.1\|679271_680123_+	undecaprenyl-diphosphatase UppP	NA	NA	NA	NA
AVG11143.1\|680487_681711_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11144.1\|681886_683011_+	radical SAM domain protein	NA	NA	NA	NA
AVG11145.1\|683063_684434_+	Magnesium and cobalt efflux protein CorC	NA	NA	NA	NA
AVG11146.1\|684597_685350_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	9.3e-134	98.3
AVG11147.1\|685487_686171_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.7e-118	96.9
AVG11148.1\|686351_686564_+\|coat	Spore coat associated protein JA (CotJA)	NA	NA	NA	NA
AVG11149.1\|686836_687103_+\|coat	spore coat peptide assembly protein	NA	NA	NA	NA
AVG11150.1\|687144_687714_+	protein CotJC	NA	NA	NA	NA
AVG11151.1\|688106_688403_+	hypothetical protein	A0A0K2CZ50	Paenibacillus_phage	3.5e-12	70.6
AVG11152.1\|688632_689538_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AVG11153.1\|690741_690939_+	hypothetical protein	NA	NA	NA	NA
AVG11154.1\|691430_692654_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8
AVG11155.1\|693081_694275_-	Collagen triple helix repeat (20 copies)	NA	NA	NA	NA
AVG11156.1\|696763_697321_+\|transposase	transposase	NA	NA	NA	NA
AVG11157.1\|697338_697848_+\|transposase	transposase	NA	NA	NA	NA
AVG11158.1\|698060_698501_+	hypothetical protein	NA	NA	NA	NA
AVG11159.1\|700115_700295_-	dTDP-glucose 4,6-dehydratase	NA	NA	NA	NA
AVG11160.1\|700291_701014_-\|coat	spore coat polysaccharide biosynthesis protein SpsI	H9NC64	Sphingomonas_phage	7.8e-45	41.0
AVG11161.1\|701994_702885_+	3D domain protein	A0A024B055	Bacillus_phage	3.7e-12	43.6
AVG11162.1\|702980_703991_-	polysaccharide deacetylase	NA	NA	NA	NA
AVG11163.1\|704427_705303_+	putative endopeptidase LytE	D2KRB9	Lactobacillus_phage	2.6e-10	33.0
AVG11164.1\|705619_706018_+\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	1.1e-21	43.5

DBSCAN-SWA_7

717998 : 773367

Paenibacillus_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11176.1\|717998_719222_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11177.1\|719358_720531_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
AVG11178.1\|720639_720942_+	putative membrane protein	NA	NA	NA	NA
AVG11179.1\|721496_721673_-	hypothetical protein	NA	NA	NA	NA
AVG11180.1\|721718_722942_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11181.1\|723154_723364_+	hypothetical protein	NA	NA	NA	NA
AVG11182.1\|723572_724796_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11183.1\|724919_725867_+	spermidine/putrescine import ATP-binding protein potA	A0A2H4PQG7	Staphylococcus_phage	3.8e-23	30.4
AVG11184.1\|725882_726659_+	putative pleiotropic drug resistance protein	NA	NA	NA	NA
AVG11185.1\|726655_727642_+	ABC-2 type transport system permease protein PotC	NA	NA	NA	NA
AVG11186.1\|727702_730321_+	HTH-type transcriptional regulator MalT	NA	NA	NA	NA
AVG11187.1\|730438_731053_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.5e-73	62.6
AVG11188.1\|731312_731423_+	hypothetical protein	NA	NA	NA	NA
AVG11189.1\|731716_732721_+	HTH-type transcriptional repressor PurR	NA	NA	NA	NA
AVG11190.1\|732766_733741_+	Glucosamine kinase GspK	NA	NA	NA	NA
AVG11191.1\|733746_735048_+	putative 6-phospho-beta-glucosidase	NA	NA	NA	NA
AVG11192.1\|735458_736619_+\|holin	glycine betaine/carnitine/choline transport ATP-binding protein OpuCA	G3M9Y6	Bacillus_virus	9.0e-27	33.6
AVG11193.1\|736615_737272_+\|holin	choline transport system permease protein OpuBB	NA	NA	NA	NA
AVG11194.1\|737288_738182_+\|holin	choline-binding protein	NA	NA	NA	NA
AVG11195.1\|738225_738855_+\|holin	glycine betaine/carnitine/choline transport system permease protein OpuCD	NA	NA	NA	NA
AVG11196.1\|739135_739564_+	Acetyltransferase YpeA	NA	NA	NA	NA
AVG11197.1\|739844_740432_+	hypothetical protein	NA	NA	NA	NA
AVG11198.1\|740460_741630_+	putative iron-sulfur cluster binding protein	NA	NA	NA	NA
AVG11199.1\|741700_742735_+	metal dependent phosphohydrolase	NA	NA	NA	NA
AVG11200.1\|742934_744158_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11201.1\|744231_744441_+	hypothetical protein	NA	NA	NA	NA
AVG11202.1\|744796_745387_+	GTP cyclohydrolase 1	E7DN69	Pneumococcus_phage	5.5e-49	54.4
AVG11203.1\|745607_746888_-	putative superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	8.1e-37	42.8
AVG11204.1\|746961_747993_-	hypothetical protein	NA	NA	NA	NA
AVG11205.1\|748330_749074_+	hypothetical protein	NA	NA	NA	NA
AVG11206.1\|749181_750153_+	CDF family cation diffusion facilitator	NA	NA	NA	NA
AVG11207.1\|750312_753012_-	aconitate hydratase Acn	NA	NA	NA	NA
AVG11208.1\|753354_754374_+	two-component response regulator	NA	NA	NA	NA
AVG11209.1\|754396_755518_+	D-alanine--D-alanine ligase Ddl	NA	NA	NA	NA
AVG11210.1\|755641_755830_+	hypothetical protein	NA	NA	NA	NA
AVG11211.1\|756030_757059_+	UV DNA damage endonuclease UvsE	A0A2I2L3D9	Orpheovirus	7.7e-22	27.5
AVG11212.1\|757247_758018_+	enoyl-[acyl-carrier-protein] reductase [NADH] FabI	NA	NA	NA	NA
AVG11213.1\|758151_758445_-	hypothetical protein	NA	NA	NA	NA
AVG11214.1\|758952_759807_+	inositol-1-monophosphatase SuhB	NA	NA	NA	NA
AVG11215.1\|759910_760327_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
AVG11216.1\|760487_761492_+	biotin synthase BioB	NA	NA	NA	NA
AVG11217.1\|761567_766079_-	glutamate synthase [NADPH] large chain GltA	NA	NA	NA	NA
AVG11218.1\|766604_767918_-	glutamate-1-semialdehyde 2,1-aminomutase 1	NA	NA	NA	NA
AVG11219.1\|768009_769035_-	transcriptional regulator LytR	NA	NA	NA	NA
AVG11220.1\|769584_770055_+	peroxiredoxin-like protein	NA	NA	NA	NA
AVG11221.1\|770346_771702_+	putative polysaccharide deacetylase YheN	NA	NA	NA	NA
AVG11222.1\|771839_772466_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	2.7e-54	53.8
AVG11223.1\|772692_773367_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	4.0e-35	43.8

DBSCAN-SWA_8

780289 : 846397

Paenibacillus_phage(26.09%)

transposase,protease,integrase

attL 834175:834234|attR 845053:846441

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11229.1\|780289_781513_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11230.1\|781685_781859_+	helix-turn-helix family protein	NA	NA	NA	NA
AVG11231.1\|781876_782908_-	vancomycin/teicoplanin A-type resistance protein VanA	NA	NA	NA	NA
AVG11232.1\|782900_783320_-	putative lactate dehydrogenase VanHE	M1I636	Acanthocystis_turfacea_Chlorella_virus	2.5e-19	42.9
AVG11233.1\|783600_784824_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11234.1\|785158_786553_+	putative permease	A0A0R6PHV4	Moraxella_phage	1.9e-47	32.9
AVG11235.1\|793239_794463_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11236.1\|794540_795548_-	HTH-type transcriptional regulator DegA	NA	NA	NA	NA
AVG11237.1\|795741_796545_-	5-deoxy-glucuronate isomerase IolB	NA	NA	NA	NA
AVG11238.1\|796593_797613_-	oxidoreductase domain protein	NA	NA	NA	NA
AVG11239.1\|797966_799001_+	5-dehydro-2-deoxygluconokinase IolC	NA	NA	NA	NA
AVG11240.1\|799019_800471_+	methylmalonate semialdehyde dehydrogenase [acylating] 3	NA	NA	NA	NA
AVG11241.1\|800483_802418_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase	NA	NA	NA	NA
AVG11242.1\|802512_803409_+	inosose dehydratase 2	NA	NA	NA	NA
AVG11243.1\|803435_804503_+	Myo-inositol 2-dehydrogenase IolG	NA	NA	NA	NA
AVG11244.1\|804542_804983_+	putative symporter YidK	NA	NA	NA	NA
AVG11245.1\|805097_806321_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11246.1\|806586_807525_+	putative symporter YidK	NA	NA	NA	NA
AVG11247.1\|807639_808617_+	nitrilase Nit	NA	NA	NA	NA
AVG11248.1\|809165_809657_+	N5-carboxyaminoimidazole ribonucleotide mutase PurE	A0A2P0VNU7	Tetraselmis_virus	1.1e-21	48.9
AVG11249.1\|809653_810949_+	N5-carboxyaminoimidazole ribonucleotide synthase PurK	NA	NA	NA	NA
AVG11250.1\|811016_812312_+	adenylosuccinate lyase PurB	A0A1B3B081	Gordonia_phage	6.3e-21	34.3
AVG11251.1\|812385_813270_+	phosphoribosylaminoimidazole-succinocarboxamide synthase PurC	A0A0M4JBD3	Mollivirus	1.1e-37	33.9
AVG11252.1\|813360_813603_+	phosphoribosylformylglycinamidine synthase PurS	A0A0E3FJ99	Synechococcus_phage	7.4e-08	35.4
AVG11253.1\|813676_814372_+	phosphoribosylformylglycinamidine synthase 1	NA	NA	NA	NA
AVG11254.1\|814349_816593_+	phosphoribosylformylglycinamidine synthase 2	A6N228	Microbacterium_phage	5.9e-168	44.4
AVG11255.1\|816577_818152_+	amidophosphoribosyltransferase PurF	A0A0M3SGR2	Mollivirus	1.5e-48	31.6
AVG11256.1\|818246_819293_+	phosphoribosylformylglycinamidine cyclo-ligase PurM	Q58MH8	Prochlorococcus_phage	3.3e-68	44.7
AVG11257.1\|819289_819913_+	phosphoribosylglycinamide formyltransferase PurN	M4QRX9	Synechococcus_phage	7.0e-26	38.3
AVG11258.1\|820123_821671_+	bifunctional purine biosynthesis protein PurH	Q58MG4	Prochlorococcus_phage	7.7e-74	49.8
AVG11259.1\|821689_822970_+	phosphoribosylamine--glycine ligase PurD	NA	NA	NA	NA
AVG11260.1\|824056_824539_+	NTP pyrophosphohydrolase-like protein	NA	NA	NA	NA
AVG11261.1\|824865_825300_-	hypothetical protein	NA	NA	NA	NA
AVG11262.1\|825407_826481_-	putative lipoprotein YerB	NA	NA	NA	NA
AVG11263.1\|826821_827106_-	hypothetical protein	NA	NA	NA	NA
AVG11264.1\|827679_827970_+	TrpR like protein, YerC/YecD	NA	NA	NA	NA
AVG11265.1\|828137_828926_+	sirohydrochlorin cobaltochelatase CbiX	NA	NA	NA	NA
AVG11266.1\|829075_830020_+	diacylglycerol kinase DagK	NA	NA	NA	NA
AVG11267.1\|830016_831594_+	23S rRNA (uracil-C(5))-methyltransferase RlmCD	A0A2K5B251	Erysipelothrix_phage	2.1e-95	38.1
AVG11268.1\|831791_834068_-	phage related protein	NA	NA	NA	NA
834175:834234	attL	NA	NA	NA	NA
AVG11269.1\|834295_835519_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11270.1\|835683_836346_+\|transposase	putative transposase	NA	NA	NA	NA
AVG11271.1\|836371_837040_+	DNA polymerase I - 3'-5' exonuclease	A0A2K5B2B0	Erysipelothrix_phage	5.1e-99	77.0
AVG11272.1\|837133_837607_+	putative phage antirepressor protein	O48391	Streptococcus_phage	6.9e-18	68.8
AVG11273.1\|837850_838210_+\|transposase	transposase-like protein	NA	NA	NA	NA
AVG11274.1\|838266_838449_-	hypothetical protein	NA	NA	NA	NA
AVG11275.1\|838618_840613_-	methyl-accepting chemotaxis protein TlpB	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-12	44.4
AVG11276.1\|840797_841034_+	hypothetical protein	NA	NA	NA	NA
AVG11277.1\|841216_841501_-\|integrase	phage integrase family protein	NA	NA	NA	NA
AVG11278.1\|841797_842070_+	transcriptional regulator, LuxR family	NA	NA	NA	NA
AVG11279.1\|842066_843077_+\|protease	intracellular serine protease	A0A2H4PQH1	Staphylococcus_phage	9.9e-22	28.6
AVG11280.1\|843092_843791_+	ABC transporter-like protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	30.0
AVG11281.1\|843796_844951_+	ABC transporter-like protein	NA	NA	NA	NA
AVG11282.1\|845173_846397_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
845053:846441	attR	NA	NA	NA	NA

DBSCAN-SWA_9

853371 : 902650

Paenibacillus_phage(54.55%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11288.1\|853371_854595_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11289.1\|854659_854779_+	putative phage DNA-binding protein	NA	NA	NA	NA
AVG11290.1\|855004_856111_-	filamentation induced by cAMP protein Fic	NA	NA	NA	NA
AVG11291.1\|856447_857395_+	export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-24	32.4
AVG11292.1\|857571_858726_+	ABC transporter-like protein	NA	NA	NA	NA
AVG11293.1\|858731_859151_+	thioesterase superfamily protein	NA	NA	NA	NA
AVG11294.1\|859147_860098_+	malonyl-CoA-[acyl-carrier-protein] transacylase	NA	NA	NA	NA
AVG11295.1\|860090_860837_+	3-oxoacyl-[acyl-carrier-protein] reductase FabG	W8CYX9	Bacillus_phage	4.9e-10	46.1
AVG11296.1\|861046_862270_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11297.1\|862355_862643_+	acyl carrier protein	NA	NA	NA	NA
AVG11298.1\|862649_863138_+	(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
AVG11299.1\|863134_865933_+	putative acetyltransferase	NA	NA	NA	NA
AVG11300.1\|865961_866519_+\|transposase	transposase	NA	NA	NA	NA
AVG11301.1\|866536_867046_+\|transposase	transposase	NA	NA	NA	NA
AVG11302.1\|867095_868142_+	aminomethyltransferase GcvT	NA	NA	NA	NA
AVG11303.1\|868153_870601_+	3-oxoacyl-[acyl-carrier-protein] synthase	NA	NA	NA	NA
AVG11304.1\|870788_871001_+	hypothetical protein	NA	NA	NA	NA
AVG11305.1\|870961_871534_+	toxin-like protein	Q331X8	Clostridium_botulinum_C_phage	4.3e-30	40.2
AVG11306.1\|871586_871778_+	toxin-like protein	NA	NA	NA	NA
AVG11307.1\|871899_873249_+	toxin-like protein	A0A1V0E026	Clostridioides_phage	9.7e-49	37.8
AVG11308.1\|873464_874688_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11309.1\|875147_875360_-	hypothetical protein	NA	NA	NA	NA
AVG11310.1\|875520_875721_+	ABC-2 family transporter protein	NA	NA	NA	NA
AVG11311.1\|875911_876508_+	hypothetical protein	NA	NA	NA	NA
AVG11312.1\|876609_877818_-	alcohol dehydrogenase GbsB	NA	NA	NA	NA
AVG11313.1\|877837_879310_-	betaine aldehyde dehydrogenase GbsA	NA	NA	NA	NA
AVG11314.1\|879374_879593_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVG11315.1\|879657_880881_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11316.1\|881180_881516_-\|transposase	transposase	NA	NA	NA	NA
AVG11317.1\|881833_882640_+	DSBA-like thioredoxin domain protein	NA	NA	NA	NA
AVG11318.1\|882775_882907_+	hypothetical protein	NA	NA	NA	NA
AVG11319.1\|883319_884807_+	phosphohydrolase	NA	NA	NA	NA
AVG11320.1\|884799_886023_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG11321.1\|887775_888999_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11322.1\|889295_889769_+	Viral enhancin protein	NA	NA	NA	NA
AVG11323.1\|890414_891143_-	Endo-1,4-beta-xylanase Z precursor	NA	NA	NA	NA
AVG11324.1\|891328_892441_+	pyruvate dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
AVG11325.1\|892490_893471_+	pyruvate dehydrogenase E1 component subunit beta	NA	NA	NA	NA
AVG11326.1\|893538_894837_+	pyruvate dehydrogenase E2 dihydrolipoamide acyltransferase component	NA	NA	NA	NA
AVG11327.1\|894841_896257_+	dihydrolipoyl dehydrogenase PdhD	NA	NA	NA	NA
AVG11328.1\|896501_897242_+	glycerophosphodiester phosphodiesterase-like protein	NA	NA	NA	NA
AVG11329.1\|897267_898245_+	glycerate dehydrogenase HprA	M1HBE3	Paramecium_bursaria_Chlorella_virus	2.9e-26	33.3
AVG11330.1\|898231_899137_-	phospholipid kinase-like protein	NA	NA	NA	NA
AVG11331.1\|899500_899833_+	hypothetical protein	NA	NA	NA	NA
AVG11332.1\|901568_902078_-\|transposase	transposase	NA	NA	NA	NA
AVG11333.1\|902095_902650_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

969818 : 1055777

111

Paenibacillus_phage(62.5%)

terminase,tRNA,coat,integrase,transposase

attL 963365:963379|attR 1044323:1045711

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
963365:963379	attL	NA	NA	NA	NA
AVG11405.1\|969818_972263_+\|tRNA	leucine--tRNA ligase LeuS	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	70.7
963365:963379	attL	NA	NA	NA	NA
AVG11406.1\|972266_973094_-	ComE operon protein 4	NA	NA	NA	NA
AVG11407.1\|973262_973796_+	membrane bound high-affinity DNA-binding receptor-like protein	NA	NA	NA	NA
AVG11408.1\|973894_975187_+	methionine gamma-lyase MdeA	A0A0B5JD48	Pandoravirus	8.5e-18	27.8
AVG11409.1\|975212_975725_+	DNA transport-associated-like protein	A0A222YXY3	Mycobacterium_phage	3.5e-23	44.9
AVG11410.1\|975866_977681_+	DNA internalization competence protein ComEC/Rec2-like protein	NA	NA	NA	NA
AVG11411.1\|977692_978925_-\|integrase	phage integrase-like protein	A0A0K2CZ62	Paenibacillus_phage	4.8e-180	75.1
AVG11412.1\|978992_979718_-	transcriptional regulator-like protein	Q786F1	Bacillus_phage	1.5e-11	42.2
AVG11413.1\|979992_980202_+	putative phage protein	Q786F1	Bacillus_phage	6.3e-08	44.3
AVG11414.1\|980341_981166_+	putative antirepressor, phage associated	A0A0C5AFE7	Paenibacillus_phage	1.1e-130	94.7
AVG11415.1\|981374_981635_+	hypothetical protein	NA	NA	NA	NA
AVG11416.1\|981611_981767_-	hypothetical protein	NA	NA	NA	NA
AVG11417.1\|981967_982345_+	hypothetical protein	R9VW30	Paenibacillus_phage	3.8e-59	89.6
AVG11418.1\|982341_982563_+	hypothetical protein	R9W0P6	Paenibacillus_phage	5.6e-31	91.8
AVG11419.1\|982700_982934_+	transition state regulatory protein AbrB	S5MA41	Brevibacillus_phage	5.8e-18	49.3
AVG11420.1\|982963_983128_+	hypothetical protein	NA	NA	NA	NA
AVG11421.1\|983156_983912_+	putative prophage antirepressor	A0A0C5AEJ9	Bacteriophage	1.5e-107	76.5
AVG11422.1\|983908_984217_+	hypothetical protein	NA	NA	NA	NA
AVG11423.1\|984252_984441_+	hypothetical protein	NA	NA	NA	NA
AVG11424.1\|984437_985214_+	putative phage anti-repressor	A0A2I7SCV5	Paenibacillus_phage	1.8e-55	73.8
AVG11425.1\|985228_985420_+	hypothetical protein	NA	NA	NA	NA
AVG11426.1\|985456_985720_+	hypothetical protein	A0A0K2CZE9	Paenibacillus_phage	2.2e-13	56.3
AVG11427.1\|985727_986159_+	hypothetical protein	A0A0K2CYQ7	Paenibacillus_phage	8.5e-07	53.7
AVG11428.1\|986155_986734_+	putative sporulation protein YyaC	G3M9W0	Bacillus_virus	1.2e-24	41.2
AVG11429.1\|986803_988432_+	hypothetical protein	R9TQJ2	Paenibacillus_phage	3.8e-225	76.6
AVG11430.1\|988435_989260_+	hypothetical protein	A0A0A7S0A9	Clostridium_phage	1.9e-87	62.8
AVG11431.1\|989240_990053_+	phage related protein	R9TMF6	Paenibacillus_phage	5.4e-111	68.9
AVG11432.1\|990068_990401_+	hypothetical protein	A0A0K2CY25	Paenibacillus_phage	5.3e-57	98.2
AVG11433.1\|990449_991337_+	Replication initiation and membrane attachment	A0A0K2CY85	Paenibacillus_phage	8.1e-153	100.0
AVG11434.1\|991299_992049_+	phage-related protein	A0A0K2CYM7	Paenibacillus_phage	4.5e-120	98.6
AVG11435.1\|992050_992161_+	hypothetical protein	A0A0K2CYR7	Paenibacillus_phage	3.5e-10	91.7
AVG11436.1\|992167_992377_+	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	5.0e-29	86.8
AVG11437.1\|992378_992753_+	endodeoxyribonuclease RUS	A0A0K2CYQ8	Paenibacillus_phage	7.6e-44	66.1
AVG11438.1\|992759_992867_+	hypothetical protein	NA	NA	NA	NA
AVG11439.1\|992943_993309_+	hypothetical protein	A0A0K2CZ58	Paenibacillus_phage	1.5e-57	86.0
AVG11440.1\|993323_993845_+	hypothetical protein	NA	NA	NA	NA
AVG11441.1\|993841_994585_+	adenine-specific DNA methylase-like protein	A0A0E3IAX4	Synechococcus_phage	6.7e-68	52.4
994487:994501	attR	NA	NA	NA	NA
AVG11442.1\|994678_994987_+	hypothetical protein	NA	NA	NA	NA
994487:994501	attR	NA	NA	NA	NA
AVG11443.1\|995449_995620_+	hypothetical protein	NA	NA	NA	NA
AVG11444.1\|995588_995939_+	positive control sigma-like factor	A0A0K2CNQ1	Brevibacillus_phage	1.1e-23	57.6
AVG11445.1\|996261_996465_+	hypothetical protein	A0A0K2CZA1	Paenibacillus_phage	2.9e-26	89.6
AVG11446.1\|996528_996702_+	hypothetical protein	A0A0K2CZI7	Paenibacillus_phage	5.6e-10	59.6
AVG11447.1\|996736_996904_+	hypothetical protein	NA	NA	NA	NA
AVG11448.1\|996962_997703_+\|terminase	phage-related terminase-like protein small subunit	A0A2H4J4R0	uncultured_Caudovirales_phage	1.4e-44	47.5
AVG11449.1\|997695_998853_+\|terminase	phage-related terminase-like protein large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.9e-138	64.2
AVG11450.1\|998845_1000069_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11451.1\|1000675_1000816_-	hypothetical protein	NA	NA	NA	NA
AVG11452.1\|1000805_1000907_-	hypothetical protein	NA	NA	NA	NA
AVG11453.1\|1000906_1002163_-	putative DNA-binding protein	A0A0K2CP77	Brevibacillus_phage	1.4e-62	35.6
AVG11454.1\|1002402_1003362_+	hypothetical protein	A0A2I7SCF1	Paenibacillus_phage	2.6e-112	89.9
AVG11455.1\|1003376_1003739_+	hypothetical protein	A0A2I7SCG2	Paenibacillus_phage	6.4e-48	79.2
AVG11456.1\|1004207_1005431_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11457.1\|1005495_1006071_+	ferrous iron transport protein B	NA	NA	NA	NA
AVG11458.1\|1006189_1007413_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11459.1\|1007541_1007841_-\|integrase	integrase family protein	NA	NA	NA	NA
AVG11460.1\|1008094_1008619_-	hypothetical protein	NA	NA	NA	NA
AVG11461.1\|1008746_1010279_-	NADH dehydrogenase AhpF	A0A2I2L5E1	Orpheovirus	4.3e-37	32.7
AVG11462.1\|1010287_1010851_-	alkyl hydroperoxide reductase subunit C	NA	NA	NA	NA
AVG11463.1\|1010994_1011162_-	Virus attachment protein p12 family protein	NA	NA	NA	NA
AVG11464.1\|1011175_1011556_-	ferrous iron transport protein B	NA	NA	NA	NA
AVG11465.1\|1011749_1012973_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11466.1\|1013322_1013526_+\|coat	spore coat-like protein	NA	NA	NA	NA
AVG11467.1\|1013544_1013847_+\|coat	Spore coat protein F precursor	NA	NA	NA	NA
AVG11468.1\|1014728_1015049_+	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVG11469.1\|1015048_1015867_+	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVG11470.1\|1016051_1016405_+	putative propanediol utilization protein	NA	NA	NA	NA
AVG11471.1\|1016416_1016818_+	putative ethanolamine/propanediol utilization protein	NA	NA	NA	NA
AVG11472.1\|1017082_1017655_+	response regulator-like protein	NA	NA	NA	NA
AVG11473.1\|1017647_1019072_+	putative sensor histidine kinase	NA	NA	NA	NA
AVG11474.1\|1019212_1019950_+	reactivating factor for ethanolamine ammonia lyase	NA	NA	NA	NA
AVG11475.1\|1020042_1020642_+	reactivating factor for ethanolamine ammonia lyase	NA	NA	NA	NA
AVG11476.1\|1020671_1022036_+	ethanolamine ammonia-lyase heavy chain EutB	NA	NA	NA	NA
AVG11477.1\|1022057_1023008_+	ethanolamine ammonia-lyase light chain EutC	NA	NA	NA	NA
AVG11478.1\|1023026_1023680_+	ethanolamine utilization protein EutL	NA	NA	NA	NA
AVG11479.1\|1023691_1024432_+	propanediol utilization protein PduA	NA	NA	NA	NA
AVG11480.1\|1024582_1026046_+	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVG11481.1\|1026095_1026383_+	propanediol utilization protein PduA	NA	NA	NA	NA
AVG11482.1\|1026527_1027355_+	ethanolamine utilization cobalamin adenosyltransferase EutT	NA	NA	NA	NA
AVG11483.1\|1027366_1028005_+	phosphate propanoyltransferase PduL	NA	NA	NA	NA
AVG11484.1\|1028023_1028707_+	putative ethanolamine utilization protein	NA	NA	NA	NA
AVG11485.1\|1028719_1028992_+	ethanolamine utilization protein EutN	NA	NA	NA	NA
AVG11486.1\|1028984_1029530_+	ethanolamine utilization protein	NA	NA	NA	NA
AVG11487.1\|1029549_1030665_+	ethanolamine utilization protein EutH	NA	NA	NA	NA
AVG11488.1\|1031002_1031842_+	methyltransferase type 11	NA	NA	NA	NA
AVG11489.1\|1031969_1032134_-	hypothetical protein	NA	NA	NA	NA
AVG11490.1\|1032181_1032343_-	hypothetical protein	NA	NA	NA	NA
AVG11491.1\|1033495_1033708_+	hypothetical protein	NA	NA	NA	NA
AVG11492.1\|1033806_1034268_+	putative DNA-binding protein	A0A0K2CP77	Brevibacillus_phage	2.0e-22	30.5
AVG11493.1\|1034264_1034396_+	hypothetical protein	NA	NA	NA	NA
AVG11494.1\|1035187_1035490_+	hypothetical protein	NA	NA	NA	NA
AVG11495.1\|1035506_1036031_+	putative integral membrane protein	NA	NA	NA	NA
AVG11496.1\|1036100_1036514_+	hypothetical protein	NA	NA	NA	NA
AVG11497.1\|1036785_1037088_-	hypothetical protein	NA	NA	NA	NA
AVG11498.1\|1037473_1037911_+	hypothetical protein	NA	NA	NA	NA
AVG11499.1\|1038185_1038824_+	transcriptional regulatory protein	NA	NA	NA	NA
AVG11500.1\|1038823_1039006_+	hypothetical protein	NA	NA	NA	NA
AVG11501.1\|1039112_1040174_+	selenide, water dikinase	NA	NA	NA	NA
AVG11502.1\|1040228_1041281_+\|tRNA	tRNA 2-selenouridine synthase SelU	NA	NA	NA	NA
AVG11503.1\|1041541_1042012_+	hypothetical protein	NA	NA	NA	NA
AVG11504.1\|1042074_1042452_+	Gas vesicle protein	NA	NA	NA	NA
AVG11505.1\|1043114_1044338_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11506.1\|1044621_1045194_-	putative ribosomal-protein-alanine acetyltransferase YjcK	D0R097	Streptococcus_phage	1.1e-06	28.3
AVG11507.1\|1045363_1046047_+\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	2.6e-18	32.7
AVG11508.1\|1046815_1048039_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11509.1\|1049128_1050427_+	alpha-galactosidase MelA	NA	NA	NA	NA
AVG11510.1\|1050728_1050998_-	Exopolysaccharide biosynthesis protein related to N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase	NA	NA	NA	NA
AVG11511.1\|1051175_1051322_+	hypothetical protein	A0A0C5ABC9	Paenibacillus_phage	3.1e-09	97.4
AVG11512.1\|1051539_1051737_+\|transposase	putative transposase InsK for insertion sequence element IS150	NA	NA	NA	NA
AVG11513.1\|1051729_1052953_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11514.1\|1053833_1054526_-	ankyrin-repeat containing protein	A0A2I7SC07	Paenibacillus_phage	8.9e-99	90.1
AVG11515.1\|1054553_1055777_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8

DBSCAN-SWA_11

1062848 : 1113724

Paenibacillus_phage(40.0%)

transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11525.1\|1062848_1064072_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11526.1\|1064233_1064581_+	hypothetical protein	NA	NA	NA	NA
AVG11527.1\|1064678_1065794_-	permease-like protein	NA	NA	NA	NA
AVG11528.1\|1065807_1066560_-	methionine aminopeptidase Map	NA	NA	NA	NA
AVG11529.1\|1066817_1067120_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
AVG11530.1\|1067119_1067344_+	hypothetical protein	NA	NA	NA	NA
AVG11531.1\|1067874_1068948_+	hypothetical protein	NA	NA	NA	NA
AVG11532.1\|1069057_1070212_-	putative RNA methyltransferase YpsC	NA	NA	NA	NA
AVG11533.1\|1070328_1070964_+	acyl-CoA O-methyltransferase-like protein	NA	NA	NA	NA
AVG11534.1\|1071015_1072233_-	multidrug resistance protein MdtG	NA	NA	NA	NA
AVG11535.1\|1072430_1073006_+\|coat	spore coat protein	NA	NA	NA	NA
AVG11536.1\|1073223_1074447_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11537.1\|1074474_1075158_+	ankyrin-repeat containing protein	A0A0K2CZQ0	Paenibacillus_phage	6.9e-11	96.8
AVG11538.1\|1075241_1075982_-	putative N-acetylmannosaminyltransferase TarA	NA	NA	NA	NA
AVG11539.1\|1076177_1077032_+	hypothetical protein	NA	NA	NA	NA
AVG11540.1\|1077082_1077334_-	guanine/hypoxanthine permease PbuO	NA	NA	NA	NA
AVG11541.1\|1077330_1077576_-	guanine/hypoxanthine permease PbuO	A0A0R6PHV4	Moraxella_phage	9.7e-08	49.1
AVG11542.1\|1077575_1078382_-	guanine/hypoxanthine permease PbuO	A0A0R6PHV4	Moraxella_phage	1.3e-21	34.7
AVG11543.1\|1078474_1078834_-	putative integral membrane protein	NA	NA	NA	NA
AVG11544.1\|1078896_1080687_-	oligoendopeptidase F-like protein	A0A1X9I5X5	Streptococcus_phage	1.9e-55	26.8
AVG11545.1\|1081304_1082159_-	integral membrane protein, YjbE family	W8EBD0	Pseudomonas_phage	1.2e-23	36.3
AVG11546.1\|1082455_1082689_-	hypothetical protein	NA	NA	NA	NA
AVG11547.1\|1082888_1083086_+	cold shock protein CspB	Q9AZD3	Lactococcus_phage	7.5e-19	67.7
AVG11548.1\|1083292_1084033_+	putative transcriptional regulatory protein	NA	NA	NA	NA
AVG11549.1\|1084090_1084735_-	oxidoreductase-like protein	NA	NA	NA	NA
AVG11550.1\|1085084_1085381_+	serine hydroxymethyltransferase	NA	NA	NA	NA
AVG11551.1\|1085648_1086158_+	hypothetical protein	NA	NA	NA	NA
AVG11552.1\|1086159_1087239_+	Tetraprenyl-beta-curcumene synthase	NA	NA	NA	NA
AVG11553.1\|1087283_1088249_+	6-phosphofructokinase PfkA	NA	NA	NA	NA
AVG11554.1\|1088482_1088692_+	hypothetical protein	NA	NA	NA	NA
AVG11555.1\|1088724_1089276_+	oxidoreductase NAD-like protein	NA	NA	NA	NA
AVG11556.1\|1089685_1091092_+	cytochrome d ubiquinol oxidase subunit 1	NA	NA	NA	NA
AVG11557.1\|1091075_1092092_+	cytochrome d ubiquinol oxidase subunit 2	NA	NA	NA	NA
AVG11558.1\|1092091_1093816_+	ATP-binding/permease protein CydC	W8CYL7	Bacillus_phage	1.5e-25	24.7
AVG11559.1\|1093812_1095570_+	ATP-binding/permease protein CydD	W8CYL7	Bacillus_phage	6.3e-24	26.3
AVG11560.1\|1095667_1095904_-	Sec-independent protein translocase protein TatA	NA	NA	NA	NA
AVG11561.1\|1096152_1096341_-	hypothetical protein	NA	NA	NA	NA
AVG11562.1\|1096485_1097307_-	putative membrane protein	NA	NA	NA	NA
AVG11563.1\|1097493_1098717_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11564.1\|1098926_1099502_+	putative HTH-type transcriptional regulator YhgD	NA	NA	NA	NA
AVG11565.1\|1099799_1100468_-	putative lipoprotein	NA	NA	NA	NA
AVG11566.1\|1100496_1101030_-	hypothetical protein	NA	NA	NA	NA
AVG11567.1\|1101401_1102919_+	DEAD-box ATP-dependent RNA helicase CshA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.4e-64	37.9
AVG11568.1\|1103034_1103754_+	putative integral membrane protein	NA	NA	NA	NA
AVG11569.1\|1104213_1104870_+	putative transaldolase Tal	A0A0E3F5V4	Synechococcus_phage	1.1e-50	47.7
AVG11570.1\|1104905_1105913_+	fructose-1,6-bisphosphatase class 2	NA	NA	NA	NA
AVG11571.1\|1106147_1107299_+	putative manganese transport protein MntH	NA	NA	NA	NA
AVG11572.1\|1107536_1108760_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11573.1\|1109108_1109498_+	hypothetical protein	NA	NA	NA	NA
AVG11574.1\|1109582_1110101_-	putative thiol peroxidase Tpx	NA	NA	NA	NA
AVG11575.1\|1110246_1111176_+	HTH-type transcriptional regulator GltC	NA	NA	NA	NA
AVG11576.1\|1111193_1111886_-\|protease	putative membrane protease YugP	NA	NA	NA	NA
AVG11577.1\|1111919_1112327_-	copper efflux transcriptional regulator-like protein	NA	NA	NA	NA
AVG11578.1\|1112500_1113724_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_12

1151058 : 1194569

Paenibacillus_phage(23.08%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11613.1\|1151058_1151649_-\|transposase	putative transposase	NA	NA	NA	NA
AVG11614.1\|1151740_1152385_-	hypothetical protein	NA	NA	NA	NA
AVG11615.1\|1152668_1153892_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11616.1\|1154274_1154568_-	hypothetical protein	NA	NA	NA	NA
AVG11617.1\|1154888_1155215_+	permease-like protein	NA	NA	NA	NA
AVG11618.1\|1155355_1156321_+	manganese-binding lipoprotein MntA	NA	NA	NA	NA
AVG11619.1\|1156357_1157089_+	manganese transport system ATP-binding protein MntB	A0A2R8FG22	Brazilian_cedratvirus	1.3e-15	30.9
AVG11620.1\|1157142_1158075_+	manganese transport system membrane protein MntC	NA	NA	NA	NA
AVG11621.1\|1158071_1158953_+	manganese transport system membrane protein MntD	NA	NA	NA	NA
AVG11622.1\|1159307_1160633_+	branched-chain amino acid transport system carrier protein BraB	NA	NA	NA	NA
AVG11623.1\|1161055_1162279_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11624.1\|1162460_1162823_+	hypothetical protein	NA	NA	NA	NA
AVG11625.1\|1162991_1163231_+	hypothetical protein	NA	NA	NA	NA
AVG11626.1\|1163366_1163639_-	hypothetical protein	NA	NA	NA	NA
AVG11627.1\|1163746_1163998_+	hypothetical protein	NA	NA	NA	NA
AVG11628.1\|1164034_1164226_+	hypothetical protein	NA	NA	NA	NA
AVG11629.1\|1164299_1164656_+	carboxymuconolactone decarboxylase	NA	NA	NA	NA
AVG11630.1\|1164751_1165051_-	hypothetical protein	NA	NA	NA	NA
AVG11631.1\|1165233_1166664_+	dihydrolipoamide dehydrogenase	NA	NA	NA	NA
AVG11632.1\|1166763_1167762_+	2-oxoisovalerate dehydrogenase subunit alpha	NA	NA	NA	NA
AVG11633.1\|1167780_1168761_+	2-oxoisovalerate dehydrogenase subunit beta	NA	NA	NA	NA
AVG11634.1\|1168781_1170143_+	branched-chain alpha-keto acid dehydrogenase component lipoamide acyltransferase	NA	NA	NA	NA
AVG11635.1\|1170321_1171446_+	peptidase T	NA	NA	NA	NA
AVG11636.1\|1171438_1172062_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	3.7e-35	43.8
AVG11637.1\|1172254_1172914_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	2.2e-62	54.3
AVG11638.1\|1173216_1174173_+	transcriptional regulator LytR-like protein	NA	NA	NA	NA
AVG11639.1\|1174192_1174369_-	hypothetical protein	NA	NA	NA	NA
AVG11640.1\|1174484_1175039_+	ADP-ribose pyrophosphatase NudF	A0A1S6L1P8	Vibrio_phage	3.5e-05	30.8
AVG11641.1\|1175041_1176235_+	hypothetical protein	NA	NA	NA	NA
AVG11642.1\|1176467_1177112_+	stage II sporulation protein M	NA	NA	NA	NA
AVG11643.1\|1177211_1177697_+	ferric uptake regulation protein Fur	NA	NA	NA	NA
AVG11644.1\|1178003_1179125_+	alanine dehydrogenase Ald	NA	NA	NA	NA
AVG11645.1\|1179190_1179424_+	hypothetical protein	NA	NA	NA	NA
AVG11646.1\|1179520_1180417_+	tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	4.6e-39	32.4
AVG11647.1\|1180577_1181753_+	phosphopentomutase DeoB	NA	NA	NA	NA
AVG11648.1\|1181821_1182646_+	purine nucleoside phosphorylase 1	Q5YFI9	Singapore_grouper_iridovirus	6.1e-62	43.4
AVG11649.1\|1182662_1183520_+	purine nucleoside phosphorylase 1	Q5YBA4	Grouper_iridovirus	1.4e-53	38.4
AVG11650.1\|1183769_1184147_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
AVG11651.1\|1184206_1184443_+	pyrimidine-nucleoside phosphorylase Pdp	A0A0H3UZD4	Geobacillus_virus	1.3e-09	70.5
AVG11652.1\|1184492_1185176_-	putative membrane protein	NA	NA	NA	NA
AVG11653.1\|1185172_1186066_-	Nod factor export ATP-binding protein I	W6JKT0	Anomala_cuprea_entomopoxvirus	6.9e-27	39.8
AVG11654.1\|1186049_1186868_-	putative membrane protein	NA	NA	NA	NA
AVG11655.1\|1186842_1187412_-	RNA polymerase, sigma-24 subunit, ECF subfamily	NA	NA	NA	NA
AVG11656.1\|1187568_1188747_+	D-alanyl-D-alanine carboxypeptidase DacF	NA	NA	NA	NA
AVG11657.1\|1188862_1189222_+	anti-sigma F factor antagonist	NA	NA	NA	NA
AVG11658.1\|1189218_1189674_+	anti-sigma F factor	NA	NA	NA	NA
AVG11659.1\|1189685_1190441_+	RNA polymerase sigma-F factor SigF	A0A0A0RV91	Bacillus_phage	1.0e-63	54.5
AVG11660.1\|1191280_1191721_+	hypothetical protein	NA	NA	NA	NA
AVG11661.1\|1191710_1191812_+	hypothetical protein	NA	NA	NA	NA
AVG11662.1\|1192088_1192370_+	hypothetical protein	NA	NA	NA	NA
AVG11663.1\|1192362_1193226_+	nitrate reductase alpha chain NarG	NA	NA	NA	NA
AVG11664.1\|1193345_1194569_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_13

1206022 : 1214111

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11673.1\|1206022_1207246_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11674.1\|1207355_1207793_+	peptidyl-prolyl cis-trans isomerase B	A0A1B1IVS0	uncultured_Mediterranean_phage	1.6e-21	45.3
AVG11675.1\|1208716_1209850_+	riboflavin biosynthesis protein RibD	A0A2H4PQS8	Staphylococcus_phage	1.6e-52	35.5
AVG11676.1\|1209853_1210519_+	riboflavin synthase alpha chain RibE	A0A2H4PQS5	Staphylococcus_phage	3.4e-39	43.3
AVG11677.1\|1210553_1211783_+	riboflavin biosynthesis protein RibBA	A0A2H4PQS2	Staphylococcus_phage	8.1e-111	51.0
AVG11678.1\|1211817_1212288_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.2e-43	57.9
AVG11679.1\|1212718_1213501_+	segregation and condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.7e-09	34.2
AVG11680.1\|1213466_1214111_+	segregation and condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	8.2e-14	31.9

DBSCAN-SWA_14

1230139 : 1280721

Paenibacillus_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11697.1\|1230139_1230760_+\|protease	CAAX amino terminal protease self- immunity	NA	NA	NA	NA
AVG11698.1\|1230765_1230978_+	hypothetical protein	NA	NA	NA	NA
AVG11699.1\|1231160_1231460_+	hypothetical protein	NA	NA	NA	NA
AVG11700.1\|1231684_1232293_+	adaptor-like protein	NA	NA	NA	NA
AVG11701.1\|1232429_1233680_+	NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AVG11702.1\|1233720_1234410_+\|protease	protease PrsW	NA	NA	NA	NA
AVG11703.1\|1234473_1234632_+	hypothetical protein	NA	NA	NA	NA
AVG11704.1\|1234811_1236164_+	sporulation protein YpeB	NA	NA	NA	NA
AVG11705.1\|1236341_1237565_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11706.1\|1237795_1237984_+	hypothetical protein	NA	NA	NA	NA
AVG11707.1\|1237990_1239214_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG11708.1\|1239372_1239846_+	cyclic diGMP binding-like domain-containing protein	NA	NA	NA	NA
AVG11709.1\|1239910_1240153_+	hypothetical protein	NA	NA	NA	NA
AVG11710.1\|1240258_1240939_+	cytidylate kinase Cmk	NA	NA	NA	NA
AVG11711.1\|1240941_1241526_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AVG11712.1\|1241666_1242902_+	30S ribosomal S1-like protein	NA	NA	NA	NA
AVG11713.1\|1242938_1243988_+	isopentenyl-diphosphate delta-isomerase Fni	NA	NA	NA	NA
AVG11714.1\|1244149_1244773_+	hypothetical protein	NA	NA	NA	NA
AVG11715.1\|1244772_1245672_+	hypothetical protein	NA	NA	NA	NA
AVG11716.1\|1245686_1245866_+	hypothetical protein	NA	NA	NA	NA
AVG11717.1\|1245970_1247293_+	ribosome-associated GTPase	NA	NA	NA	NA
AVG11718.1\|1247305_1247899_+	glycerol-3-phosphate acyltransferase PlsY	NA	NA	NA	NA
AVG11719.1\|1247946_1248993_+	glycerol-3-phosphate dehydrogenase (NAD(P)+)	NA	NA	NA	NA
AVG11720.1\|1249073_1249355_+	hypothetical protein	NA	NA	NA	NA
AVG11721.1\|1249544_1249844_+	Benzoate 1,2-dioxygenase electron transfer component	NA	NA	NA	NA
AVG11722.1\|1250507_1250861_+	Na(+)-translocating NADH-quinone reductase subunit F	NA	NA	NA	NA
AVG11723.1\|1250854_1251649_+	putative lipoprotein	NA	NA	NA	NA
AVG11724.1\|1252206_1253685_+	stage IV sporulation protein A	NA	NA	NA	NA
AVG11725.1\|1253975_1254248_+	DNA-binding protein HU 1	A7KV42	Bacillus_phage	1.2e-27	72.2
AVG11726.1\|1254747_1254906_+	hypothetical protein	NA	NA	NA	NA
AVG11727.1\|1255006_1255225_+	MtrB-like protein	NA	NA	NA	NA
AVG11728.1\|1255356_1255899_+	hypothetical protein	NA	NA	NA	NA
AVG11729.1\|1255986_1256850_+	heptaprenyl diphosphate synthase component I-like protein	NA	NA	NA	NA
AVG11730.1\|1256861_1257569_+	demethylmenaquinone methyltransferase UbiE	NA	NA	NA	NA
AVG11731.1\|1257638_1258517_+	putative 4-hydroxybenzoate polyprenyltransferase	NA	NA	NA	NA
AVG11732.1\|1258517_1259117_+	phenolic acid decarboxylase subunit B	NA	NA	NA	NA
AVG11733.1\|1259106_1259949_+	putative periplasmic solute-binding protein	NA	NA	NA	NA
AVG11734.1\|1259970_1260945_+	heptaprenyl diphosphate synthase component 2	NA	NA	NA	NA
AVG11735.1\|1260999_1262223_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11736.1\|1262449_1262893_+	nucleoside diphosphate kinase Ndk	D2E8E1	Anguillid_herpesvirus	8.4e-26	44.3
AVG11737.1\|1263038_1263821_+	chemotaxis protein methyltransferase CheR	NA	NA	NA	NA
AVG11738.1\|1263917_1264085_+	hypothetical protein	NA	NA	NA	NA
AVG11739.1\|1264262_1265426_+	chorismate synthase AroC	A0A291AU41	Pandoravirus	3.8e-41	36.0
AVG11740.1\|1265427_1266534_+	3-dehydroquinate synthase AroB	NA	NA	NA	NA
AVG11741.1\|1266536_1266914_+	chorismate mutase AroH	NA	NA	NA	NA
AVG11742.1\|1267250_1268807_+	anthranilate synthase component 1	NA	NA	NA	NA
AVG11743.1\|1268827_1269874_+	anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.1e-68	41.8
AVG11744.1\|1269863_1270661_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	8.3e-48	42.8
AVG11745.1\|1270707_1271412_+	N-(5'-phosphoribosyl)anthranilate isomerase TrpF	NA	NA	NA	NA
AVG11746.1\|1271404_1272601_+	tryptophan synthase beta chain TrpB	NA	NA	NA	NA
AVG11747.1\|1272597_1273410_+	tryptophan synthase alpha chain TrpA	NA	NA	NA	NA
AVG11748.1\|1273431_1274532_+	histidinol-phosphate aminotransferase HisC	A0A1X6WGT4	Pacmanvirus	4.0e-24	28.1
AVG11749.1\|1274528_1275614_+	prephenate dehydrogenase TyrA	NA	NA	NA	NA
AVG11750.1\|1275919_1276516_+	putative phosphatase PhoE	NA	NA	NA	NA
AVG11751.1\|1276694_1277825_+	hypothetical protein	NA	NA	NA	NA
AVG11752.1\|1277883_1278405_+	bacterial transferase hexapeptide repeat protein	NA	NA	NA	NA
AVG11753.1\|1278456_1278642_+	hypothetical protein	NA	NA	NA	NA
AVG11754.1\|1278714_1279392_+	hypothetical protein	NA	NA	NA	NA
AVG11755.1\|1279548_1280721_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	5.6e-218	99.7

DBSCAN-SWA_15

1304092 : 1426642

113

Paenibacillus_phage(40.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG11781.1\|1304092_1305643_+\|protease	ATP-dependent zinc metalloprotease FtsH 1	E5EQU5	Bathycoccus_sp._RCC1105_virus	1.8e-78	41.2
AVG11782.1\|1305873_1306746_+	3-hydroxybutyryl-CoA dehydrogenase Hbd	NA	NA	NA	NA
AVG11783.1\|1306742_1307948_+	acetate kinase AckA	NA	NA	NA	NA
AVG11784.1\|1308021_1309320_+\|tRNA	asparagine--tRNA ligase AsnS	A0A2P1EMB4	Moumouvirus	1.3e-61	30.5
AVG11785.1\|1309344_1310016_+	DNA-remodelling primosomal-like protein	A0A0N7AE27	Bacillus_phage	8.9e-19	46.1
AVG11786.1\|1310100_1310769_-	GTP pyrophosphokinase YwaC	NA	NA	NA	NA
AVG11787.1\|1310876_1310993_-	LexA repressor-like protein	NA	NA	NA	NA
AVG11788.1\|1311057_1312281_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11789.1\|1312356_1313022_-	methylthioribulose-1-phosphate dehydratase MtnB	NA	NA	NA	NA
AVG11790.1\|1313035_1313671_-	2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphate phosphatase MtnX	NA	NA	NA	NA
AVG11791.1\|1313667_1315005_-	2,3-diketo-5-methylthiopentyl-1-phosphate enolase	NA	NA	NA	NA
AVG11792.1\|1315008_1315866_-	pyrroline-5-carboxylate reductase 1	NA	NA	NA	NA
AVG11793.1\|1316008_1317256_-	gamma-glutamyl phosphate reductase ProA	A0A1X9I5D4	Streptococcus_phage	8.3e-103	50.4
AVG11794.1\|1317277_1318399_-	glutamate 5-kinase ProB	A0A1X9I5D0	Streptococcus_phage	4.4e-79	43.1
AVG11795.1\|1318820_1319885_-	LL-diaminopimelate aminotransferase DapL	NA	NA	NA	NA
AVG11796.1\|1319886_1320015_-	hypothetical protein	NA	NA	NA	NA
AVG11797.1\|1320167_1321013_+	nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase	NA	NA	NA	NA
AVG11798.1\|1321083_1321266_+	hypothetical protein	NA	NA	NA	NA
AVG11799.1\|1321222_1321444_+	stage II sporulation protein E	W8CYM9	Bacillus_phage	4.1e-05	37.1
AVG11800.1\|1321430_1322528_+	ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein	A0A1V0SGX0	Hokovirus	3.8e-51	48.8
AVG11801.1\|1322957_1323380_+	putative protein containing a divergent version of the methyl-accepting chemotaxis-like domain protein	NA	NA	NA	NA
AVG11802.1\|1323460_1323796_+	stage II sporulation protein	NA	NA	NA	NA
AVG11803.1\|1323816_1324266_+	putative anti-sigma B factor	NA	NA	NA	NA
AVG11804.1\|1324262_1325045_+	RNA polymerase sigma-B factor SigB	A0A173GBT3	Bacillus_phage	1.2e-14	26.0
AVG11805.1\|1325365_1326274_-	LysR substrate binding domain protein	NA	NA	NA	NA
AVG11806.1\|1326421_1327843_+	3-isopropylmalate dehydratase large subunit LeuC	NA	NA	NA	NA
AVG11807.1\|1327872_1328481_+	3-isopropylmalate dehydratase small subunit LeuD	NA	NA	NA	NA
AVG11808.1\|1328698_1330033_+	N-acetylmuramoyl-L-alanine amidase	Q0H257	Geobacillus_phage	1.4e-20	39.7
AVG11809.1\|1330046_1330634_+	Spore germination protein	NA	NA	NA	NA
AVG11810.1\|1330853_1331519_+	putative endonuclease III	NA	NA	NA	NA
AVG11811.1\|1331580_1331853_+	hypothetical protein	NA	NA	NA	NA
AVG11812.1\|1331906_1335587_+	dynamin family protein	NA	NA	NA	NA
AVG11813.1\|1336653_1336938_+	Lipid A export ATP-binding/permease protein MsbA	NA	NA	NA	NA
AVG11814.1\|1337258_1338071_+	exported lipase-like protein	NA	NA	NA	NA
AVG11815.1\|1338118_1339096_+	bacitracin ABC transporter, ATP-binding protein BcrA	A0A2H4PQG7	Staphylococcus_phage	4.0e-36	36.4
AVG11816.1\|1339088_1340081_+	putative membrane protein	NA	NA	NA	NA
AVG11817.1\|1340108_1342082_+	DNA topoisomerase 4 subunit B	G3M9Z3	Bacillus_virus	1.7e-126	42.5
AVG11818.1\|1342143_1344603_+	DNA topoisomerase 4 subunit A	G3M9Z5	Bacillus_virus	4.3e-111	35.0
AVG11819.1\|1344667_1345531_-	transcriptional regulatory protein	NA	NA	NA	NA
AVG11820.1\|1345720_1346299_+	putative oxidoreductase	NA	NA	NA	NA
AVG11821.1\|1346305_1347529_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11822.1\|1347556_1348120_+	putative transcriptional regulatory protein YclJ	A0A0K2CZQ0	Paenibacillus_phage	4.4e-11	96.8
AVG11823.1\|1348164_1349097_+	aldo/keto reductase	NA	NA	NA	NA
AVG11824.1\|1349116_1350265_-	ABC transporter-like protein	NA	NA	NA	NA
AVG11825.1\|1350282_1351068_-	ABC transporter	A0A2H4PQG7	Staphylococcus_phage	5.7e-17	32.3
AVG11826.1\|1351064_1351205_-	hypothetical protein	NA	NA	NA	NA
AVG11827.1\|1351236_1351992_-	ABC-type transport system involved in multi-copper enzyme maturation, permease component	NA	NA	NA	NA
AVG11828.1\|1352007_1352706_-	ABC transporter-like protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-12	22.5
AVG11829.1\|1352702_1353095_-	transcriptional regulatory protein	NA	NA	NA	NA
AVG11830.1\|1353282_1353519_-	Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase	NA	NA	NA	NA
AVG11831.1\|1353757_1353982_+	hypothetical protein	NA	NA	NA	NA
AVG11832.1\|1353978_1354509_+	hypothetical protein	NA	NA	NA	NA
AVG11833.1\|1356225_1357449_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11834.1\|1357682_1366079_+	glycosyltransferase family 36 protein	NA	NA	NA	NA
AVG11835.1\|1366387_1367107_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	7.8e-130	99.2
AVG11836.1\|1367087_1367600_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	7.3e-82	100.0
AVG11837.1\|1367664_1367805_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVG11838.1\|1367836_1368175_-	hypothetical protein	NA	NA	NA	NA
AVG11839.1\|1368351_1369575_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11840.1\|1370370_1370775_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG11841.1\|1370785_1371517_-	pseudouridine synthase, RluA family	NA	NA	NA	NA
AVG11842.1\|1371520_1372387_-	ribosomal RNA large subunit methyltransferase I	NA	NA	NA	NA
AVG11843.1\|1372590_1374525_+	1,4-alpha-glucan-branching enzyme	NA	NA	NA	NA
AVG11844.1\|1374521_1375670_+	glucose-1-phosphate adenylyltransferase GlgC	NA	NA	NA	NA
AVG11845.1\|1375676_1376786_+	glycogen biosynthesis protein GlgD	NA	NA	NA	NA
AVG11846.1\|1376816_1378262_+	glycogen synthase GlgA	NA	NA	NA	NA
AVG11847.1\|1378434_1378569_+	hypothetical protein	NA	NA	NA	NA
AVG11848.1\|1378737_1378968_+	hypothetical protein	NA	NA	NA	NA
AVG11849.1\|1379106_1380330_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11850.1\|1380688_1380979_+\|transposase	transposase	NA	NA	NA	NA
AVG11851.1\|1381021_1382245_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11852.1\|1382725_1383301_+	hypothetical protein	NA	NA	NA	NA
AVG11853.1\|1383430_1383616_+	hypothetical protein	NA	NA	NA	NA
AVG11854.1\|1383890_1385495_-	Alpha-galactosidase	NA	NA	NA	NA
AVG11855.1\|1385760_1386984_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11856.1\|1387152_1387569_+	Nitric oxide dioxygenase	NA	NA	NA	NA
AVG11857.1\|1387569_1388376_+	Nitric oxide dioxygenase	NA	NA	NA	NA
AVG11858.1\|1388711_1389953_+	arginine deiminase ArcA	NA	NA	NA	NA
AVG11859.1\|1389970_1390969_+	ornithine carbamoyltransferase, catabolic	NA	NA	NA	NA
AVG11860.1\|1391065_1392481_+	arginine/ornithine antiporter ArcD	NA	NA	NA	NA
AVG11861.1\|1392497_1393451_+	carbamate kinase ArcC	NA	NA	NA	NA
AVG11862.1\|1393489_1394176_+	cAMP-binding protein	NA	NA	NA	NA
AVG11863.1\|1394231_1394729_-	cAMP-binding protein	NA	NA	NA	NA
AVG11864.1\|1395222_1395390_+	L-gulono-1,4-lactone dehydrogenase	NA	NA	NA	NA
AVG11865.1\|1395463_1395889_-	putative ribosomal protein	NA	NA	NA	NA
AVG11866.1\|1396017_1396881_-	copper amine oxidase-like protein	NA	NA	NA	NA
AVG11867.1\|1397222_1398254_-	putative membrane protein	NA	NA	NA	NA
AVG11868.1\|1398486_1398921_+	hypothetical protein	NA	NA	NA	NA
AVG11869.1\|1399026_1399350_+	hypothetical protein	NA	NA	NA	NA
AVG11870.1\|1400144_1400411_+	hypothetical protein	NA	NA	NA	NA
AVG11871.1\|1400575_1402339_+	hypothetical protein	NA	NA	NA	NA
AVG11872.1\|1402653_1403316_+	ATP-binding protein CirD	A0A2H4PQG7	Staphylococcus_phage	1.4e-13	28.1
AVG11873.1\|1403321_1403483_+	hypothetical protein	NA	NA	NA	NA
AVG11874.1\|1403533_1405204_+	HTH-type transcriptional activator Btr	NA	NA	NA	NA
AVG11875.1\|1405300_1406278_+	iron-uptake system-binding protein FeuA	NA	NA	NA	NA
AVG11876.1\|1406285_1407296_+	iron-uptake system permease protein FeuB	NA	NA	NA	NA
AVG11877.1\|1407288_1408317_+	iron-uptake system permease protein FeuC	NA	NA	NA	NA
AVG11878.1\|1408499_1409723_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11879.1\|1410059_1411241_+	GlcNAc-binding protein A	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.7e-26	38.9
AVG11880.1\|1411408_1412245_+	transcriptional regulator, XRE family	NA	NA	NA	NA
AVG11881.1\|1412307_1413183_-	ferri-bacillibactin esterase BesA	NA	NA	NA	NA
AVG11882.1\|1413330_1414548_-	cytochrome P450	NA	NA	NA	NA
AVG11883.1\|1415031_1416912_+	ATP-dependent OLD family endonuclease	NA	NA	NA	NA
AVG11884.1\|1416998_1417319_-	hypothetical protein	NA	NA	NA	NA
AVG11885.1\|1417688_1417928_+	type I restriction enzyme EcoKI subunit R-like protein	NA	NA	NA	NA
AVG11886.1\|1417924_1418488_+	type I restriction enzyme EcoKI subunit R-like protein	NA	NA	NA	NA
AVG11887.1\|1418484_1419717_+	type-1 restriction enzyme StySJI specificity protein HsdS	NA	NA	NA	NA
AVG11888.1\|1420448_1420790_+	hypothetical protein	NA	NA	NA	NA
AVG11889.1\|1420930_1422154_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG11890.1\|1422275_1424357_+	Thioredoxin-related protein	NA	NA	NA	NA
AVG11891.1\|1424511_1425243_-	hypothetical protein	NA	NA	NA	NA
AVG11892.1\|1425290_1426040_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG11893.1\|1426129_1426642_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8

DBSCAN-SWA_16

1543073 : 1649462

113

Paenibacillus_phage(56.0%)

protease,tRNA,coat,integrase,transposase

attL 1586387:1586446|attR 1594149:1595536

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12011.1\|1543073_1544363_-\|tRNA	seryl-tRNA ligase SerS	A0A1B1IVT2	uncultured_Mediterranean_phage	4.8e-53	31.5
AVG12012.1\|1545300_1546743_+	lysine-specific permease LysP	NA	NA	NA	NA
AVG12013.1\|1547080_1547347_+\|coat	inner spore coat-like protein	NA	NA	NA	NA
AVG12014.1\|1547734_1548358_+	hypothetical protein	NA	NA	NA	NA
AVG12015.1\|1548466_1548685_+	hypothetical protein	NA	NA	NA	NA
AVG12016.1\|1549494_1550391_+	polysaccharide deacetylase	NA	NA	NA	NA
AVG12017.1\|1550550_1551756_+	efflux transporter-like protein	A0A2H4PQR6	Staphylococcus_phage	3.1e-99	45.1
AVG12018.1\|1551827_1552499_-	Yip1 domain protein	NA	NA	NA	NA
AVG12019.1\|1552515_1553043_-	integral membrane protein	NA	NA	NA	NA
AVG12020.1\|1553039_1553234_-	hypothetical protein	NA	NA	NA	NA
AVG12021.1\|1553234_1553987_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-23	31.8
AVG12022.1\|1553974_1554619_-	hypothetical protein	NA	NA	NA	NA
AVG12023.1\|1554851_1556075_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12024.1\|1556545_1556980_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG12025.1\|1557053_1557701_+	hypothetical protein	NA	NA	NA	NA
AVG12026.1\|1557856_1558120_+	uridylate kinase-like protein	NA	NA	NA	NA
AVG12027.1\|1558343_1559081_-	hypothetical protein	NA	NA	NA	NA
AVG12028.1\|1559365_1560655_+	Hemolysin C	NA	NA	NA	NA
AVG12029.1\|1561087_1561990_+	phenazine biosynthesis protein PhzF	NA	NA	NA	NA
AVG12030.1\|1562410_1562773_+	hypothetical protein	NA	NA	NA	NA
AVG12031.1\|1562857_1563637_+	putative disulfide bond formation protein	NA	NA	NA	NA
AVG12032.1\|1563725_1564559_+	HAD-superfamily hydrolase	NA	NA	NA	NA
AVG12033.1\|1564767_1565202_+	acetyltransferase, GNAT family	NA	NA	NA	NA
AVG12034.1\|1565797_1566487_-\|transposase	putative transposase	NA	NA	NA	NA
AVG12035.1\|1566585_1567617_-	HTH-type transcriptional regulator MalR	NA	NA	NA	NA
AVG12036.1\|1568016_1569300_+	maltose/maltodextrin-binding protein MalX	NA	NA	NA	NA
AVG12037.1\|1569382_1570696_+	putative arabinogalactan oligomer transport system permease protein GanP	NA	NA	NA	NA
AVG12038.1\|1570692_1571538_+	putative arabinogalactan oligomer transport system permease protein GanQ	NA	NA	NA	NA
AVG12039.1\|1571603_1572020_-	hypothetical protein	NA	NA	NA	NA
AVG12040.1\|1572204_1572699_+	spermine/spermidine acetyltransferase	NA	NA	NA	NA
AVG12041.1\|1572765_1573839_+	putative nitronate monooxygenase	NA	NA	NA	NA
AVG12042.1\|1574070_1575351_+	hydroxylamine reductase Hcp	NA	NA	NA	NA
AVG12043.1\|1575455_1576679_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12044.1\|1576873_1577800_-	UDP-N-acetylenolpyruvoylglucosamine reductase MurB	NA	NA	NA	NA
AVG12045.1\|1578012_1578237_-	hypothetical protein	NA	NA	NA	NA
AVG12046.1\|1578725_1579088_+	hypothetical protein	NA	NA	NA	NA
AVG12047.1\|1579124_1580600_-	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
AVG12048.1\|1580790_1581072_+	hypothetical protein	NA	NA	NA	NA
AVG12049.1\|1581032_1581743_+	D-alanyl-D-alanine carboxypeptidase DacB	A0A1P8VVG5	Erythrobacter_phage	1.7e-07	31.5
AVG12050.1\|1581821_1581995_+	hypothetical protein	NA	NA	NA	NA
AVG12051.1\|1582106_1582985_-	D-tagatose-1,6-bisphosphate aldolase subunit GatY	NA	NA	NA	NA
AVG12052.1\|1583042_1584476_-	PTS system fructose-specific EIIABC component FruA	NA	NA	NA	NA
AVG12053.1\|1584475_1585405_-	1-phosphofructokinase FruK	NA	NA	NA	NA
AVG12054.1\|1585575_1586358_+	phosphosugar-binding transcriptional regulator	NA	NA	NA	NA
1586387:1586446	attL	NA	NA	NA	NA
AVG12055.1\|1586430_1587654_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12056.1\|1587718_1587841_+	LexA repressor-like protein	NA	NA	NA	NA
AVG12057.1\|1587837_1588395_+	MutX-like protein	NA	NA	NA	NA
AVG12058.1\|1588389_1588794_-	small multidrug efflux transporter-like protein	NA	NA	NA	NA
AVG12059.1\|1588786_1589119_-	small multidrug efflux transporter-like protein	NA	NA	NA	NA
AVG12060.1\|1589124_1589664_-	transcriptional regulator, TetR family	NA	NA	NA	NA
AVG12061.1\|1589775_1589898_+	hypothetical protein	NA	NA	NA	NA
AVG12062.1\|1589989_1590340_+	hypothetical protein	NA	NA	NA	NA
AVG12063.1\|1590701_1591460_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG12064.1\|1592191_1592629_-\|integrase	putative integrase	S5MNZ2	Brevibacillus_phage	1.5e-27	53.8
AVG12065.1\|1592940_1594164_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12066.1\|1594170_1594338_-	Helix-turn-helix domain protein	A0A0K2CZS1	Paenibacillus_phage	5.2e-13	93.0
AVG12067.1\|1594536_1596060_+\|protease	minor extracellular protease Epr	NA	NA	NA	NA
1594149:1595536	attR	NA	NA	NA	NA
AVG12068.1\|1596052_1597276_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12069.1\|1597303_1598014_+	putative transcriptional regulatory protein YclJ	A0A2I7SCM7	Paenibacillus_phage	7.2e-11	81.6
AVG12070.1\|1598467_1599016_+	hypothetical protein	A0A2I7SC06	Paenibacillus_phage	1.1e-78	87.9
AVG12071.1\|1599027_1599288_+	hypothetical protein	A0A2I7SC12	Paenibacillus_phage	3.8e-34	86.0
AVG12072.1\|1599660_1599864_-	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	1.2e-27	91.0
AVG12073.1\|1600155_1601568_-	N-acetyl-anhydromuranmyl-L-alanine amidase	NA	NA	NA	NA
AVG12074.1\|1602360_1602603_+	hypothetical protein	NA	NA	NA	NA
AVG12075.1\|1602926_1603439_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG12076.1\|1603528_1604278_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG12077.1\|1604389_1604635_-	transcriptional repressor MprA	NA	NA	NA	NA
AVG12078.1\|1605044_1605713_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG12079.1\|1605807_1606674_+	cystine-binding periplasmic protein	NA	NA	NA	NA
AVG12080.1\|1607375_1608122_+	glutamine transport ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	1.2e-35	43.6
AVG12081.1\|1608166_1608589_+	peroxiredoxin, OsmC subfamily	NA	NA	NA	NA
AVG12082.1\|1608873_1609083_+	cyanate hydratase CynS	NA	NA	NA	NA
AVG12083.1\|1609331_1609475_-	hypothetical protein	NA	NA	NA	NA
AVG12084.1\|1609508_1610432_+	serine/threonine protein kinase	NA	NA	NA	NA
AVG12085.1\|1611441_1611636_+	hypothetical protein	NA	NA	NA	NA
AVG12086.1\|1611747_1612971_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG12087.1\|1613141_1614365_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12088.1\|1614591_1615224_+	pyridoxamine 5'-phosphate oxidase, FMN-binding family	NA	NA	NA	NA
AVG12089.1\|1616566_1616989_-\|transposase	transposase-like protein	NA	NA	NA	NA
AVG12090.1\|1617298_1617619_-\|transposase	transposase IS3/IS911 family protein	A0A0C5AJ29	Paenibacillus_phage	7.2e-19	48.1
AVG12091.1\|1617676_1617976_-\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVG12092.1\|1618066_1618627_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVG12093.1\|1619105_1619462_-	group I intron endonuclease	NA	NA	NA	NA
AVG12094.1\|1619482_1620241_-	hypothetical protein	NA	NA	NA	NA
AVG12095.1\|1620829_1621384_+	putative membrane protein	NA	NA	NA	NA
AVG12096.1\|1622883_1625832_+	formate dehydrogenase, alpha subunit	NA	NA	NA	NA
AVG12097.1\|1625834_1626326_+	hypothetical protein	NA	NA	NA	NA
AVG12098.1\|1626342_1627146_+	FdhD-like protein	NA	NA	NA	NA
AVG12099.1\|1627448_1628402_+	iron-siderophore ABC transporter-like protein	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-94	55.3
AVG12100.1\|1628391_1629345_+	iron-siderophore ABC transporter-like protein	NA	NA	NA	NA
AVG12101.1\|1629338_1630097_+	iron-siderophore ABC transporter-like protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.7e-19	30.8
AVG12102.1\|1630223_1631141_+	iron-siderophore ABC transporter-like protein	NA	NA	NA	NA
AVG12103.1\|1631142_1631310_+	hypothetical protein	NA	NA	NA	NA
AVG12104.1\|1631363_1631621_+	hypothetical protein	NA	NA	NA	NA
AVG12105.1\|1631642_1632791_+	6-phosphogluconolactonase-like protein	NA	NA	NA	NA
AVG12106.1\|1633347_1633662_+	MIP18 family protein YitW	NA	NA	NA	NA
AVG12107.1\|1633820_1634300_+	Cysteine dioxygenase	NA	NA	NA	NA
AVG12108.1\|1634456_1635218_+	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AVG12109.1\|1635270_1635426_+	hypothetical protein	NA	NA	NA	NA
AVG12110.1\|1635443_1636109_+	GTP pyrophosphokinase YwaC	NA	NA	NA	NA
AVG12111.1\|1636254_1636668_+	penicillinase repressor	NA	NA	NA	NA
AVG12112.1\|1636670_1637486_+	peptidase, M56 family	NA	NA	NA	NA
AVG12113.1\|1637573_1638290_+	disulfide bond formation protein D	NA	NA	NA	NA
AVG12114.1\|1638298_1638733_+	thiol-disulfide oxidoreductase-like protein	NA	NA	NA	NA
AVG12115.1\|1638775_1639498_-	oxidoreductase, short chain dehydrogenase/reductase family protein	A0A0M4JSW6	Mollivirus	2.6e-08	26.2
AVG12116.1\|1639941_1640316_-	Two-component response regulator YkoH-like protein	NA	NA	NA	NA
AVG12117.1\|1641123_1641579_-	transcriptional regulator	NA	NA	NA	NA
AVG12118.1\|1641760_1642594_+	putative permease	NA	NA	NA	NA
AVG12119.1\|1642590_1642986_+	putative membrane protein	NA	NA	NA	NA
AVG12120.1\|1643167_1645099_+	dihydrolipoamide dehydrogenase	NA	NA	NA	NA
AVG12121.1\|1645169_1646687_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AVG12122.1\|1646673_1647900_+	aminoacyltransferase FemX	NA	NA	NA	NA
AVG12123.1\|1648238_1649462_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_17

1652610 : 1695666

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12126.1\|1652610_1653834_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG12127.1\|1653915_1655583_+	lipoprotein-like protein	NA	NA	NA	NA
AVG12128.1\|1657409_1659011_+	response regulator receiver domain protein	NA	NA	NA	NA
AVG12129.1\|1659793_1660951_+	stage V sporulation protein E	NA	NA	NA	NA
AVG12130.1\|1660930_1661581_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AVG12131.1\|1661711_1662338_+	putative membrane protein	NA	NA	NA	NA
AVG12132.1\|1662490_1663012_-	peptide methionine sulfoxide reductase MsrA	NA	NA	NA	NA
AVG12133.1\|1663470_1664193_+	trehalose operon transcriptional repressor	NA	NA	NA	NA
AVG12134.1\|1664612_1666046_+	PTS system trehalose-specific EIIBC component TreP	NA	NA	NA	NA
AVG12135.1\|1666062_1667745_+	trehalose-6-phosphate hydrolase TreA	NA	NA	NA	NA
AVG12136.1\|1668057_1668372_-	Alpha-keto-acid decarboxylase	NA	NA	NA	NA
AVG12137.1\|1668857_1670081_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
AVG12138.1\|1670823_1671927_-	RNA polymerase sigma factor rpoD	M4SMP8	Cyanophage	3.0e-40	37.9
AVG12139.1\|1672380_1673283_+	putative oxidoreductase YhdF	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.9e-54	43.9
AVG12140.1\|1673378_1673915_-	putative membrane-associated phospholipid phosphatase	NA	NA	NA	NA
AVG12141.1\|1674346_1675936_-	bacillolysin	NA	NA	NA	NA
AVG12142.1\|1676210_1676438_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	2.4e-08	75.6
AVG12143.1\|1676452_1677172_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	2.0e-101	78.9
AVG12144.1\|1677164_1678388_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG12145.1\|1678492_1679047_-	spore germination protein GerPC	NA	NA	NA	NA
AVG12146.1\|1679329_1679563_-	spore germination protein GerPA/GerPF	NA	NA	NA	NA
AVG12147.1\|1679681_1680122_+	hypothetical protein	NA	NA	NA	NA
AVG12148.1\|1680534_1681161_+	Futalosine hydrolase	NA	NA	NA	NA
AVG12149.1\|1681157_1681988_+	putative periplasmic solute-binding protein	NA	NA	NA	NA
AVG12150.1\|1682091_1683162_-	branched-chain-amino-acid aminotransferase 2	NA	NA	NA	NA
AVG12151.1\|1683286_1684177_+	HTH-type transcriptional regulator BsdA	NA	NA	NA	NA
AVG12152.1\|1684422_1684761_-	hypothetical protein	NA	NA	NA	NA
AVG12153.1\|1684938_1685880_-	glutaminase GlsA	NA	NA	NA	NA
AVG12154.1\|1687517_1687952_+	Two-component sensor histidine kinase-like protein	W8CYF6	Bacillus_phage	5.0e-15	35.8
AVG12155.1\|1688017_1688347_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG12156.1\|1688660_1688858_-	LexA repressor-like protein	NA	NA	NA	NA
AVG12157.1\|1688922_1690146_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12158.1\|1690262_1692188_+	Alkyl hydroperoxide reductase, large subunit	NA	NA	NA	NA
AVG12159.1\|1692611_1693970_-	putative manganese transport protein MntH	NA	NA	NA	NA
AVG12160.1\|1694442_1695666_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_18

1770599 : 1865034

Paenibacillus_phage(57.14%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12188.1\|1770599_1771358_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG12189.1\|1771379_1772279_+	phosphoenolpyruvate phosphomutase BcpB	NA	NA	NA	NA
AVG12190.1\|1772275_1773172_+	phosphonopyruvate decarboxylase BcpC	NA	NA	NA	NA
AVG12191.1\|1773276_1774500_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12192.1\|1775658_1775901_+	magnesium transporter-like protein	NA	NA	NA	NA
AVG12193.1\|1775966_1779437_+	CoA-substrate-specific enzyme activase	NA	NA	NA	NA
AVG12194.1\|1781450_1781825_+	hypothetical protein	NA	NA	NA	NA
AVG12195.1\|1782465_1783848_+	putative transporter	NA	NA	NA	NA
AVG12196.1\|1784006_1785209_-	multidrug resistance protein	NA	NA	NA	NA
AVG12197.1\|1785231_1785813_-	fatty acid metabolism regulator protein FadR	NA	NA	NA	NA
AVG12198.1\|1785985_1786570_+	TetR family transcriptional regulator	NA	NA	NA	NA
AVG12199.1\|1786834_1788058_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12200.1\|1788211_1788535_+	small multidrug resistance protein	NA	NA	NA	NA
AVG12201.1\|1788537_1788852_+	putative membrane protein	NA	NA	NA	NA
AVG12202.1\|1789252_1789477_+	hypothetical protein	NA	NA	NA	NA
AVG12203.1\|1789454_1790261_+	amidinotransferase family protein	NA	NA	NA	NA
AVG12204.1\|1790594_1791266_+	alcohol dehydrogenase, zinc-dependent	NA	NA	NA	NA
AVG12205.1\|1792001_1792874_-	alpha/beta hydrolase FolD protein	NA	NA	NA	NA
AVG12206.1\|1793208_1793781_-	monogalactosyldiacylglycerol synthase-like protein	NA	NA	NA	NA
AVG12207.1\|1794134_1794293_+	hypothetical protein	NA	NA	NA	NA
AVG12208.1\|1794712_1795495_+	putative nitrite transporter NirC	NA	NA	NA	NA
AVG12209.1\|1796258_1796462_+	Acetyltransferase (GNAT) family protein	NA	NA	NA	NA
AVG12210.1\|1796695_1797919_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12211.1\|1798100_1798568_+	putative membrane protein	NA	NA	NA	NA
AVG12212.1\|1798635_1799448_+	putative membrane protein	NA	NA	NA	NA
AVG12213.1\|1799434_1800241_+	putative membrane protein	NA	NA	NA	NA
AVG12214.1\|1800237_1801041_+	hypothetical protein	NA	NA	NA	NA
AVG12215.1\|1801053_1801704_+	putative ABC transporter	A0A2H4PQG7	Staphylococcus_phage	3.4e-31	38.3
AVG12216.1\|1801700_1802699_+	hypothetical protein	NA	NA	NA	NA
AVG12217.1\|1802949_1804173_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12218.1\|1804615_1804924_-	hypothetical protein	NA	NA	NA	NA
AVG12219.1\|1805119_1807612_-	putative phosphoenolpyruvate synthase Pps	A0A1V0SGR7	Hokovirus	3.3e-34	35.4
AVG12220.1\|1807797_1808550_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	9.3e-134	98.3
AVG12221.1\|1808687_1809371_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	3.4e-119	97.4
AVG12222.1\|1809475_1817281_-	nonribosomal peptide ligase subunit	A0A2K9KZV5	Tupanvirus	3.4e-77	27.5
AVG12223.1\|1817417_1833527_-	nonribosomal peptide ligase subunit	A0A2K9KZV5	Tupanvirus	1.9e-119	22.7
AVG12224.1\|1833570_1845525_-	putative non-ribosomal peptide ligase/ polyketide synthase hybrid	A0A2K9KZV5	Tupanvirus	7.2e-111	27.8
AVG12225.1\|1845555_1846755_-	putative malonyl CoA-acyl carrier protein transacylase	NA	NA	NA	NA
AVG12226.1\|1847847_1848273_-	putative transcriptional regulator	NA	NA	NA	NA
AVG12227.1\|1848373_1849273_+	transcriptional regulator, LysR family	A0A2P0ZL89	Lactobacillus_phage	5.5e-08	25.4
AVG12228.1\|1850931_1851444_+\|transposase	transposase	NA	NA	NA	NA
AVG12229.1\|1851440_1851971_+\|transposase	transposase	NA	NA	NA	NA
AVG12230.1\|1852047_1853271_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12231.1\|1853335_1854829_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVG12232.1\|1854912_1855476_-	hypothetical protein	NA	NA	NA	NA
AVG12233.1\|1855600_1856497_-	CDF family cation diffusion facilitator	NA	NA	NA	NA
AVG12234.1\|1857134_1857281_-	hypothetical protein	NA	NA	NA	NA
AVG12235.1\|1857479_1857848_+	hypothetical protein	NA	NA	NA	NA
AVG12236.1\|1858038_1858773_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AVG12237.1\|1858828_1859614_-	N-acetylmuramic acid deacetylase-like protein	NA	NA	NA	NA
AVG12238.1\|1859727_1861245_-	membrane protein	NA	NA	NA	NA
AVG12239.1\|1861323_1862442_-	two-component response regulator	NA	NA	NA	NA
AVG12240.1\|1862914_1863187_-	ribonuclease inhibitor-like protein	NA	NA	NA	NA
AVG12241.1\|1863327_1863627_-	ribonuclease	NA	NA	NA	NA
AVG12242.1\|1863810_1865034_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_19

1868440 : 1920097

Paenibacillus_phage(68.75%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12245.1\|1868440_1869124_-\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	2.9e-17	32.3
AVG12246.1\|1869265_1870489_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12247.1\|1870603_1870789_-\|transposase	transposase	NA	NA	NA	NA
AVG12248.1\|1871886_1872945_+	glycosyltransferase-like protein	NA	NA	NA	NA
AVG12249.1\|1873059_1874076_+	glucose-1-phosphate thymidylyltransferase StrD	K7QKA7	Escherichia_phage	8.7e-26	33.5
AVG12250.1\|1874144_1875368_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12251.1\|1876083_1876269_-	D-tagatose-1,6-bisphosphate aldolase subunit GatY	NA	NA	NA	NA
AVG12252.1\|1876413_1876734_-	hypothetical protein	NA	NA	NA	NA
AVG12253.1\|1876730_1877504_-	4'-phosphopantetheinyl transferase	NA	NA	NA	NA
AVG12254.1\|1877781_1878996_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	8.3e-225	99.3
AVG12255.1\|1879226_1879748_-	transcriptional regulator, RpiR family	NA	NA	NA	NA
AVG12256.1\|1879812_1881036_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12257.1\|1881078_1881414_-	MurPQ operon repressor	NA	NA	NA	NA
AVG12258.1\|1881449_1882130_-	putative N-acetylmannosamine-6-phosphate 2-epimerase NanE	NA	NA	NA	NA
AVG12259.1\|1882134_1883667_-	PTS system glucose-specific EIICBA component PtsG	NA	NA	NA	NA
AVG12260.1\|1883876_1885100_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12261.1\|1885435_1886554_-	glycosyltransferase-like protein	NA	NA	NA	NA
AVG12262.1\|1886730_1887558_+	metallophosphoesterase-like protein	NA	NA	NA	NA
AVG12263.1\|1888005_1889568_-	gluconokinase GntK	NA	NA	NA	NA
AVG12264.1\|1889602_1890964_-	gluconate permease GnuT	NA	NA	NA	NA
AVG12265.1\|1891074_1891752_-	gluconate operon transcriptional repressor	NA	NA	NA	NA
AVG12266.1\|1891865_1892540_-	6-phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	9.1e-48	38.7
AVG12267.1\|1892536_1892749_-	6-phosphogluconate dehydrogenase-like protein	NA	NA	NA	NA
AVG12268.1\|1892929_1893247_-	hypothetical protein	A0A2H4JDX0	uncultured_Caudovirales_phage	5.8e-13	45.0
AVG12269.1\|1893887_1895111_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12270.1\|1895199_1896096_-	group-specific protein	NA	NA	NA	NA
AVG12271.1\|1896164_1896380_-	hypothetical protein	NA	NA	NA	NA
AVG12272.1\|1896816_1896918_+	hypothetical protein	NA	NA	NA	NA
AVG12273.1\|1897204_1898428_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12274.1\|1898594_1899365_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	39.2
AVG12275.1\|1899981_1901205_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12276.1\|1901867_1902074_+	hypothetical protein	NA	NA	NA	NA
AVG12277.1\|1902451_1903000_+	GCN5-related N-acetyltransferase	NA	NA	NA	NA
AVG12278.1\|1903233_1904406_+	oxalate decarboxylase OxdD	NA	NA	NA	NA
AVG12279.1\|1904489_1904918_-	cell wall hydrolase CwlJ	NA	NA	NA	NA
AVG12280.1\|1905084_1905474_-	Putative oxidoreductase CatD	NA	NA	NA	NA
AVG12281.1\|1906674_1906980_-	FtsX-like permease family protein	NA	NA	NA	NA
AVG12282.1\|1907614_1908838_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12283.1\|1909120_1909627_-	hypothetical protein	NA	NA	NA	NA
AVG12284.1\|1910662_1912072_+	putative multidrug resistance protein YoeA	NA	NA	NA	NA
AVG12285.1\|1912164_1913052_-	putative membrane protein	NA	NA	NA	NA
AVG12286.1\|1913257_1913542_-	D-proline reductase proprotein PrdA	NA	NA	NA	NA
AVG12287.1\|1913959_1915183_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12288.1\|1915592_1916423_+	acid phosphatase	NA	NA	NA	NA
AVG12289.1\|1916676_1917033_-	transcriptional activator FtrA	NA	NA	NA	NA
AVG12290.1\|1917113_1918481_-	putative integral membrane protein	NA	NA	NA	NA
AVG12291.1\|1918873_1920097_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_20

1951612 : 1988348

Paenibacillus_phage(71.43%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12312.1\|1951612_1952836_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG12313.1\|1953111_1953594_-	protein-tyrosine-phosphatase-like protein	NA	NA	NA	NA
AVG12314.1\|1953953_1955177_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12315.1\|1955591_1956557_-	putative C4-dicarboxylate response regulator DctR	NA	NA	NA	NA
AVG12316.1\|1958333_1959392_+	C4-dicarboxylate-binding protein DctB	NA	NA	NA	NA
AVG12317.1\|1959649_1960927_+	C4-dicarboxylate transport protein DctA	NA	NA	NA	NA
AVG12318.1\|1961095_1962022_-	band 7 family protein	NA	NA	NA	NA
AVG12319.1\|1962025_1962457_-	hypothetical protein	NA	NA	NA	NA
AVG12320.1\|1962653_1963646_-	putative transporter	NA	NA	NA	NA
AVG12321.1\|1963659_1963845_-	hypothetical protein	NA	NA	NA	NA
AVG12322.1\|1964124_1965348_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12323.1\|1965572_1966454_-	putative L-serine dehydratase, alpha chain	NA	NA	NA	NA
AVG12324.1\|1966480_1967143_-	putative L-serine dehydratase, beta chain	NA	NA	NA	NA
AVG12325.1\|1967357_1967522_-	hypothetical protein	NA	NA	NA	NA
AVG12326.1\|1967611_1976002_-	putative non-ribosomal peptide ligase domain protein	A0A2K9KZV5	Tupanvirus	1.4e-92	26.1
AVG12327.1\|1976026_1979269_-	putative non-ribosomal peptide ligase domain protein	A0A2K9KZV5	Tupanvirus	1.3e-83	26.2
AVG12328.1\|1979674_1979854_-	hypothetical protein	NA	NA	NA	NA
AVG12329.1\|1980674_1980884_-\|tRNA	Tryptophan--tRNA ligase 2	NA	NA	NA	NA
AVG12330.1\|1980976_1981258_-\|tRNA	Tryptophan--tRNA ligase 2	NA	NA	NA	NA
AVG12331.1\|1982167_1982353_-	hypothetical protein	NA	NA	NA	NA
AVG12332.1\|1982859_1983759_+	cyclic peptide transporter	NA	NA	NA	NA
AVG12333.1\|1983986_1985210_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12334.1\|1985597_1986599_+	phosphohydrolase	NA	NA	NA	NA
AVG12335.1\|1986780_1987485_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.1e-56	51.1
AVG12336.1\|1987658_1988348_-\|transposase	putative transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2019050 : 2072761

Paenibacillus_phage(56.25%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12365.1\|2019050_2020274_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG12366.1\|2020596_2021559_+	putative UDP-glucose 4-epimerase	A0A2K9L0I7	Tupanvirus	2.5e-38	34.0
AVG12367.1\|2021705_2022725_+	oligopeptide transport ATP-binding protein OppD	G9BWD6	Planktothrix_phage	9.7e-17	30.2
AVG12368.1\|2022711_2023638_+	oligopeptide transport ATP-binding protein OppF	G9BWD6	Planktothrix_phage	3.8e-20	33.2
AVG12369.1\|2023651_2024617_+	oligopeptide transport system permease protein OppB	NA	NA	NA	NA
AVG12370.1\|2024635_2025541_+	oligopeptide transport system permease protein OppC	NA	NA	NA	NA
AVG12371.1\|2025555_2027355_+	oligopeptide-binding protein OppA	NA	NA	NA	NA
AVG12372.1\|2027515_2028547_-	ribonucleoside-diphosphate reductase subunit beta	A0A127AVZ3	Bacillus_phage	1.3e-90	46.7
AVG12373.1\|2028601_2030887_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0Y0AS84	Bacillus_phage	1.5e-267	65.1
AVG12374.1\|2031117_2031627_-\|transposase	transposase	NA	NA	NA	NA
AVG12375.1\|2031644_2032202_-\|transposase	transposase	NA	NA	NA	NA
AVG12376.1\|2032785_2033970_-	putative tagatose-6-phosphate ketose/aldose isomerase AgaS	NA	NA	NA	NA
AVG12377.1\|2034023_2034794_-	transcriptional regulator, GntR family	NA	NA	NA	NA
AVG12378.1\|2034858_2036082_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12379.1\|2036405_2037629_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12380.1\|2037621_2038515_-	hypothetical protein	NA	NA	NA	NA
AVG12381.1\|2038700_2041247_+	O-GlcNAcase NagJ	NA	NA	NA	NA
AVG12382.1\|2041334_2041439_-	hypothetical protein	NA	NA	NA	NA
AVG12383.1\|2041690_2042998_+	cell volume regulation protein A	NA	NA	NA	NA
AVG12384.1\|2043307_2044120_-	hypothetical protein	A0A2I2L551	Orpheovirus	7.9e-38	37.2
AVG12385.1\|2044261_2045665_-	fumarate hydratase class II	NA	NA	NA	NA
AVG12386.1\|2045741_2046020_-	hypothetical protein	NA	NA	NA	NA
AVG12387.1\|2046218_2046908_+\|transposase	putative transposase	NA	NA	NA	NA
AVG12388.1\|2047081_2047786_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.1e-56	51.1
AVG12389.1\|2047935_2049663_-	glycine betaine transport system permease protein OpuAB	NA	NA	NA	NA
AVG12390.1\|2049659_2050859_-	glycine betaine transport ATP-binding protein OpuAA	G3M9Y6	Bacillus_virus	1.8e-30	39.5
AVG12391.1\|2051158_2051737_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG12392.1\|2052003_2053488_+	putative aldehyde dehydrogenase DhaS	NA	NA	NA	NA
AVG12393.1\|2053537_2054710_-	spore autolysin-like protein	NA	NA	NA	NA
AVG12394.1\|2054725_2054905_-	hypothetical protein	NA	NA	NA	NA
AVG12395.1\|2054955_2055066_+	hypothetical protein	NA	NA	NA	NA
AVG12396.1\|2055960_2056806_-	carbohydrate kinase, YjeF related protein	NA	NA	NA	NA
AVG12397.1\|2056821_2057781_-	glycerophosphodiester phosphodiesterase family protein	NA	NA	NA	NA
AVG12398.1\|2057978_2059202_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG12399.1\|2059387_2060476_-	putative dipeptidase YkvY	NA	NA	NA	NA
AVG12400.1\|2060672_2061671_-	Phosphate/sulfate permease	NA	NA	NA	NA
AVG12401.1\|2062004_2062172_+	thioredoxin-disulfide reductase	NA	NA	NA	NA
AVG12402.1\|2062216_2062858_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
AVG12403.1\|2062999_2063197_-	hypothetical protein	A0A2I7SCV7	Paenibacillus_phage	1.9e-17	66.2
AVG12404.1\|2063338_2063671_+	hypothetical protein	NA	NA	NA	NA
AVG12405.1\|2063667_2063844_+	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	8.5e-22	89.7
AVG12406.1\|2064044_2065268_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12407.1\|2066969_2067401_+	UspA domain-containing protein	NA	NA	NA	NA
AVG12408.1\|2067639_2068941_-	cell envelope-like function transcriptional attenuator common domain protein	NA	NA	NA	NA
AVG12409.1\|2069160_2070384_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12410.1\|2070825_2071248_-	hypothetical protein	NA	NA	NA	NA
AVG12411.1\|2071279_2072761_-\|tRNA	(dimethylallyl)adenosine tRNA methylthiotransferase MiaB	NA	NA	NA	NA

DBSCAN-SWA_22

2164924 : 2219461

Paenibacillus_phage(36.36%)

tRNA,transposase,protease,integrase

attL 2203846:2203860|attR 2219475:2219489

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12504.1\|2164924_2166319_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	3.8e-40	27.6
AVG12505.1\|2166488_2167031_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
AVG12506.1\|2167209_2168538_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TrmFO	NA	NA	NA	NA
AVG12507.1\|2168550_2170641_-	DNA topoisomerase 1	A0A2K9L5F8	Tupanvirus	1.8e-110	40.9
AVG12508.1\|2170788_2171064_-	hypothetical protein	NA	NA	NA	NA
AVG12509.1\|2171259_2172483_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12510.1\|2172571_2173333_-	DNA processing Smf single strand binding protein-like protein	S6BFL3	Thermus_phage	4.5e-27	42.9
AVG12511.1\|2173360_2174584_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12512.1\|2174792_2175728_-	succinyl-CoA ligase [ADP-forming] subunit alpha	NA	NA	NA	NA
AVG12513.1\|2175784_2176945_-	succinyl-CoA ligase [ADP-forming] subunit beta	NA	NA	NA	NA
AVG12514.1\|2177332_2177593_-	hypothetical protein	NA	NA	NA	NA
AVG12515.1\|2177624_2178020_-	hypothetical protein	NA	NA	NA	NA
AVG12516.1\|2178235_2179759_+	Mg chelatase-like protein	NA	NA	NA	NA
AVG12517.1\|2179856_2180261_-	hypothetical protein	NA	NA	NA	NA
AVG12518.1\|2180270_2180603_-	flagellar biosynthesis-like protein	NA	NA	NA	NA
AVG12519.1\|2180599_2182411_-	glycosyltransferase-like protein	NA	NA	NA	NA
AVG12520.1\|2182465_2183149_-	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	9.7e-21	37.7
AVG12521.1\|2183441_2184323_-	ribosome biogenesis GTPase A	NA	NA	NA	NA
AVG12522.1\|2184414_2185017_-	signal peptidase I	NA	NA	NA	NA
AVG12523.1\|2185128_2185470_-	50S ribosomal protein L19	NA	NA	NA	NA
AVG12524.1\|2185612_2186365_-\|tRNA	tRNA (guanine(37)-N(1))-methyltransferase TrmD	NA	NA	NA	NA
AVG12525.1\|2186361_2186883_-	ribosome maturation factor RimM	NA	NA	NA	NA
AVG12526.1\|2187108_2187339_-	RNA binding-like protein	NA	NA	NA	NA
AVG12527.1\|2187361_2187634_-	30S ribosomal protein S16	NA	NA	NA	NA
AVG12528.1\|2187675_2189043_-	signal recognition particle protein Ffh	NA	NA	NA	NA
AVG12529.1\|2189072_2189435_-	putative DNA-binding protein	NA	NA	NA	NA
AVG12530.1\|2189568_2190576_-	cell division protein, FtsY-like protein	NA	NA	NA	NA
AVG12531.1\|2190660_2194239_-	chromosome partition protein SMC	NA	NA	NA	NA
AVG12532.1\|2194407_2195271_-	ribonuclease 3	A0A167RGU4	Powai_lake_megavirus	8.7e-27	30.0
AVG12533.1\|2195288_2196524_-	3-oxoacyl-[acyl-carrier-protein] synthase 2	NA	NA	NA	NA
AVG12534.1\|2196613_2196847_-	acyl carrier protein AcpP	B2ZXV3	Ralstonia_phage	6.0e-07	38.0
AVG12535.1\|2196965_2197706_-	3-oxoacyl-[acyl-carrier-protein] reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	5.0e-23	36.4
AVG12536.1\|2197805_2198741_-	malonyl CoA-acyl carrier protein transacylase FabD	NA	NA	NA	NA
AVG12537.1\|2198772_2199759_-	3-oxoacyl-[acyl-carrier-protein] synthase 3	NA	NA	NA	NA
AVG12538.1\|2199769_2200756_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
AVG12539.1\|2200757_2201348_-	transcription factor FapR	NA	NA	NA	NA
AVG12540.1\|2201523_2201697_-	50S ribosomal protein L32	NA	NA	NA	NA
AVG12541.1\|2201815_2202328_-	hypothetical protein	NA	NA	NA	NA
AVG12542.1\|2202415_2203534_-	peptidase Do	NA	NA	NA	NA
AVG12543.1\|2203673_2205023_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
2203846:2203860	attL	NA	NA	NA	NA
AVG12544.1\|2205033_2205543_-	phosphopantetheine adenylyltransferase CoaD	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.0e-26	39.5
AVG12545.1\|2205560_2206118_-	putative rRNA methyltransferase YlbH	NA	NA	NA	NA
AVG12546.1\|2206667_2206865_-	Helix-turn-helix domain protein	D0R7I7	Paenibacillus_phage	2.4e-09	76.9
AVG12547.1\|2206929_2207343_+	hypothetical protein	A0A0K2CYM1	Paenibacillus_phage	8.7e-33	98.6
AVG12548.1\|2207490_2207880_-	hypothetical protein	NA	NA	NA	NA
AVG12549.1\|2208324_2208603_-	amidinotransferase family protein	NA	NA	NA	NA
AVG12550.1\|2209141_2210473_-	GlcNAc-binding protein A	A0A2D1GD28	Mycobacterium_phage	4.1e-07	29.3
AVG12551.1\|2210863_2211106_-	hypothetical protein	A0A2I7SCT4	Paenibacillus_phage	7.3e-32	97.5
AVG12552.1\|2211115_2211787_-	N-acetylmuramoyl-L-alanine amidase	A0A0K2CXQ8	Paenibacillus_phage	1.5e-127	95.5
AVG12553.1\|2211783_2212023_-	hypothetical protein	A0A0C5AEG8	Bacteriophage	2.8e-36	100.0
AVG12554.1\|2212050_2212179_-	hypothetical protein	NA	NA	NA	NA
AVG12555.1\|2212434_2212746_+\|transposase	transposase IS3/IS911 family protein	NA	NA	NA	NA
AVG12556.1\|2212844_2213315_+\|transposase	putative transposase	NA	NA	NA	NA
AVG12557.1\|2214994_2215345_-	hypothetical protein	A0A0K2CYS5	Paenibacillus_phage	8.4e-29	60.0
AVG12558.1\|2216039_2216555_+	hypothetical protein	NA	NA	NA	NA
AVG12559.1\|2216637_2216841_-	hypothetical protein	A0A0S2SXP3	Bacillus_phage	6.8e-07	40.0
AVG12560.1\|2217326_2217437_-	hypothetical protein	NA	NA	NA	NA
AVG12561.1\|2217436_2217661_-	helix-turn-helix protein	NA	NA	NA	NA
AVG12562.1\|2217807_2218251_+	LexA repressor-like protein	A6XML9	Bacillus_virus	1.0e-10	37.5
AVG12563.1\|2218257_2218506_+	putative repressor LexA	A0A0N9RTK0	Paenibacillus_phage	1.0e-17	53.7
AVG12564.1\|2218525_2218861_+\|integrase	phage integrase-like protein	S5MNZ2	Brevibacillus_phage	6.8e-12	43.2
AVG12565.1\|2218975_2219461_+\|integrase	phage integrase-like protein	S5MNZ2	Brevibacillus_phage	1.7e-27	57.9
2219475:2219489	attR	NA	NA	NA	NA

DBSCAN-SWA_23

2297906 : 2416900

140

Paenibacillus_phage(40.91%)

tail,tRNA,integrase,capsid,transposase

attL 2377105:2377147|attR 2390875:2390917

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12639.1\|2297906_2299130_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12640.1\|2299194_2299644_+	putative phage DNA-binding protein	NA	NA	NA	NA
AVG12641.1\|2299842_2300268_-	CoA binding domain protein	NA	NA	NA	NA
AVG12642.1\|2300286_2301099_-	hypothetical protein	NA	NA	NA	NA
AVG12643.1\|2301118_2302411_-	3-phosphoshikimate 1-carboxyvinyltransferase AroA	NA	NA	NA	NA
AVG12644.1\|2302537_2302900_-	CrcB-like protein	NA	NA	NA	NA
AVG12645.1\|2302892_2303279_-	CrcB-like protein	NA	NA	NA	NA
AVG12646.1\|2303382_2303901_-	shikimate kinase AroK	NA	NA	NA	NA
AVG12647.1\|2304031_2305267_-	ABC transporter-like protein	NA	NA	NA	NA
AVG12648.1\|2305272_2305977_-	putative ABC transporter ATP-binding protein YthP	A0A2H4PQG7	Staphylococcus_phage	1.2e-13	24.6
AVG12649.1\|2306004_2306187_-	hypothetical protein	NA	NA	NA	NA
AVG12650.1\|2306314_2306932_-	ankyrin-repeat containing protein	A0A2I7SCM7	Paenibacillus_phage	4.8e-11	93.8
AVG12651.1\|2306959_2308183_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12652.1\|2308175_2308940_-	hypothetical protein	NA	NA	NA	NA
AVG12653.1\|2309234_2309363_-	hypothetical protein	NA	NA	NA	NA
AVG12654.1\|2310218_2310527_+	hypothetical protein	NA	NA	NA	NA
AVG12655.1\|2310528_2311941_-	6-phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	3.9e-32	29.4
AVG12656.1\|2312617_2312857_-	hypothetical protein	A0A0K2CYG5	Paenibacillus_phage	1.0e-22	67.5
AVG12657.1\|2313617_2315180_-	bacillolysin	NA	NA	NA	NA
AVG12658.1\|2315995_2316481_+	hypothetical protein	A0A0C5AN10	Bacteriophage	1.5e-52	66.2
AVG12659.1\|2316691_2317441_+	putative phage-associated protein	A0A0C5ABL3	Bacteriophage	5.1e-92	67.5
AVG12660.1\|2317648_2318872_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	5.8e-226	99.3
AVG12661.1\|2319184_2319736_+	hypothetical protein	NA	NA	NA	NA
AVG12662.1\|2319937_2320420_-	putative phage protein	A0A0N9SGM1	Paenibacillus_phage	1.4e-26	41.3
AVG12663.1\|2320716_2321001_-	hypothetical protein	NA	NA	NA	NA
AVG12664.1\|2320954_2321893_-	putative phage DNA-binding protein	A0A0A7RTT7	Clostridium_phage	1.1e-38	32.8
AVG12665.1\|2321957_2323181_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12666.1\|2323173_2323578_-\|transposase	putative transposase InsK for insertion sequence element IS150	NA	NA	NA	NA
AVG12667.1\|2323597_2324710_-	AAA ATPase	A0A1S5V1G7	Saudi_moumouvirus	1.5e-15	28.8
AVG12668.1\|2325022_2325265_-	hypothetical protein	A0A0K2CZD0	Paenibacillus_phage	9.5e-32	96.2
AVG12669.1\|2325277_2325556_-	hypothetical protein	R9VWV2	Paenibacillus_phage	4.2e-39	80.6
AVG12670.1\|2325573_2326038_-	hypothetical protein	A0A0K2CZJ8	Paenibacillus_phage	6.9e-63	71.4
AVG12671.1\|2326044_2326725_-	N-acetylmuramoyl-L-alanine amidase	A0A0C5AEW3	Paenibacillus_phage	2.1e-129	95.1
AVG12672.1\|2326721_2326961_-	hypothetical protein	R9W0N4	Paenibacillus_phage	2.8e-36	100.0
AVG12673.1\|2326996_2327155_-	hypothetical protein	NA	NA	NA	NA
AVG12674.1\|2327147_2327543_-	hypothetical protein	NA	NA	NA	NA
AVG12675.1\|2327555_2328959_-	phage structural protein	S5MNY5	Brevibacillus_phage	5.4e-10	37.5
AVG12676.1\|2328962_2329241_-	hypothetical protein	NA	NA	NA	NA
AVG12677.1\|2329237_2329819_-	putative phage protein	S5MA71	Brevibacillus_phage	4.8e-37	45.9
AVG12678.1\|2329811_2330888_-\|capsid	phage capsid assembly-like protein	A0A0K2CP27	Brevibacillus_phage	2.5e-100	52.4
AVG12679.1\|2330880_2331291_-	phage protein	A0A0A7RTU4	Clostridium_phage	1.1e-27	48.5
AVG12680.1\|2331293_2331536_-	hypothetical protein	S5MC71	Brevibacillus_phage	9.9e-13	37.6
AVG12681.1\|2331535_2332519_-	putative phage cell wall hydrolase	S5MNC9	Brevibacillus_phage	1.0e-103	55.6
AVG12682.1\|2332523_2333162_-	putative phage cell wall hydrolase	S5MUH0	Brevibacillus_phage	4.4e-52	50.5
AVG12683.1\|2333158_2335135_-\|tail	putative tail length tape measure protein	S5MNW9	Brevibacillus_phage	8.7e-139	46.9
AVG12684.1\|2335320_2335491_-	hypothetical protein	NA	NA	NA	NA
AVG12685.1\|2335490_2335916_-	phage protein	X5JAB6	Clostridium_phage	1.6e-26	44.8
AVG12686.1\|2335942_2336407_-	putative phage protein	A0A0K2CNG3	Brevibacillus_phage	2.7e-51	62.1
AVG12687.1\|2336408_2337740_-	phage protein	A0A0K2CNL4	Brevibacillus_phage	2.5e-113	48.7
AVG12688.1\|2337740_2337923_-	hypothetical protein	NA	NA	NA	NA
AVG12689.1\|2337915_2338326_-	hypothetical protein	S5MUN8	Brevibacillus_phage	7.8e-26	46.8
AVG12690.1\|2338322_2338733_-	phage protein	S5MNW5	Brevibacillus_phage	1.4e-38	61.1
AVG12691.1\|2338732_2339092_-	hypothetical protein	S5M673	Brevibacillus_phage	3.7e-32	54.7
AVG12692.1\|2339093_2339468_-	hypothetical protein	S5MP25	Brevibacillus_phage	2.1e-30	55.8
AVG12693.1\|2339448_2339682_-	hypothetical protein	NA	NA	NA	NA
AVG12694.1\|2339693_2340644_-\|capsid	putative major capsid protein	A0A0K2CP76	Brevibacillus_phage	5.1e-137	86.6
AVG12695.1\|2340671_2341895_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12696.1\|2342013_2342298_+	hypothetical protein	NA	NA	NA	NA
AVG12697.1\|2342306_2342918_+	response regulator receiver domain protein	NA	NA	NA	NA
AVG12698.1\|2342890_2345293_-	hyaluronate lyase	NA	NA	NA	NA
AVG12699.1\|2345305_2346055_-	putative sugar isomerase	NA	NA	NA	NA
AVG12700.1\|2346068_2347241_-	unsaturated glucuronyl hydrolase Ugl	NA	NA	NA	NA
AVG12701.1\|2347254_2347971_-	putative phosphosugar isomerase/binding protein	NA	NA	NA	NA
AVG12702.1\|2347990_2348476_-	sorbose PTS system IIB-like component	NA	NA	NA	NA
AVG12703.1\|2348489_2349281_-	PTS system, IID component	NA	NA	NA	NA
AVG12704.1\|2349273_2350053_-	PTS system, IIC component	NA	NA	NA	NA
AVG12705.1\|2350064_2350511_-	PTS system, IIA component	NA	NA	NA	NA
AVG12706.1\|2350507_2351212_-	HTH-type transcriptional repressor YvoA	NA	NA	NA	NA
AVG12707.1\|2351424_2352048_+	hypothetical protein	NA	NA	NA	NA
AVG12708.1\|2352559_2353843_-	transporter, major facilitator family protein	NA	NA	NA	NA
AVG12709.1\|2354103_2355474_+	arginine decarboxylase SpeA	NA	NA	NA	NA
AVG12710.1\|2355617_2356037_+	hypothetical protein	NA	NA	NA	NA
AVG12711.1\|2356111_2356426_-	hypothetical protein	NA	NA	NA	NA
AVG12712.1\|2356483_2357494_-	hypothetical protein	NA	NA	NA	NA
AVG12713.1\|2357595_2357778_+	Spo0E like sporulation regulatory protein	NA	NA	NA	NA
AVG12714.1\|2357784_2358297_-	putative membrane protein	NA	NA	NA	NA
AVG12715.1\|2358425_2359184_+	ribonuclease Z	U5PU04	Bacillus_phage	1.6e-45	39.2
AVG12716.1\|2359314_2359542_-	hypothetical protein	G3MB34	Bacillus_virus	4.9e-06	38.9
AVG12717.1\|2359719_2361348_+	sporulation kinase C	NA	NA	NA	NA
AVG12718.1\|2361353_2361791_-	acetyltransferase-like protein	NA	NA	NA	NA
AVG12719.1\|2362133_2363357_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12720.1\|2363550_2364003_-	acid phosphatase/vanadium-dependent haloperoxidase YuiD	NA	NA	NA	NA
AVG12721.1\|2364158_2364584_+	CBS domain-containing protein	NA	NA	NA	NA
AVG12722.1\|2364528_2364681_-	hypothetical protein	NA	NA	NA	NA
AVG12723.1\|2364892_2365300_+	oligopeptide-binding protein AppA	NA	NA	NA	NA
AVG12724.1\|2365248_2366112_+	oligopeptide transport ATP-binding protein AppD	G9BWD6	Planktothrix_phage	3.7e-17	31.3
AVG12725.1\|2366209_2366932_+	oligopeptide ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-18	27.9
AVG12726.1\|2367095_2367233_+	hypothetical protein	NA	NA	NA	NA
AVG12727.1\|2367402_2367924_-	hypothetical protein	NA	NA	NA	NA
AVG12728.1\|2367998_2368370_-	acetyltransferase-like protein	NA	NA	NA	NA
AVG12729.1\|2368545_2369769_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12730.1\|2369939_2371163_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12731.1\|2371254_2372682_+	guanine/hypoxanthine permease PbuO	NA	NA	NA	NA
AVG12732.1\|2372963_2373350_-	hypothetical protein	NA	NA	NA	NA
AVG12733.1\|2373494_2374718_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12734.1\|2375336_2376530_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7SC76	Paenibacillus_phage	3.2e-27	88.5
2377105:2377147	attL	NA	NA	NA	NA
AVG12735.1\|2377185_2377518_-	hypothetical protein	A0A2I7SCG0	Paenibacillus_phage	1.6e-29	89.2
AVG12736.1\|2377667_2378057_+	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	6.5e-06	49.3
AVG12737.1\|2378526_2378646_-	hypothetical protein	NA	NA	NA	NA
AVG12738.1\|2379074_2379407_+	hypothetical protein	NA	NA	NA	NA
AVG12739.1\|2379413_2380637_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12740.1\|2380701_2381115_+	LexA repressor-like protein	NA	NA	NA	NA
AVG12741.1\|2381150_2381264_+	hypothetical protein	NA	NA	NA	NA
AVG12742.1\|2381693_2381927_-	hypothetical protein	NA	NA	NA	NA
AVG12743.1\|2382000_2382222_-	putative transcriptional regulator	A0A0E3U244	Fusobacterium_phage	3.8e-11	44.4
AVG12744.1\|2382718_2382910_+	hypothetical protein	A0A2I7SC20	Paenibacillus_phage	1.6e-29	98.4
AVG12745.1\|2382906_2383176_+	hypothetical protein	A0A2I7SC25	Paenibacillus_phage	9.0e-39	98.8
AVG12746.1\|2383179_2383392_+	hypothetical protein	A0A2I7SC04	Paenibacillus_phage	6.4e-24	78.8
AVG12747.1\|2383728_2384277_-	hypothetical protein	A0A0C5AEH5	Bacteriophage	1.3e-73	81.4
AVG12748.1\|2384613_2385114_-	hypothetical protein	R9VWV6	Paenibacillus_phage	7.1e-05	31.7
AVG12749.1\|2385668_2386226_+\|transposase	transposase	NA	NA	NA	NA
AVG12750.1\|2386243_2386753_+\|transposase	transposase	NA	NA	NA	NA
AVG12751.1\|2387285_2387696_+	helix-turn-helix family protein	F8J1E0	Lactobacillus_phage	6.6e-09	38.8
AVG12752.1\|2387727_2388144_+	Metallopeptidase ImmA	A0A2P1JU12	Anoxybacillus_phage	4.6e-18	37.0
AVG12753.1\|2388281_2389505_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12754.1\|2389666_2390101_+	putative phage protein	A0A1B0T6A8	Bacillus_phage	1.2e-24	43.4
AVG12755.1\|2390097_2390787_+\|integrase	phage integrase-like protein	A0A1B0T6A8	Bacillus_phage	1.3e-52	46.5
AVG12756.1\|2391051_2391579_-	hypothetical protein	NA	NA	NA	NA
2390875:2390917	attR	NA	NA	NA	NA
AVG12757.1\|2391698_2392655_-	proline-specific peptidase	NA	NA	NA	NA
AVG12758.1\|2392898_2394122_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12759.1\|2394708_2394873_-	hypothetical protein	NA	NA	NA	NA
AVG12760.1\|2394975_2395149_-	phosphatidylglycerophosphatase A-like protein	NA	NA	NA	NA
AVG12761.1\|2395392_2395905_+	2'-5' RNA ligase	NA	NA	NA	NA
AVG12762.1\|2396004_2396754_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG12763.1\|2396843_2397356_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG12764.1\|2397492_2398971_-	Maltose-binding periplasmic protein/domain	NA	NA	NA	NA
AVG12765.1\|2399377_2400751_+	peptidase M20	NA	NA	NA	NA
AVG12766.1\|2400930_2401581_-	orotate phosphoribosyltransferase PyrE	Q58MW1	Prochlorococcus_phage	5.4e-05	29.2
AVG12767.1\|2401630_2402356_-	orotidine 5'-phosphate decarboxylase PyrF	NA	NA	NA	NA
AVG12768.1\|2402433_2405643_-	carbamoyl-phosphate synthase pyrimidine-specific large chain	NA	NA	NA	NA
AVG12769.1\|2405629_2406808_-	carbamoyl-phosphate synthase small chain CarA	R4TGJ8	Halovirus	2.6e-58	37.1
AVG12770.1\|2406830_2408147_-	dihydroorotase PyrC	NA	NA	NA	NA
AVG12771.1\|2408199_2409108_-	aspartate carbamoyltransferase PyrB	M1HWF9	Paramecium_bursaria_Chlorella_virus	2.9e-33	39.2
AVG12772.1\|2409109_2409655_-	bifunctional protein PyrR	NA	NA	NA	NA
AVG12773.1\|2409996_2411247_-	LL-diaminopimelate aminotransferase DapL	NA	NA	NA	NA
AVG12774.1\|2411401_2412337_-	putative RNA pseudouridine synthase YlyB	A0A2H4UV25	Bodo_saltans_virus	2.5e-11	29.1
AVG12775.1\|2412326_2412848_-	lipoprotein signal peptidase LspA	NA	NA	NA	NA
AVG12776.1\|2412992_2413724_+	transcriptional regulator, TraR/DksA family	NA	NA	NA	NA
AVG12777.1\|2413735_2414056_-	hypothetical protein	NA	NA	NA	NA
AVG12778.1\|2414131_2416900_-\|tRNA	isoleucine--tRNA ligase IleS	A0A2H4UVG0	Bodo_saltans_virus	2.0e-77	26.7

DBSCAN-SWA_24

2468126 : 2713146

266

Paenibacillus_phage(68.61%)

holin,protease,portal,tail,tRNA,coat,integrase,lysis,capsid,transposase

attL 2566595:2566654|attR 2699739:2701127

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG12827.1\|2468126_2469335_-\|tRNA	putative tRNA sulfurtransferase ThiI	NA	NA	NA	NA
AVG12828.1\|2469337_2470510_-	putative cysteine desulfurase IscS	NA	NA	NA	NA
AVG12829.1\|2470641_2471427_-	transglycosylase SLT domain protein	A0A0H3V0Q1	Geobacillus_virus	5.3e-23	43.8
AVG12830.1\|2471548_2472325_-	putative membrane protein	NA	NA	NA	NA
AVG12831.1\|2472321_2473245_-	ABC transporter, ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-36	37.7
AVG12832.1\|2473388_2473694_-	hypothetical protein	NA	NA	NA	NA
AVG12833.1\|2473727_2473937_-	ABC transporter, permease protein, putative	NA	NA	NA	NA
AVG12834.1\|2474120_2474621_-	hypothetical protein	NA	NA	NA	NA
AVG12835.1\|2476799_2478023_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG12836.1\|2478193_2479417_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8
AVG12837.1\|2480057_2481173_-	metal-binding protein	NA	NA	NA	NA
AVG12838.1\|2481148_2481907_-\|tRNA	tRNA (adenine(22)-N(1))-methyltransferase TrmK	NA	NA	NA	NA
AVG12839.1\|2481910_2482741_-	hypothetical protein	NA	NA	NA	NA
AVG12840.1\|2482884_2484012_-	RNA polymerase sigma factor rpoD	M4SMP8	Cyanophage	3.8e-38	37.2
AVG12841.1\|2484058_2485885_-	DNA primase DnaG	A0A1S5REW9	Helicobacter_phage	1.8e-42	32.7
AVG12842.1\|2485927_2486401_-	hypothetical protein	NA	NA	NA	NA
AVG12843.1\|2486482_2487310_-	putative phosphotransferase	NA	NA	NA	NA
AVG12844.1\|2487535_2488288_-	DNA repair protein RecO	NA	NA	NA	NA
AVG12845.1\|2488586_2489489_-	GTPase Era	NA	NA	NA	NA
AVG12846.1\|2489534_2489945_-	cytidine deaminase	NA	NA	NA	NA
AVG12847.1\|2489961_2490678_-	diacylglycerol kinase	NA	NA	NA	NA
AVG12848.1\|2490674_2491187_-	putative rRNA maturation factor	NA	NA	NA	NA
AVG12849.1\|2491278_2493561_-	membrane-associated hydrolase-like protein	NA	NA	NA	NA
AVG12850.1\|2493557_2494529_-	PhoH-like protein PhoH	A0A0S0MVD6	Pseudomonas_phage	1.8e-49	47.4
AVG12851.1\|2494547_2495726_-	putative stage IV sporulation protein	NA	NA	NA	NA
AVG12852.1\|2495749_2496031_-	YqfC	NA	NA	NA	NA
AVG12853.1\|2496224_2496665_-	YqeY-like protein	A0A292GL36	Xanthomonas_phage	1.2e-19	40.4
AVG12854.1\|2496999_2497347_-	Hit-like protein	NA	NA	NA	NA
AVG12855.1\|2499763_2501185_-	ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein	W8CYF6	Bacillus_phage	3.6e-38	32.9
AVG12856.1\|2501171_2501882_-	putative transcriptional regulatory protein OmpR	W8CYM9	Bacillus_phage	4.6e-34	35.7
AVG12857.1\|2501910_2503281_-	putative lipoprotein	NA	NA	NA	NA
AVG12858.1\|2503476_2504436_-	polysaccharide deacetylase	NA	NA	NA	NA
AVG12859.1\|2504683_2505427_-	pyruvate formate-lyase 1-activating enzyme PflA	NA	NA	NA	NA
AVG12860.1\|2505595_2507860_-	formate acetyltransferase PflB	A0A2P0VNR5	Tetraselmis_virus	2.1e-189	44.7
AVG12861.1\|2507985_2510601_-	aldehyde-alcohol dehydrogenase AdhE	NA	NA	NA	NA
AVG12862.1\|2510818_2512042_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12863.1\|2512282_2512813_+	hypothetical protein	NA	NA	NA	NA
AVG12864.1\|2512955_2513567_-	molybdopterin-guanine dinucleotide biosynthesis protein A	NA	NA	NA	NA
AVG12865.1\|2513787_2514510_+	anaerobic regulatory protein Fnr	NA	NA	NA	NA
AVG12866.1\|2514676_2515015_-	assimilatory nitrite reductase subunit	NA	NA	NA	NA
AVG12867.1\|2515029_2517474_-	nitrite reductase (NAD(P)H)	NA	NA	NA	NA
AVG12868.1\|2517647_2518871_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	3.4e-226	99.3
AVG12869.1\|2518935_2519205_+	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
AVG12870.1\|2519113_2519338_-	hypothetical protein	NA	NA	NA	NA
AVG12871.1\|2519442_2522895_-	nuclease sbcCD subunit C	A0A1D8KRV2	Synechococcus_phage	3.5e-10	32.0
AVG12872.1\|2522908_2524084_-	nuclease sbcCD subunit D	NA	NA	NA	NA
AVG12873.1\|2524097_2528273_-	ATP-dependent helicase/nuclease subunit A	G3MA40	Bacillus_virus	2.6e-07	25.1
AVG12874.1\|2528250_2531853_-	ATP-dependent helicase/deoxyribonuclease subunit B	NA	NA	NA	NA
AVG12875.1\|2532320_2532830_-\|transposase	transposase	NA	NA	NA	NA
AVG12876.1\|2532847_2533336_-\|transposase	transposase	A0A0K2CZQ0	Paenibacillus_phage	6.5e-11	96.8
AVG12877.1\|2533363_2534587_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12878.1\|2534607_2534802_-\|transposase	transposase	NA	NA	NA	NA
AVG12879.1\|2535040_2535592_-	DinB superfamily protein	NA	NA	NA	NA
AVG12880.1\|2535638_2536367_-	hypothetical protein	NA	NA	NA	NA
AVG12881.1\|2536639_2536906_+	hypothetical protein	NA	NA	NA	NA
AVG12882.1\|2536959_2537496_-	putative acetyltransferase	NA	NA	NA	NA
AVG12883.1\|2537587_2538952_-	ribosomal RNA large subunit methyltransferase I	W6LLI2	Streptococcus_phage	4.8e-19	22.2
AVG12884.1\|2539081_2540140_+	Na+/anion cotransporter-like protein	NA	NA	NA	NA
AVG12885.1\|2540151_2540577_-	Putative mutator protein MutT4	NA	NA	NA	NA
AVG12886.1\|2540724_2542074_-	putative methylthiotransferase YqeV	NA	NA	NA	NA
AVG12887.1\|2542076_2542844_-	RNA methyltransferase, RsmE family	NA	NA	NA	NA
AVG12888.1\|2543009_2543687_-	peptidase, M50 family	NA	NA	NA	NA
AVG12889.1\|2543695_2543986_-	Ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AVG12890.1\|2544014_2544659_-	Ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AVG12891.1\|2544874_2545246_-	hypothetical protein	NA	NA	NA	NA
AVG12892.1\|2545262_2545403_-	hypothetical protein	NA	NA	NA	NA
AVG12893.1\|2545553_2546675_-	chaperone protein DnaJ	A0A1V0SBY2	Catovirus	2.0e-31	34.8
AVG12894.1\|2546834_2548688_-	chaperone protein DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.9e-143	49.2
AVG12895.1\|2548744_2549344_-	molecular chaperone GrpE	NA	NA	NA	NA
AVG12896.1\|2549466_2550498_-	heat-inducible transcription repressor HrcA	NA	NA	NA	NA
AVG12897.1\|2550541_2550982_-	putative acetyltransferase protein	NA	NA	NA	NA
AVG12898.1\|2551077_2551536_-	GCN5-related N-acetyltransferase	NA	NA	NA	NA
AVG12899.1\|2551636_2552788_-	oxygen-independent coproporphyrinogen-III oxidase 1	NA	NA	NA	NA
AVG12900.1\|2552868_2554683_-	elongation factor protein	E4ZFJ7	Streptococcus_phage	4.4e-20	23.7
AVG12901.1\|2554759_2555203_-	hypothetical protein	NA	NA	NA	NA
AVG12902.1\|2555239_2556220_-	spore autolysin-like protein	NA	NA	NA	NA
AVG12903.1\|2556207_2556435_-	hypothetical protein	NA	NA	NA	NA
AVG12904.1\|2556636_2557632_-\|protease	germination protease Gpr	NA	NA	NA	NA
AVG12905.1\|2557817_2558090_+	30S ribosomal protein S20	NA	NA	NA	NA
AVG12906.1\|2558188_2559214_-	DNA polymerase III subunit delta-like protein	NA	NA	NA	NA
AVG12907.1\|2559545_2560583_-	putative transmembrane transcriptional regulator (anti-sigma factor)	NA	NA	NA	NA
AVG12908.1\|2560572_2561127_-	putative RNA polymerase sigma factor SigW	NA	NA	NA	NA
AVG12909.1\|2561651_2562326_-	macrolide export ATP-binding/permease protein MacB	G9BWD6	Planktothrix_phage	1.6e-31	38.5
AVG12910.1\|2562401_2563625_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
AVG12911.1\|2563713_2566242_-	FtsX-like permease family protein	NA	NA	NA	NA
AVG12912.1\|2566369_2566489_-	hypothetical protein	NA	NA	NA	NA
2566595:2566654	attL	NA	NA	NA	NA
AVG12913.1\|2566714_2567938_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG12914.1\|2568046_2568325_-	beta-lactamase domain-containing protein	M1PSD2	Streptococcus_phage	2.7e-14	54.2
AVG12915.1\|2568764_2569004_-	hypothetical protein	A0A0K2CYG5	Paenibacillus_phage	3.0e-22	66.2
AVG12916.1\|2569764_2571327_-	bacillolysin	NA	NA	NA	NA
AVG12917.1\|2572142_2572628_+	hypothetical protein	A0A0C5AN10	Bacteriophage	1.5e-52	66.2
AVG12918.1\|2572830_2574054_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG12919.1\|2574224_2575448_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	2.4e-227	99.8
AVG12920.1\|2575878_2576091_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	2.3e-34	97.1
AVG12921.1\|2576221_2576596_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	4.6e-65	96.8
AVG12922.1\|2576567_2576681_-	hypothetical protein	NA	NA	NA	NA
AVG12923.1\|2576719_2577676_-	ribonuclease Z	NA	NA	NA	NA
AVG12924.1\|2577850_2581291_-	methionine synthase MetH	A0A140XBC7	Dickeya_phage	5.1e-09	46.7
AVG12925.1\|2581567_2582110_+	acireductone dioxygenase MtnD	NA	NA	NA	NA
AVG12926.1\|2582215_2583010_-	phosphatase-like protein	NA	NA	NA	NA
AVG12927.1\|2583036_2583222_-	hypothetical protein	NA	NA	NA	NA
AVG12928.1\|2583403_2583781_-	Cell division suppressor protein YneA	NA	NA	NA	NA
AVG12929.1\|2583926_2584544_+	LexA repressor	A0A1B2APZ1	Phage_Wrath	6.5e-16	63.8
AVG12930.1\|2584689_2584956_-	hypothetical protein	A0A2I7SCW2	Paenibacillus_phage	1.9e-28	72.7
AVG12931.1\|2585452_2585686_-	hypothetical protein	A0A0K2CYV5	Paenibacillus_phage	2.2e-09	46.6
AVG12932.1\|2585783_2586875_-	membrane transcriptional regulator-like protein	NA	NA	NA	NA
AVG12933.1\|2588292_2589042_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG12934.1\|2589131_2589644_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG12935.1\|2589913_2590324_+	hypothetical protein	NA	NA	NA	NA
AVG12936.1\|2590367_2590829_+\|transposase	putative transposase for insertion sequence element IS3 family protein	A0A2I6AZV9	Macacine_betaherpesvirus	4.2e-20	40.7
AVG12937.1\|2590818_2591151_+	hypothetical protein	NA	NA	NA	NA
AVG12938.1\|2590990_2591341_-	hypothetical protein	NA	NA	NA	NA
AVG12939.1\|2591608_2592832_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	3.4e-226	99.3
AVG12940.1\|2593205_2593877_+\|integrase	integrase catalytic region	Q6H9S6	Enterobacteria_phage	3.9e-14	27.8
AVG12941.1\|2594145_2594961_-\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-58	45.4
AVG12942.1\|2595008_2595296_-\|transposase	transposase IS3/IS911 family protein	A0A1P8CWP5	Bacillus_phage	2.4e-05	37.8
AVG12943.1\|2595590_2596922_-	glutamine ligase GlnA	NA	NA	NA	NA
AVG12944.1\|2596958_2597366_-	HTH-type transcriptional regulator GlnR	NA	NA	NA	NA
AVG12945.1\|2597378_2597474_-	hypothetical protein	NA	NA	NA	NA
AVG12946.1\|2597536_2598787_-	aluminum resistance protein	NA	NA	NA	NA
AVG12947.1\|2598829_2600119_-	GTP-binding protein HflX	NA	NA	NA	NA
AVG12948.1\|2600144_2601134_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.4e-51	45.5
AVG12949.1\|2601260_2602307_-	lipoate-protein ligase LplJ	NA	NA	NA	NA
AVG12950.1\|2602303_2603005_-	vancomycin high temperature exclusion protein	NA	NA	NA	NA
AVG12951.1\|2603194_2603581_-	carboxylesterase	NA	NA	NA	NA
AVG12952.1\|2603631_2604306_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.2e-20	48.8
AVG12953.1\|2604489_2606922_-	penicillin-binding protein 1F	NA	NA	NA	NA
AVG12954.1\|2607070_2607310_-	RNA-binding protein Hfq	NA	NA	NA	NA
AVG12955.1\|2607387_2608350_-\|tRNA	tRNA dimethylallyltransferase MiaA	NA	NA	NA	NA
AVG12956.1\|2608337_2609168_-	methyltransferase-like protein	NA	NA	NA	NA
AVG12957.1\|2609237_2611286_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	2.0e-66	30.5
AVG12958.1\|2611316_2613998_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.3e-28	22.2
AVG12959.1\|2614121_2615477_-	hypothetical protein	NA	NA	NA	NA
AVG12960.1\|2615578_2616148_-\|coat	spore coat protein E	NA	NA	NA	NA
AVG12961.1\|2616407_2616794_+	hypothetical protein	A0A0N9SIM5	Paenibacillus_phage	5.9e-60	91.4
AVG12962.1\|2616961_2617456_+	Telomeric repeat-binding factor 2	A0A0N7GFE7	Paenibacillus_phage	2.7e-41	100.0
AVG12963.1\|2617492_2618125_+	hypothetical protein	A0A0N9SJT2	Paenibacillus_phage	3.7e-51	68.1
AVG12964.1\|2618291_2618567_+	hypothetical protein	A0A2I7SCF3	Paenibacillus_phage	3.3e-44	95.6
AVG12965.1\|2618617_2618968_+	phage protein	A0A2I7SCF2	Paenibacillus_phage	7.5e-54	90.5
AVG12966.1\|2618973_2619348_+	hypothetical protein	A0A2I7SCF4	Paenibacillus_phage	9.9e-52	81.5
AVG12967.1\|2619390_2619624_-	putative transcriptional regulator	A0A2K9V490	Faecalibacterium_phage	2.5e-05	37.3
AVG12968.1\|2619763_2620186_+	bacteriophage protein	O48383	Streptococcus_phage	3.7e-07	75.0
AVG12969.1\|2620323_2621415_+	hypothetical protein	NA	NA	NA	NA
AVG12970.1\|2621561_2622191_-	hypothetical protein	NA	NA	NA	NA
AVG12971.1\|2622196_2622406_-	hypothetical protein	NA	NA	NA	NA
AVG12972.1\|2622545_2622827_+	hypothetical protein	NA	NA	NA	NA
AVG12973.1\|2622967_2623186_+	hypothetical protein	NA	NA	NA	NA
AVG12974.1\|2623239_2623518_+	hypothetical protein	A0A0K2CZR1	Paenibacillus_phage	3.2e-31	80.5
AVG12975.1\|2623702_2624572_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase CwlC	A0A0N9SGH1	Paenibacillus_phage	6.1e-161	94.8
AVG12976.1\|2624564_2624900_-\|holin,lysis	toxin secretion/phage lysis holin	A0A0N7GFE6	Paenibacillus_phage	1.6e-48	92.8
AVG12977.1\|2624845_2624980_-	hypothetical protein	NA	NA	NA	NA
AVG12978.1\|2624967_2625408_-	phage-related protein	A0A0N9S7V6	Paenibacillus_phage	1.9e-49	67.1
AVG12979.1\|2625404_2627723_-	phage minor structural protein	A0A0N9SIL8	Paenibacillus_phage	0.0e+00	93.9
AVG12980.1\|2627725_2629183_-\|tail	phage tail component	A0A0N9RRA9	Paenibacillus_phage	4.7e-283	96.9
AVG12981.1\|2629184_2630021_-	hypothetical protein	A0A0N9SJR9	Paenibacillus_phage	1.8e-32	52.4
AVG12982.1\|2630177_2632079_-\|tail	putative phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	3.3e-220	75.4
AVG12983.1\|2632106_2632271_-	hypothetical protein	A0A0N9RZB8	Paenibacillus_phage	5.1e-13	70.4
AVG12984.1\|2632456_2632840_-	hypothetical protein	A0A0N9SST2	Paenibacillus_phage	5.0e-43	67.7
AVG12985.1\|2632842_2633100_-	hypothetical protein	A0A0K2CZ43	Paenibacillus_phage	1.4e-12	51.9
AVG12986.1\|2633164_2633713_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	6.2e-95	98.4
AVG12987.1\|2633725_2634100_-	hypothetical protein	A0A0N7GFE5	Paenibacillus_phage	1.6e-62	96.0
AVG12988.1\|2634096_2634522_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	1.3e-71	95.0
AVG12989.1\|2634518_2634851_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	1.1e-54	94.5
AVG12990.1\|2634851_2635235_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	9.7e-63	95.3
AVG12991.1\|2635249_2636236_-\|capsid	major capsid protein	A0A0N9S7T7	Paenibacillus_phage	3.5e-157	89.0
AVG12992.1\|2636292_2636928_-	Phage minor structural protein GP20	A0A0N9SIL0	Paenibacillus_phage	1.6e-54	83.4
AVG12993.1\|2637016_2637880_-	putative phage protein	A0A0N9SJR1	Paenibacillus_phage	4.9e-147	92.7
AVG12994.1\|2637876_2639256_-\|portal	phage portal protein, SPP1 family	A0A0N7GFE4	Paenibacillus_phage	4.1e-252	93.7
AVG12995.1\|2639402_2639861_-	hypothetical protein	A0A0K2CZJ8	Paenibacillus_phage	8.6e-74	86.1
AVG12996.1\|2639873_2641640_-	phage protein	A0A0N9RZA7	Paenibacillus_phage	0.0e+00	98.0
AVG12997.1\|2642601_2642853_-	hypothetical protein	NA	NA	NA	NA
AVG12998.1\|2643694_2644093_-	hypothetical protein	A0A0N7GFF5	Paenibacillus_phage	7.5e-66	99.2
AVG12999.1\|2644082_2644520_-	putative phage-associated protein	A0A0N9SJZ8	Paenibacillus_phage	5.7e-59	79.3
AVG13000.1\|2644521_2644689_-	hypothetical protein	A0A0N9RTP7	Paenibacillus_phage	4.3e-15	75.9
AVG13001.1\|2644977_2646201_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG13002.1\|2646390_2646783_-	hypothetical protein	NA	NA	NA	NA
AVG13003.1\|2647113_2647518_-	hypothetical protein	A0A0N9RRE8	Paenibacillus_phage	7.4e-61	88.9
AVG13004.1\|2647582_2647816_-	hypothetical protein	A0A0N9SJZ3	Paenibacillus_phage	9.8e-34	94.8
AVG13005.1\|2647904_2648363_-	hypothetical protein	A0A0N7GFF4	Paenibacillus_phage	7.3e-73	91.4
AVG13006.1\|2648352_2648760_-	hypothetical protein	A0A0N9RZI0	Paenibacillus_phage	1.0e-62	94.1
AVG13007.1\|2648747_2650046_-	modification methylase	A0A1P8CX25	Bacillus_phage	5.4e-97	44.8
AVG13008.1\|2650124_2650508_+	hypothetical protein	A0A0N9SHP7	Paenibacillus_phage	8.8e-56	76.4
AVG13009.1\|2650464_2651025_-	deoxynucleoside monophosphate kinase	A0A0N9SJZ0	Paenibacillus_phage	3.2e-99	96.7
AVG13010.1\|2651008_2651869_-	hypothetical protein	A0A0N9RTN7	Paenibacillus_phage	4.6e-121	78.0
AVG13011.1\|2651872_2652337_-	putative prophage protein	A0A0N9SGM1	Paenibacillus_phage	1.8e-87	99.4
AVG13012.1\|2652330_2652624_-	hypothetical protein	A0A0N9S804	Paenibacillus_phage	5.7e-39	82.6
AVG13013.1\|2652624_2652864_-	hypothetical protein	NA	NA	NA	NA
AVG13014.1\|2652865_2653255_-	SprT-like family protein	A0A0N7GFF3	Paenibacillus_phage	4.6e-52	76.7
AVG13015.1\|2653268_2653595_-	hypothetical protein	NA	NA	NA	NA
AVG13016.1\|2653595_2653790_-	hypothetical protein	NA	NA	NA	NA
AVG13017.1\|2653789_2654128_-	hypothetical protein	NA	NA	NA	NA
AVG13018.1\|2654078_2654381_-	hypothetical protein	NA	NA	NA	NA
AVG13019.1\|2654387_2654591_-	hypothetical protein	NA	NA	NA	NA
AVG13020.1\|2654577_2654832_-	hypothetical protein	NA	NA	NA	NA
AVG13021.1\|2654824_2655178_-	hypothetical protein	A0A0K2CZG5	Paenibacillus_phage	2.2e-37	85.7
AVG13022.1\|2655207_2655666_-	deoxyuridine 5'-triphosphate nucleotidohydrolase Dut	D2XR49	Bacillus_phage	2.9e-37	53.8
AVG13023.1\|2655677_2656709_-	ribonucleoside-diphosphate reductase subunit beta	A0A0E3X9K0	Bacillus_phage	5.6e-121	60.3
AVG13024.1\|2656681_2656939_-	hypothetical protein	NA	NA	NA	NA
AVG13025.1\|2656953_2659080_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0Y0AS84	Bacillus_phage	2.3e-278	66.9
AVG13026.1\|2659237_2659420_-	hypothetical protein	NA	NA	NA	NA
AVG13027.1\|2659416_2659647_-	crossover junction endodeoxyribonuclease	A0A0N9ST03	Paenibacillus_phage	2.9e-30	86.8
AVG13028.1\|2659924_2660869_-	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	1.2e-146	87.1
AVG13029.1\|2660928_2661543_-	DNA polymerase III PolC-like protein	A0A0N9SJX9	Paenibacillus_phage	4.8e-96	89.2
AVG13030.1\|2661543_2662671_-	DNA-directed DNA polymerase	A0A0N9RTM8	Paenibacillus_phage	2.1e-174	78.6
AVG13031.1\|2662676_2664533_-	DNA polymerase I	A0A0N9S7Z3	Paenibacillus_phage	3.1e-303	92.0
AVG13032.1\|2664472_2665282_-	hypothetical protein	A0A0N9SIQ5	Paenibacillus_phage	1.0e-106	75.8
AVG13033.1\|2665293_2665503_-	hypothetical protein	A0A0N9SJW4	Paenibacillus_phage	1.1e-31	94.2
AVG13034.1\|2665490_2665904_-	hypothetical protein	A0A0N9RZF9	Paenibacillus_phage	1.7e-73	97.1
AVG13035.1\|2665933_2666053_-	hypothetical protein	A0A0N7GFF1	Paenibacillus_phage	1.5e-06	71.8
AVG13036.1\|2666067_2666274_-	hypothetical protein	NA	NA	NA	NA
AVG13037.1\|2666286_2667024_-	hypothetical protein	A0A0N9SJW5	Paenibacillus_phage	8.0e-138	98.4
AVG13038.1\|2667109_2667634_-	hypothetical protein	A0A0N9RTM1	Paenibacillus_phage	3.9e-54	66.7
AVG13039.1\|2667699_2668263_-	hypothetical protein	A0A0N9SGJ9	Paenibacillus_phage	3.0e-76	88.8
AVG13040.1\|2668316_2669267_-	DNA primase	A0A0N9S7Y2	Paenibacillus_phage	4.1e-163	88.6
AVG13041.1\|2669279_2670656_-	replicative DNA helicase	A0A0N9SIP5	Paenibacillus_phage	3.8e-258	98.0
AVG13042.1\|2670652_2671423_-	putative DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	7.3e-142	95.3
AVG13043.1\|2671430_2671697_-	hypothetical protein	A0A0N9RRC8	Paenibacillus_phage	3.4e-38	85.2
AVG13044.1\|2671707_2672235_-	hypothetical protein	A0A0N9SJU7	Paenibacillus_phage	4.3e-77	83.4
AVG13045.1\|2672237_2672360_-	hypothetical protein	NA	NA	NA	NA
AVG13046.1\|2672372_2673206_-	hypothetical protein	A0A0N9RZE9	Paenibacillus_phage	7.0e-90	67.9
AVG13047.1\|2673220_2673589_-	hypothetical protein	A0A0N9SSX1	Paenibacillus_phage	6.3e-59	89.3
AVG13048.1\|2673572_2673950_-	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	1.0e-40	70.9
AVG13049.1\|2674007_2674379_-	hypothetical protein	A0A0N9SJV6	Paenibacillus_phage	2.9e-19	43.1
AVG13050.1\|2674409_2674658_-	hypothetical protein	A0A0N9RTL0	Paenibacillus_phage	5.9e-45	98.8
AVG13051.1\|2674826_2675153_-	hypothetical protein	A0A0N7GFE9	Paenibacillus_phage	1.2e-53	98.1
AVG13052.1\|2675173_2675500_-	hypothetical protein	A0A0N9SGJ1	Paenibacillus_phage	3.4e-56	99.1
AVG13053.1\|2675526_2675829_-	hypothetical protein	A0A0N9S7X2	Paenibacillus_phage	3.7e-41	86.0
AVG13054.1\|2675825_2675996_-	hypothetical protein	A0A0N9SIN5	Paenibacillus_phage	1.0e-19	91.2
AVG13055.1\|2675992_2676169_-	hypothetical protein	NA	NA	NA	NA
AVG13056.1\|2676202_2676439_-	hypothetical protein	A0A0C5AER7	Bacteriophage	3.4e-26	73.9
AVG13057.1\|2676553_2676670_-	hypothetical protein	A0A0N7GFE8	Paenibacillus_phage	3.4e-11	88.6
AVG13058.1\|2676666_2676834_-	hypothetical protein	A0A0N7GFE8	Paenibacillus_phage	3.4e-12	80.9
AVG13059.1\|2676843_2677077_-	hypothetical protein	A0A0N9SHK5	Paenibacillus_phage	8.6e-22	91.5
AVG13060.1\|2677250_2677886_+	putative repressor LexA	A0A0N9RTK0	Paenibacillus_phage	1.2e-78	85.9
AVG13061.1\|2677898_2679077_+\|integrase	integrase Int	A0A0N9SGH8	Paenibacillus_phage	1.1e-216	97.4
AVG13062.1\|2679198_2680161_-	putative lipoprotein	NA	NA	NA	NA
AVG13063.1\|2680374_2680716_-	Putative aliphatic sulfonates transport permease protein SsuC	NA	NA	NA	NA
AVG13064.1\|2680880_2681432_-	glycine betaine transport ATP-binding protein OpuAA	G3M9Y6	Bacillus_virus	2.3e-20	39.6
AVG13065.1\|2681432_2681675_-	ABC transporter, ATP-binding protein	NA	NA	NA	NA
AVG13066.1\|2681841_2682342_-	ABC transporter-like protein	NA	NA	NA	NA
AVG13067.1\|2682654_2683377_+\|transposase	putative transposase	NA	NA	NA	NA
AVG13068.1\|2683465_2684689_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13069.1\|2684998_2686519_-	Zn-dependent carboxypeptidase	NA	NA	NA	NA
AVG13070.1\|2686625_2686961_+	HesB/YadR/YfhF-family protein	NA	NA	NA	NA
AVG13071.1\|2686983_2687574_+	putative carbonic anhydrase YtiB	NA	NA	NA	NA
AVG13072.1\|2687570_2688125_-	hypothetical protein	NA	NA	NA	NA
AVG13073.1\|2688252_2688684_+	hypothetical protein	NA	NA	NA	NA
AVG13074.1\|2688683_2688962_+	hypothetical protein	NA	NA	NA	NA
AVG13075.1\|2689138_2691376_-	immune inhibitor A	NA	NA	NA	NA
AVG13076.1\|2691650_2692121_-	putative metal-dependent hydrolase of the TIM-barrel fold protein	NA	NA	NA	NA
AVG13077.1\|2692153_2695279_-	putative N-acetyltransferase YvbK	NA	NA	NA	NA
AVG13078.1\|2695414_2697013_-	malate synthase Mls	NA	NA	NA	NA
AVG13079.1\|2697042_2698437_-	isocitrate lyase AceA	A0A0K2CZQ0	Paenibacillus_phage	1.9e-10	96.8
AVG13080.1\|2698464_2699688_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13081.1\|2699858_2701082_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13082.1\|2701163_2701772_+	ABC transporter-like protein	M1I2G3	Paramecium_bursaria_Chlorella_virus	3.0e-05	23.9
2699739:2701127	attR	NA	NA	NA	NA
AVG13083.1\|2701768_2702221_+	ABC transporter-like protein	A0A2H4PQG7	Staphylococcus_phage	8.6e-10	37.8
AVG13084.1\|2702427_2702811_-	kinase-associated lipoprotein B	NA	NA	NA	NA
AVG13085.1\|2702930_2703269_-	putative thioredoxin	NA	NA	NA	NA
AVG13086.1\|2703291_2703825_-	hypothetical protein	NA	NA	NA	NA
AVG13087.1\|2703907_2705527_-	ABC transporter, ATP-binding protein	A0A2K9L0W2	Tupanvirus	2.4e-54	27.9
AVG13088.1\|2705557_2707471_-	ABC transporter, ATP-binding protein	A0A2K9L3Z8	Tupanvirus	6.4e-54	29.9
AVG13089.1\|2708864_2709161_-	stress responsive A/B barrel domain protein	NA	NA	NA	NA
AVG13090.1\|2709180_2710737_-	ABC efflux transporter-like protein	A0A2K9L3Z8	Tupanvirus	4.9e-52	28.5
AVG13091.1\|2710866_2712618_-	type VI secretion system FHA domain protein	NA	NA	NA	NA
AVG13092.1\|2712630_2713146_-\|protease	putative Flp pilus assembly protein, protease CpaA	NA	NA	NA	NA

DBSCAN-SWA_25

2803332 : 2855124

Paenibacillus_phage(23.53%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13179.1\|2803332_2805999_-\|tRNA	valine--tRNA ligase ValS	A0A1V0SK04	Klosneuvirus	2.1e-167	41.3
AVG13180.1\|2806791_2807928_-	stage VI sporulation protein D	NA	NA	NA	NA
AVG13181.1\|2808032_2808431_-	putative RNA pseudouridine synthase YhcT	NA	NA	NA	NA
AVG13182.1\|2808917_2809997_+	exopolysaccharide biosynthesis protein	A0A1P8CWN9	Bacillus_phage	1.7e-11	30.9
AVG13183.1\|2810329_2811286_-	pantothenate kinase CoaA	A0A1B1ISL9	uncultured_Mediterranean_phage	5.3e-33	34.6
AVG13184.1\|2811530_2812832_-	glutamate-1-semialdehyde 2,1-aminomutase 2	NA	NA	NA	NA
AVG13185.1\|2812894_2814334_-	protoporphyrinogen oxidase HemY	NA	NA	NA	NA
AVG13186.1\|2814374_2815304_-	ferrochelatase HemH	NA	NA	NA	NA
AVG13187.1\|2815300_2816374_-	uroporphyrinogen decarboxylase HemE	NA	NA	NA	NA
AVG13188.1\|2816566_2817562_-	delta-aminolevulinic acid dehydratase HemB	NA	NA	NA	NA
AVG13189.1\|2817582_2819133_-	porphyrin biosynthesis protein HemD	NA	NA	NA	NA
AVG13190.1\|2819149_2820094_-	porphobilinogen deaminase HemC	NA	NA	NA	NA
AVG13191.1\|2820142_2820880_-	precorrin-2 dehydrogenase SirC	NA	NA	NA	NA
AVG13192.1\|2820876_2821719_-	protein HemX	NA	NA	NA	NA
AVG13193.1\|2821750_2823151_-\|tRNA	glutamyl-tRNA reductase HemA	NA	NA	NA	NA
AVG13194.1\|2823322_2823856_-	hypothetical protein	NA	NA	NA	NA
AVG13195.1\|2823993_2824395_-	S-adenosylmethionine decarboxylase proenzyme SpeH	A0A0E3FA82	Synechococcus_phage	1.2e-18	36.4
AVG13196.1\|2824767_2825355_-	hypothetical protein	NA	NA	NA	NA
AVG13197.1\|2825745_2826360_-	putative GTP-binding protein EngB	NA	NA	NA	NA
AVG13198.1\|2826378_2828712_-\|protease	Lon protease Lon	A0A0R6PGP8	Moraxella_phage	4.3e-169	41.5
AVG13199.1\|2828861_2830580_-\|protease	Lon protease 2	A0A0R6PGP8	Moraxella_phage	4.7e-16	24.7
AVG13200.1\|2830804_2831503_+	N-acetylmuramoyl-L-alanine amidase-like protein	NA	NA	NA	NA
AVG13201.1\|2831553_2832675_-	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG	NA	NA	NA	NA
AVG13202.1\|2832779_2834039_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.5e-149	65.0
AVG13203.1\|2834054_2834645_-\|protease	ATP-dependent Clp protease proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	4.2e-57	56.6
AVG13204.1\|2834809_2836111_-	trigger factor Tig	NA	NA	NA	NA
AVG13205.1\|2836289_2837192_-	hypothetical protein	NA	NA	NA	NA
AVG13206.1\|2837322_2838543_-	PGA biosynthesis protein CapA	A0A2H4J5Z6	uncultured_Caudovirales_phage	4.8e-55	33.9
AVG13207.1\|2838639_2838756_-	hypothetical protein	NA	NA	NA	NA
AVG13208.1\|2838769_2838883_-	hypothetical protein	NA	NA	NA	NA
AVG13209.1\|2838937_2840452_-	Bacterial membrane flanked domain protein	NA	NA	NA	NA
AVG13210.1\|2840444_2840921_-	Bacterial membrane flanked domain protein	NA	NA	NA	NA
AVG13211.1\|2841086_2841632_-	hypothetical protein	NA	NA	NA	NA
AVG13212.1\|2841728_2843573_+	asparagine ligase	L7RC73	Acanthamoeba_polyphaga_moumouvirus	5.8e-28	24.7
AVG13213.1\|2843640_2844273_-	Non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
AVG13214.1\|2844259_2845015_-	ribonuclease PH	NA	NA	NA	NA
AVG13215.1\|2845350_2846382_-	spore germination protein GerM	NA	NA	NA	NA
AVG13216.1\|2846618_2847134_+	phosphatidylglycerophosphatase A-like protein	G3MBC5	Bacillus_virus	1.9e-37	53.6
AVG13217.1\|2847245_2848055_+	putative membrane protein	NA	NA	NA	NA
AVG13218.1\|2848177_2849401_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13219.1\|2849515_2849869_-	putative lethal factor domain protein	NA	NA	NA	NA
AVG13220.1\|2850188_2850995_-	methyltransferase	NA	NA	NA	NA
AVG13221.1\|2851061_2851175_-	hypothetical protein	NA	NA	NA	NA
AVG13222.1\|2851280_2851511_-	hypothetical protein	R9W000	Paenibacillus_phage	5.0e-06	96.7
AVG13223.1\|2851520_2852198_-	N-acetylmuramoyl-L-alanine amidase	A0A0K2CYE7	Paenibacillus_phage	6.9e-128	94.7
AVG13224.1\|2852674_2853898_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13225.1\|2854012_2854141_-	hypothetical protein	A0A2H4J054	uncultured_Caudovirales_phage	2.8e-06	56.1
AVG13226.1\|2854140_2855124_-	phage structural protein	A0A0C5AEQ0	Bacteriophage	7.1e-49	75.9

DBSCAN-SWA_26

2861083 : 2901776

Paenibacillus_phage(36.36%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13234.1\|2861083_2862307_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13235.1\|2862994_2863219_-	spore germination protein GerE	A0A290GJH9	Caldibacillus_phage	3.7e-14	70.5
AVG13236.1\|2863359_2864679_-	putative permease	NA	NA	NA	NA
AVG13237.1\|2864809_2865742_-	dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	NA	NA	NA	NA
AVG13238.1\|2865722_2866424_-	dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit	NA	NA	NA	NA
AVG13239.1\|2866838_2867705_+	3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2	NA	NA	NA	NA
AVG13240.1\|2867788_2868625_-	glycosyltransferase-like protein	NA	NA	NA	NA
AVG13241.1\|2868611_2869628_-	glycosyl transferase family 2	NA	NA	NA	NA
AVG13242.1\|2869632_2870424_-	glycosyltransferase, group 2 family protein	NA	NA	NA	NA
AVG13243.1\|2870577_2871498_+	NAD dependent epimerase/dehydratase family protein WcaG	E3T4Y8	Cafeteria_roenbergensis_virus	7.4e-32	31.2
AVG13244.1\|2871579_2872299_-	glycosyltransferase-like protein	K7Z8A5	Megavirus	1.2e-10	23.6
AVG13245.1\|2872306_2873212_-	UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase	A0A291LAD7	Escherichia_phage	1.2e-15	25.7
AVG13246.1\|2873208_2874039_-	putative reductase	NA	NA	NA	NA
AVG13247.1\|2874035_2875022_-	polysaccharide biosynthesis protein CapD	A0A1V0SAI8	Catovirus	1.6e-40	33.4
AVG13248.1\|2875011_2876106_-	UDP-N-acetylglucosamine 2-epimerase WecB	A0A2P1ELS7	Moumouvirus	1.9e-87	44.4
AVG13249.1\|2876102_2877653_-	extracellular matrix biosynthesis-like protein	NA	NA	NA	NA
AVG13250.1\|2877833_2878205_-	hypothetical protein	NA	NA	NA	NA
AVG13251.1\|2878204_2879341_-	putative spore maturation protein	NA	NA	NA	NA
AVG13252.1\|2879315_2880506_-	putative spore maturation protein	NA	NA	NA	NA
AVG13253.1\|2880502_2881225_-\|coat	spore coat polysaccharide biosynthesis protein SpsI	G3MA50	Bacillus_virus	5.4e-46	40.9
AVG13254.1\|2881479_2883399_-	hypothetical protein	NA	NA	NA	NA
AVG13255.1\|2883410_2889314_-	hypothetical protein	NA	NA	NA	NA
AVG13256.1\|2889435_2889774_-	putative L,D-transpeptidase YkuD	NA	NA	NA	NA
AVG13257.1\|2891421_2892204_+	phosphatidylserine decarboxylase proenzyme Psd	NA	NA	NA	NA
AVG13258.1\|2892215_2892728_+	efflux transporter-like protein	NA	NA	NA	NA
AVG13259.1\|2892757_2893357_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVG13260.1\|2893678_2894431_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	9.3e-134	98.3
AVG13261.1\|2894568_2894688_-\|transposase	transposase	A0A0C5AJ29	Paenibacillus_phage	7.7e-11	97.4
AVG13262.1\|2894744_2895251_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.5e-74	97.2
AVG13263.1\|2895356_2895836_-	protein YtsP	NA	NA	NA	NA
AVG13264.1\|2895901_2896696_-	MSM operon regulatory protein-like protein	NA	NA	NA	NA
AVG13265.1\|2896699_2898139_-	NAD-dependent malic enzyme	NA	NA	NA	NA
AVG13266.1\|2898457_2899750_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AVG13267.1\|2899851_2900949_-	endo-1,4-D-glucanase	NA	NA	NA	NA
AVG13268.1\|2901266_2901776_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_27

2962380 : 2979814

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13330.1\|2962380_2963604_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13331.1\|2963631_2964777_+\|transposase	transposase	A0A0K2CZQ0	Paenibacillus_phage	2.0e-10	96.8
AVG13332.1\|2964758_2965229_+	hypothetical protein	NA	NA	NA	NA
AVG13333.1\|2965369_2966305_+	hypothetical protein	NA	NA	NA	NA
AVG13334.1\|2967584_2967797_+	hypothetical protein	NA	NA	NA	NA
AVG13335.1\|2967844_2968402_+\|transposase	transposase	NA	NA	NA	NA
AVG13336.1\|2968419_2968929_+\|transposase	transposase	NA	NA	NA	NA
AVG13337.1\|2968894_2970832_+	cellulose synthase regulator protein	NA	NA	NA	NA
AVG13338.1\|2970828_2971695_+	diguanylate cyclase	NA	NA	NA	NA
AVG13339.1\|2971919_2972600_-	putative membrane protein	NA	NA	NA	NA
AVG13340.1\|2972596_2972968_-	LrgA family protein	NA	NA	NA	NA
AVG13341.1\|2973090_2973984_+	putative HTH-type transcriptional regulator YwbI	NA	NA	NA	NA
AVG13342.1\|2974359_2974917_-	hypothetical protein	NA	NA	NA	NA
AVG13343.1\|2975027_2976176_-	transglutaminase domain protein	NA	NA	NA	NA
AVG13344.1\|2976203_2976659_-	hypothetical protein	NA	NA	NA	NA
AVG13345.1\|2976737_2977880_+	exporter-like protein	NA	NA	NA	NA
AVG13346.1\|2978083_2978452_+	ribonuclease-like protein	NA	NA	NA	NA
AVG13347.1\|2978462_2979212_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG13348.1\|2979301_2979814_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8

DBSCAN-SWA_28

2984400 : 3028389

Paenibacillus_phage(41.67%)

transposase,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13353.1\|2984400_2984880_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
AVG13354.1\|2984918_2985197_-	hypothetical protein	NA	NA	NA	NA
AVG13355.1\|2985284_2986268_+	membrane-bound metal-dependent hydrolase	NA	NA	NA	NA
AVG13356.1\|2986404_2986629_-	small, acid-soluble spore protein A	A0A1P8CX76	Bacillus_phage	5.6e-10	47.8
AVG13357.1\|2987133_2988120_-\|tRNA	tryptophan--tRNA ligase TrpS	NA	NA	NA	NA
AVG13358.1\|2988498_2989917_-	cobyrinic acid A,C-diamide synthase	NA	NA	NA	NA
AVG13359.1\|2990129_2990768_-	ribonuclease H	NA	NA	NA	NA
AVG13360.1\|2991362_2991527_-	LexA repressor-like protein	NA	NA	NA	NA
AVG13361.1\|2991591_2992815_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	5.8e-226	99.3
AVG13362.1\|2993065_2994871_-	oligoendopeptidase, pepF/M3 family	NA	NA	NA	NA
AVG13363.1\|2995238_2995532_+	hypothetical protein	NA	NA	NA	NA
AVG13364.1\|2995659_2996361_-	hypothetical protein	NA	NA	NA	NA
AVG13365.1\|2996388_2996772_-	bacterial globin family protein	NA	NA	NA	NA
AVG13366.1\|2996827_2996926_-	hypothetical protein	NA	NA	NA	NA
AVG13367.1\|2997083_2998334_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
AVG13368.1\|2998477_2999284_+	putative inorganic polyphosphate/ATP-NAD kinase PpnK	NA	NA	NA	NA
AVG13369.1\|2999482_3000142_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	2.2e-62	54.3
AVG13370.1\|3000334_3001099_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	4.5e-35	43.8
AVG13371.1\|3000960_3001380_-	hypothetical protein	NA	NA	NA	NA
AVG13372.1\|3001417_3002302_-	lipoyl synthase LipA	NA	NA	NA	NA
AVG13373.1\|3002490_3003576_+	peptidase, M23 family	A0A7K9	Microcystis_virus	5.1e-08	37.0
AVG13374.1\|3003630_3004449_-	spore formation-associated protein	NA	NA	NA	NA
AVG13375.1\|3005099_3006005_-	transcriptional regulator	NA	NA	NA	NA
AVG13376.1\|3006388_3007612_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13377.1\|3007979_3008732_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A0C5AEA5	Paenibacillus_phage	1.9e-134	98.7
AVG13378.1\|3008869_3009553_-\|transposase	transposase family protein	A0A0C5AJ29	Paenibacillus_phage	1.8e-120	98.2
AVG13379.1\|3009641_3010580_-	O-acetylserine sulfhydrylase CysK	C3U2M1	Lactococcus_phage	1.7e-84	55.7
AVG13380.1\|3010603_3011422_-	RNA methyltransferase, TrmH family	NA	NA	NA	NA
AVG13381.1\|3011424_3012084_-	Ktr system potassium uptake protein C	NA	NA	NA	NA
AVG13382.1\|3012240_3012450_+	small, acid-soluble spore protein I	NA	NA	NA	NA
AVG13383.1\|3012710_3013472_-\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG13384.1\|3013468_3014596_-\|coat	spore coat protein SA	NA	NA	NA	NA
AVG13385.1\|3014787_3016374_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	1.0e-12	34.3
AVG13386.1\|3016491_3017337_-	phosphohydrolase	NA	NA	NA	NA
AVG13387.1\|3017648_3019601_-	efflux ABC transporter, permease protein	NA	NA	NA	NA
AVG13388.1\|3019575_3020358_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-31	37.4
AVG13389.1\|3020539_3022057_-	lipoprotein-like protein	NA	NA	NA	NA
AVG13390.1\|3022172_3023135_-	ABC transporter-like protein	NA	NA	NA	NA
AVG13391.1\|3023152_3024082_-	ABC transporter, permease protein	NA	NA	NA	NA
AVG13392.1\|3024066_3024432_-	TatD-related deoxyribonuclease	NA	NA	NA	NA
AVG13393.1\|3024418_3025981_-	Two component transcriptional regulator, AraC family	NA	NA	NA	NA
AVG13394.1\|3025973_3027065_-	HAMP domain protein	NA	NA	NA	NA
AVG13395.1\|3027165_3028389_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_29

3047434 : 3171165

115

Paenibacillus_phage(40.0%)

tRNA,transposase,integrase

attL 3106211:3106270|attR 3171138:3172576

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13413.1\|3047434_3048658_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13414.1\|3048874_3049258_-	hypothetical protein	NA	NA	NA	NA
AVG13415.1\|3049883_3051107_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13416.1\|3051346_3052108_+	hydrolase-like protein	A0A2K9KZN8	Tupanvirus	3.0e-07	23.3
AVG13417.1\|3059227_3060127_-	hypothetical protein	NA	NA	NA	NA
AVG13418.1\|3060245_3060647_+	hypothetical protein	NA	NA	NA	NA
AVG13419.1\|3060835_3062536_-	putative glycosyl hydrolase	NA	NA	NA	NA
AVG13420.1\|3062689_3063124_-	peroxide operon regulator	NA	NA	NA	NA
AVG13421.1\|3063248_3063848_-	hypothetical protein	NA	NA	NA	NA
AVG13422.1\|3063889_3064219_-	hypothetical protein	NA	NA	NA	NA
AVG13423.1\|3064169_3064778_-	putative RNA polymerase sigma-E factor	NA	NA	NA	NA
AVG13424.1\|3065102_3065594_-	GCN5-related N-acetyltransferase	NA	NA	NA	NA
AVG13425.1\|3065707_3067156_-\|tRNA	aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B	NA	NA	NA	NA
AVG13426.1\|3067174_3068632_-\|tRNA	glutamyl-tRNA(Gln) amidotransferase subunit A	NA	NA	NA	NA
AVG13427.1\|3068665_3068953_-\|tRNA	aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C	NA	NA	NA	NA
AVG13428.1\|3069168_3070233_+	sensor-like protein	NA	NA	NA	NA
AVG13429.1\|3070327_3070708_-	hypothetical protein	NA	NA	NA	NA
AVG13430.1\|3070875_3071250_-	aminopeptidase-like protein	NA	NA	NA	NA
AVG13431.1\|3071358_3071982_-	metallo-beta-lactamase domain protein	A0A1X9I5D3	Streptococcus_phage	1.5e-28	40.9
AVG13432.1\|3072005_3072572_-	hypothetical protein	NA	NA	NA	NA
AVG13433.1\|3072687_3073293_-	membrane phosphatase-like protein	NA	NA	NA	NA
AVG13434.1\|3073423_3073939_+	Cytochrome c oxidase subunit 2	NA	NA	NA	NA
AVG13435.1\|3074139_3074328_+	hypothetical protein	NA	NA	NA	NA
AVG13436.1\|3074675_3075254_+	transcriptional regulator, TetR family	NA	NA	NA	NA
AVG13437.1\|3075391_3075748_+	phage infection protein Pip	NA	NA	NA	NA
AVG13438.1\|3075768_3076992_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG13439.1\|3077019_3078543_+	putative phosphatase	A0A2I7SCM7	Paenibacillus_phage	1.1e-11	75.6
AVG13440.1\|3078542_3079094_+	hypothetical protein	NA	NA	NA	NA
AVG13441.1\|3079364_3080156_+	polysaccharide deacetylase, PdaB family	NA	NA	NA	NA
AVG13442.1\|3080177_3080870_+	putative L,D-transpeptidase YkuD	NA	NA	NA	NA
AVG13443.1\|3081222_3081768_-	putative sporulation protein YyaC	G3M9W0	Bacillus_virus	7.0e-22	37.4
AVG13444.1\|3081976_3082093_+	hypothetical protein	NA	NA	NA	NA
AVG13445.1\|3082201_3082906_-	copper homeostasis protein CutC	NA	NA	NA	NA
AVG13446.1\|3083134_3084358_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13447.1\|3085245_3088086_+	putative lantibiotic biosynthesis protein	NA	NA	NA	NA
AVG13448.1\|3088078_3089434_+	putative lantibiotic biosynthesis protein	NA	NA	NA	NA
AVG13449.1\|3089722_3091039_-	DAACS family dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
AVG13450.1\|3091157_3091301_-	hypothetical protein	NA	NA	NA	NA
AVG13451.1\|3091326_3092310_-	hypothetical protein	NA	NA	NA	NA
AVG13452.1\|3092334_3092631_-	hypothetical protein	NA	NA	NA	NA
AVG13453.1\|3092651_3094679_-	sodium/proton antiporter, CPA1 family	NA	NA	NA	NA
AVG13454.1\|3094718_3094991_-	hypothetical protein	NA	NA	NA	NA
AVG13455.1\|3095769_3096567_-	hypothetical protein	NA	NA	NA	NA
AVG13456.1\|3096784_3098242_+	cardiolipin synthase	NA	NA	NA	NA
AVG13457.1\|3098427_3099513_-	micrococcal nuclease	NA	NA	NA	NA
AVG13458.1\|3100123_3100897_-	phosphosugar-binding transcriptional regulator	NA	NA	NA	NA
AVG13459.1\|3100972_3102166_-	protein MalY	NA	NA	NA	NA
AVG13460.1\|3102191_3103751_-	PTS system maltose- and glucose-specific EIICB component MalX	NA	NA	NA	NA
AVG13461.1\|3104087_3104336_-	hypothetical protein	NA	NA	NA	NA
AVG13462.1\|3104516_3104765_+	hypothetical protein	NA	NA	NA	NA
AVG13463.1\|3104795_3105035_+	hypothetical protein	NA	NA	NA	NA
AVG13464.1\|3105218_3106160_-	hypothetical protein	NA	NA	NA	NA
3106211:3106270	attL	NA	NA	NA	NA
AVG13465.1\|3106242_3106992_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG13466.1\|3107081_3107594_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG13467.1\|3107656_3107800_-	hypothetical protein	A0A0K2CYN9	Paenibacillus_phage	3.7e-07	93.9
AVG13468.1\|3108135_3109359_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13469.1\|3109436_3109709_+\|integrase	phage integrase-like protein	A0A0K2CZ62	Paenibacillus_phage	1.2e-27	74.0
AVG13470.1\|3110373_3111108_-	hypothetical protein	NA	NA	NA	NA
AVG13471.1\|3111111_3112218_-	pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AVG13472.1\|3112259_3112925_-	putative inner membrane protein	NA	NA	NA	NA
AVG13473.1\|3112927_3113713_-	putative inner membrane protein	NA	NA	NA	NA
AVG13474.1\|3113733_3114072_-	hypothetical protein	NA	NA	NA	NA
AVG13475.1\|3114075_3114432_-	hypothetical protein	NA	NA	NA	NA
AVG13476.1\|3114471_3114834_-	dihydroorotase	NA	NA	NA	NA
AVG13477.1\|3115947_3116241_-	hypothetical protein	NA	NA	NA	NA
AVG13478.1\|3116307_3117531_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG13479.1\|3117788_3117929_-	hypothetical protein	NA	NA	NA	NA
AVG13480.1\|3117932_3119285_-	putative DNA-binding protein	S5MC02	Brevibacillus_phage	1.0e-21	26.3
AVG13481.1\|3119473_3120253_-	ABC transporter, efflux permease protein	NA	NA	NA	NA
AVG13482.1\|3120245_3121184_-	daunorubicin/doxorubicin resistance ATP-binding protein DrrA	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-20	29.0
AVG13483.1\|3121240_3122029_-	luciferase family protein	NA	NA	NA	NA
AVG13484.1\|3122093_3123317_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13485.1\|3123789_3124779_+	putative glycosyltransferase YkoT	B9UDL7	Salmonella_phage	8.4e-50	40.3
AVG13486.1\|3124808_3126242_+	hypothetical protein	NA	NA	NA	NA
AVG13487.1\|3126542_3126974_+	oxidoreductase-like protein	NA	NA	NA	NA
AVG13488.1\|3127070_3127616_-	integral membrane protein, YccS/YhfK family	NA	NA	NA	NA
AVG13489.1\|3127929_3128925_-	HTH-type transcriptional regulator EbgR	NA	NA	NA	NA
AVG13490.1\|3129110_3130034_-	hydrolase, alpha/beta fold family	NA	NA	NA	NA
AVG13491.1\|3130257_3131826_-	1-pyrroline-5-carboxylate dehydrogenase RocA	NA	NA	NA	NA
AVG13492.1\|3131852_3132767_-	proline dehydrogenase 1	A0A2H4PQT6	Staphylococcus_phage	1.8e-70	45.5
AVG13493.1\|3133252_3135463_+	SpoIID/LytB domain-containing protein	Q2XU88	Pseudomonas_phage	1.6e-11	25.8
AVG13494.1\|3135688_3136609_-	purine nucleosidase	NA	NA	NA	NA
AVG13495.1\|3136808_3137372_+	signal peptidase I	NA	NA	NA	NA
AVG13496.1\|3137412_3138252_-	putative membrane protein	NA	NA	NA	NA
AVG13497.1\|3138305_3138644_-	hypothetical protein	NA	NA	NA	NA
AVG13498.1\|3139519_3140473_+	site-specific tyrosine recombinase XerD-like protein	A0A097BYJ7	Leuconostoc_phage	1.2e-05	26.3
AVG13499.1\|3140746_3141451_+	metal dependent phosphohydrolase	NA	NA	NA	NA
AVG13500.1\|3141634_3141952_+	putative chloramphenical resistance permease RarD	NA	NA	NA	NA
AVG13501.1\|3142351_3143338_-	ATPase, AAA family	NA	NA	NA	NA
AVG13502.1\|3143434_3144658_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13503.1\|3145278_3146265_-	metal-dependent phosphohydrolase-like protein	A0A1B1ISR1	uncultured_Mediterranean_phage	3.7e-05	25.1
AVG13504.1\|3146307_3148551_-	alpha/beta hydrolase family protein	NA	NA	NA	NA
AVG13505.1\|3148913_3149684_-	ribokinase	NA	NA	NA	NA
AVG13506.1\|3149690_3150491_-	purine-cytosine permease-like protein	NA	NA	NA	NA
AVG13507.1\|3150794_3151190_+	hypothetical protein	NA	NA	NA	NA
AVG13508.1\|3151717_3152380_+	peptidoglycan-binding LysM	A0A0E3T7R5	Bacillus_phage	1.3e-51	51.9
AVG13509.1\|3152550_3152982_-	heat shock protein	NA	NA	NA	NA
AVG13510.1\|3153095_3153281_-	glycosyltransferase, group 2 family protein	NA	NA	NA	NA
AVG13511.1\|3153544_3154285_-	hypothetical protein	NA	NA	NA	NA
AVG13512.1\|3154346_3154985_-	putative transcriptional regulator	NA	NA	NA	NA
AVG13513.1\|3155028_3155643_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-59	54.5
AVG13514.1\|3155973_3157197_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG13515.1\|3157597_3157957_+	hypothetical protein	NA	NA	NA	NA
AVG13516.1\|3158595_3158850_+	hypothetical protein	NA	NA	NA	NA
AVG13517.1\|3158904_3159789_-	HTH-type transcriptional regulator YofA	NA	NA	NA	NA
AVG13518.1\|3159934_3160246_+	transcriptional regulator	NA	NA	NA	NA
AVG13519.1\|3160364_3163061_-	ribonucleoside-diphosphate reductase NrdZ	A0A0K2CP92	Brevibacillus_phage	3.2e-168	46.3
AVG13520.1\|3163419_3164268_+	D-alanine aminotransferase Dat	NA	NA	NA	NA
AVG13521.1\|3164384_3165227_-	octanoyltransferase LipM	NA	NA	NA	NA
AVG13522.1\|3165400_3167200_+	RNA polymerase-associated helicase-like protein	A0A2H4J643	uncultured_Caudovirales_phage	2.1e-59	29.3
AVG13523.1\|3167196_3168216_+	S-adenosylmethionine ligase	NA	NA	NA	NA
AVG13524.1\|3168337_3169351_+	hypothetical protein	NA	NA	NA	NA
AVG13525.1\|3169400_3169652_-	hypothetical protein	NA	NA	NA	NA
AVG13526.1\|3169813_3170326_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG13527.1\|3170415_3171165_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
3171138:3172576	attR	NA	NA	NA	NA

DBSCAN-SWA_30

3189417 : 3211652

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13552.1\|3189417_3190641_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG13553.1\|3190647_3192045_-	radical SAM domain protein	NA	NA	NA	NA
AVG13554.1\|3192164_3192362_-	hypothetical protein	NA	NA	NA	NA
AVG13555.1\|3192386_3192527_-	cyclic lactone autoinducer peptide	NA	NA	NA	NA
AVG13556.1\|3192597_3193155_-	Membrane protein putatively involved in post-translational modification of the autoinducing quorum-sensing peptide	NA	NA	NA	NA
AVG13557.1\|3193370_3194108_+	Two-component response regulator LytS-like protein	NA	NA	NA	NA
AVG13558.1\|3194114_3195410_+	two-component sensor kinase	NA	NA	NA	NA
AVG13559.1\|3196053_3196272_+	hypothetical protein	NA	NA	NA	NA
AVG13560.1\|3196268_3196388_+	hypothetical protein	NA	NA	NA	NA
AVG13561.1\|3196439_3196661_+	hypothetical protein	NA	NA	NA	NA
AVG13562.1\|3197911_3199390_+	ATP-binding cassette efflux transporter-like protein	A0A2K9L0W2	Tupanvirus	6.5e-30	25.2
AVG13563.1\|3199545_3200601_-\|transposase	transposase	A0A1P8DJG9	Virus_Rctr71	2.2e-16	30.9
AVG13564.1\|3200605_3201001_-\|transposase	transposase IS200-family protein	Q332K6	Clostridium_botulinum_C_phage	7.0e-40	62.8
AVG13565.1\|3201198_3201309_+	hypothetical protein	NA	NA	NA	NA
AVG13566.1\|3201418_3201577_+	Ribosomal RNA large subunit methyltransferase Cfr	NA	NA	NA	NA
AVG13567.1\|3202509_3203178_-	Adenosylcobinamide amidohydrolase	NA	NA	NA	NA
AVG13568.1\|3203249_3203483_-	hypothetical protein	NA	NA	NA	NA
AVG13569.1\|3203875_3204184_+	hypothetical protein	NA	NA	NA	NA
AVG13570.1\|3204310_3204637_-	hypothetical protein	NA	NA	NA	NA
AVG13571.1\|3204871_3206095_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13572.1\|3206465_3207887_-	PTS system EIIBC component	NA	NA	NA	NA
AVG13573.1\|3207960_3208848_-	N-acetylmuramic acid 6-phosphate etherase MurQ	NA	NA	NA	NA
AVG13574.1\|3209036_3209546_-\|transposase	transposase	NA	NA	NA	NA
AVG13575.1\|3209563_3210121_-\|transposase	transposase	NA	NA	NA	NA
AVG13576.1\|3210428_3211652_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8

DBSCAN-SWA_31

3251490 : 3294150

Paenibacillus_phage(36.36%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13623.1\|3251490_3253470_-\|tRNA	methionine--tRNA ligase MetG	A0A1V0SHR2	Klosneuvirus	4.8e-97	36.9
AVG13624.1\|3253829_3254081_-	putative membrane protein insertion efficiency factor 2	A0A2H4PQM5	Staphylococcus_phage	7.4e-19	56.1
AVG13625.1\|3254077_3254494_-	transcriptional regulator, Fur family	NA	NA	NA	NA
AVG13626.1\|3254732_3256262_+	spore germination protein KA	NA	NA	NA	NA
AVG13627.1\|3256258_3257359_+	spore germination protein YndE	NA	NA	NA	NA
AVG13628.1\|3257355_3258486_+	spore germination receptor subunit-like protein	NA	NA	NA	NA
AVG13629.1\|3258605_3259451_+	Divergent polysaccharide deacetylase	NA	NA	NA	NA
AVG13630.1\|3259641_3260631_-	oxidoreductase-like protein	NA	NA	NA	NA
AVG13631.1\|3260805_3262245_-	putative sodium/glutamine symporter GlnT	NA	NA	NA	NA
AVG13632.1\|3263403_3264558_+	polysaccharide deacetylase	NA	NA	NA	NA
AVG13633.1\|3264673_3265537_-	transcriptional regulator	NA	NA	NA	NA
AVG13634.1\|3265649_3266990_-	putative glycolate oxidase iron-sulfur subunit GlcF	NA	NA	NA	NA
AVG13635.1\|3266982_3268344_-	glycolate oxidase subunit GlcD	NA	NA	NA	NA
AVG13636.1\|3268634_3269858_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13637.1\|3270083_3270521_-	DNA protection protein	NA	NA	NA	NA
AVG13638.1\|3270660_3272283_-	DNA topoisomerase 3	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	3.4e-16	25.5
AVG13639.1\|3272383_3272770_-	DNA topoisomerase 3	NA	NA	NA	NA
AVG13640.1\|3272929_3273670_+	response regulator	NA	NA	NA	NA
AVG13641.1\|3273980_3275363_+\|tRNA	glycine--tRNA ligase	A0A2I2L3K8	Orpheovirus	1.9e-47	29.5
AVG13642.1\|3275470_3275701_-	hypothetical protein	NA	NA	NA	NA
AVG13643.1\|3275858_3276737_-	putative fructokinase GmuE	NA	NA	NA	NA
AVG13644.1\|3276776_3277766_-	HTH-type transcriptional repressor PurR	NA	NA	NA	NA
AVG13645.1\|3278050_3280174_+	putative cyclic beta-1,2-glucan modification protein	NA	NA	NA	NA
AVG13646.1\|3280282_3280624_-	hypothetical protein	NA	NA	NA	NA
AVG13647.1\|3280767_3281658_-	Vegetative catalase	A0A2K9L572	Tupanvirus	7.8e-55	38.3
AVG13648.1\|3281617_3281911_-	Vegetative catalase	NA	NA	NA	NA
AVG13649.1\|3282059_3283283_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13650.1\|3283683_3283803_+	hypothetical protein	NA	NA	NA	NA
AVG13651.1\|3284000_3284750_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG13652.1\|3284839_3285352_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG13653.1\|3285540_3286155_+	Anti-sigma-V factor RsiV	NA	NA	NA	NA
AVG13654.1\|3286377_3287598_-	anion ABC transporter-like protein	NA	NA	NA	NA
AVG13655.1\|3287603_3288293_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVG13656.1\|3288492_3288783_-	putative dienelactone hydrolase	NA	NA	NA	NA
AVG13657.1\|3289248_3289677_+	pyruvate formate-lyase-activating enzyme	NA	NA	NA	NA
AVG13658.1\|3289671_3290436_-	putative phosphoglycolate phosphatase	NA	NA	NA	NA
AVG13659.1\|3290687_3291911_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13660.1\|3292029_3292329_-	hypothetical protein	NA	NA	NA	NA
AVG13661.1\|3292343_3292862_-	putative phage DNA-binding protein	NA	NA	NA	NA
AVG13662.1\|3292926_3294150_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_32

3337760 : 3449054

100

Paenibacillus_phage(32.26%)

tRNA,transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13707.1\|3337760_3338984_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5
AVG13708.1\|3338976_3339180_-\|transposase	putative transposase InsK for insertion sequence element IS150	NA	NA	NA	NA
AVG13709.1\|3339176_3339413_-	hypothetical protein	NA	NA	NA	NA
AVG13710.1\|3339653_3340229_-	glutamine transport ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	3.9e-15	31.0
AVG13711.1\|3340232_3341090_-	phosphate ABC transporter membrane protein 2, PhoT family	NA	NA	NA	NA
AVG13712.1\|3341086_3342031_-	phosphate ABC transporter membrane protein, PhoT family	NA	NA	NA	NA
AVG13713.1\|3342259_3343150_-	phosphate ABC transporter, phosphate-binding protein	NA	NA	NA	NA
AVG13714.1\|3343865_3344948_-	oxidoreductase, NAD-binding domain protein	NA	NA	NA	NA
AVG13715.1\|3345087_3346014_+	transcriptional regulator-like protein	NA	NA	NA	NA
AVG13716.1\|3346079_3346793_-	alkaline phosphatase synthesis transcriptional regulatory protein PhoP	W8CYM9	Bacillus_phage	1.1e-38	37.8
AVG13717.1\|3346900_3348700_-	alkaline phosphatase synthesis sensor protein PhoR	W8CYF6	Bacillus_phage	1.1e-39	36.6
AVG13718.1\|3348911_3350333_+	hypothetical protein	NA	NA	NA	NA
AVG13719.1\|3350601_3352143_-	fumarate hydratase class I, aerobic	NA	NA	NA	NA
AVG13720.1\|3352323_3353475_+	polysaccharide deacetylase	NA	NA	NA	NA
AVG13721.1\|3353779_3354721_-	malate dehydrogenase Mdh	NA	NA	NA	NA
AVG13722.1\|3354746_3356045_-	isocitrate dehydrogenase	Q77Z09	Phage_21	4.0e-15	75.9
AVG13723.1\|3356151_3357264_-	citrate synthase 2	NA	NA	NA	NA
AVG13724.1\|3357684_3358131_-	acyl-CoA thioesterase-like protein	NA	NA	NA	NA
AVG13725.1\|3358307_3360062_-	pyruvate kinase Pyk	NA	NA	NA	NA
AVG13726.1\|3360054_3361029_-	acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
AVG13727.1\|3361018_3361885_-	acetyl-coenzyme A carboxylase carboxyl transferase subunit beta	NA	NA	NA	NA
AVG13728.1\|3361979_3362171_-	hypothetical protein	NA	NA	NA	NA
AVG13729.1\|3362523_3366180_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.6e-213	37.9
AVG13730.1\|3366904_3368128_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13731.1\|3368653_3368986_+	Sporulation membrane protein YtrH	NA	NA	NA	NA
AVG13732.1\|3368982_3369561_+	hypothetical protein	NA	NA	NA	NA
AVG13733.1\|3370009_3371152_-	gamma-D-glutamate-meso-diaminopimelate muropeptidase-like protein	A0A1W6DXV0	Rhodococcus_phage	6.2e-12	40.2
AVG13734.1\|3372034_3373258_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13735.1\|3373946_3374294_-	putative DNA-binding protein	NA	NA	NA	NA
AVG13736.1\|3374647_3375190_+	hypothetical protein	NA	NA	NA	NA
AVG13737.1\|3375155_3375362_+	hypothetical protein	NA	NA	NA	NA
AVG13738.1\|3375433_3376657_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	5.2e-227	99.5
AVG13739.1\|3376900_3377875_-	isoprenyl transferase-like protein	NA	NA	NA	NA
AVG13740.1\|3377896_3378526_-	response regulator receiver domain protein	NA	NA	NA	NA
AVG13741.1\|3378522_3380844_-	ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein	NA	NA	NA	NA
AVG13742.1\|3380942_3381125_+	hypothetical protein	NA	NA	NA	NA
AVG13743.1\|3381344_3381497_+	hypothetical protein	NA	NA	NA	NA
AVG13744.1\|3381673_3381979_+	hypothetical protein	NA	NA	NA	NA
AVG13745.1\|3381962_3383300_-	inosine-5'-monophosphate dehydrogenase GuaB	NA	NA	NA	NA
AVG13746.1\|3383454_3383742_-	hypothetical protein	NA	NA	NA	NA
AVG13747.1\|3383860_3384103_-	hypothetical protein	NA	NA	NA	NA
AVG13748.1\|3386259_3387483_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG13749.1\|3387547_3387712_+	LexA repressor-like protein	NA	NA	NA	NA
AVG13750.1\|3387689_3388049_-	hypothetical protein	NA	NA	NA	NA
AVG13751.1\|3388097_3389264_-	putative membrane protein	NA	NA	NA	NA
AVG13752.1\|3389393_3390767_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG13753.1\|3390775_3391975_+\|coat	endospore coat-associated protein YheC	NA	NA	NA	NA
AVG13754.1\|3391987_3393358_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG13755.1\|3393357_3394476_+\|coat	spore coat associated-like protein	NA	NA	NA	NA
AVG13756.1\|3394481_3395918_+\|coat	endospore coat-associated protein YheD	NA	NA	NA	NA
AVG13757.1\|3395940_3397167_-	putative membrane protein	NA	NA	NA	NA
AVG13758.1\|3397207_3397579_-	4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE	NA	NA	NA	NA
AVG13759.1\|3397582_3397972_-	hypothetical protein	NA	NA	NA	NA
AVG13760.1\|3397987_3398683_-	glycosyltransferase, group 2 family protein	A8CG95	Salmonella_phage	1.4e-06	28.0
AVG13761.1\|3399007_3400231_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13762.1\|3400607_3401120_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	9.7e-26	42.8
AVG13763.1\|3401209_3401959_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A1B1P773	Bacillus_phage	1.0e-87	62.2
AVG13764.1\|3402356_3402863_+	hypothetical protein	NA	NA	NA	NA
AVG13765.1\|3403862_3405962_+	thermophilic serine proteinase	A0A218KC60	Bacillus_phage	3.4e-32	35.9
AVG13766.1\|3406217_3406397_+	hypothetical protein	NA	NA	NA	NA
AVG13767.1\|3406545_3408099_-	sporulation kinase E	NA	NA	NA	NA
AVG13768.1\|3408320_3408575_+	hypothetical protein	NA	NA	NA	NA
AVG13769.1\|3408867_3409407_+	hypothetical protein	NA	NA	NA	NA
AVG13770.1\|3409707_3409923_-	hypothetical protein	NA	NA	NA	NA
AVG13771.1\|3410507_3411941_-	stage V sporulation protein R	NA	NA	NA	NA
AVG13772.1\|3411937_3413089_-	sporulation protein YhbH	X2JIL8	Bacillus_phage	5.6e-21	40.7
AVG13773.1\|3413690_3414350_-	ATP-binding transport protein NatA	A0A2K9L0W2	Tupanvirus	8.5e-06	24.0
AVG13774.1\|3414346_3414523_-	hypothetical protein	NA	NA	NA	NA
AVG13775.1\|3414725_3415949_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8
AVG13776.1\|3416275_3416794_+	hypothetical protein	NA	NA	NA	NA
AVG13777.1\|3416813_3417149_+	hypothetical protein	NA	NA	NA	NA
AVG13778.1\|3417237_3418461_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13779.1\|3418590_3418791_-\|transposase	transposase	Q6H9S5	Enterobacteria_phage	3.7e-05	44.7
AVG13780.1\|3419051_3419258_-	putative conjugation protein	NA	NA	NA	NA
AVG13781.1\|3419386_3421318_-	zinc-transporting ATPase ZosA	E4ZFI9	Streptococcus_phage	1.3e-126	40.6
AVG13782.1\|3421638_3421836_-	hypothetical protein	NA	NA	NA	NA
AVG13783.1\|3422258_3423275_+	Phosphatidylglycerol lysyltransferase	NA	NA	NA	NA
AVG13784.1\|3423307_3424828_+	Phosphatidylglycerol lysyltransferase	NA	NA	NA	NA
AVG13785.1\|3424945_3426841_-	putative serine protein kinase PrkA	A0MN77	Thermus_phage	1.3e-102	36.1
AVG13786.1\|3427092_3427833_+	hypothetical protein	NA	NA	NA	NA
AVG13787.1\|3427887_3428871_-	thioredoxin reductase	NA	NA	NA	NA
AVG13788.1\|3428910_3429570_-	molybdenum transport permease-like protein	NA	NA	NA	NA
AVG13789.1\|3429572_3430508_-	molybdate-binding lipoprotein-like protein	NA	NA	NA	NA
AVG13790.1\|3430572_3431796_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13791.1\|3432043_3432988_+	molybdate binding regulator-like protein	NA	NA	NA	NA
AVG13792.1\|3433361_3433619_-	transcriptional regulator-like protein	A0A2I7SC16	Paenibacillus_phage	6.2e-13	43.0
AVG13793.1\|3433824_3434289_-\|tRNA	putative tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
AVG13794.1\|3434460_3435549_-	phosphoserine aminotransferase SerC	M1Q1P2	Streptococcus_phage	4.5e-89	46.5
AVG13795.1\|3435722_3436331_+	2'-5' RNA-ligase-like protein	NA	NA	NA	NA
AVG13796.1\|3436525_3436885_+	putative transporter protein	G3MA03	Bacillus_virus	1.5e-20	52.6
AVG13797.1\|3437026_3437197_+	hypothetical protein	NA	NA	NA	NA
AVG13798.1\|3437296_3438721_-	glutamine ligase GlnA	NA	NA	NA	NA
AVG13799.1\|3439133_3439811_-	deoxyribose-phosphate aldolase DeoC	NA	NA	NA	NA
AVG13800.1\|3439893_3441198_-	pyrimidine-nucleoside phosphorylase Pdp	A0A0H3UZD4	Geobacillus_virus	3.1e-137	57.4
AVG13801.1\|3441241_3442426_-	pyrimidine nucleoside transport protein NupC	NA	NA	NA	NA
AVG13802.1\|3442887_3443856_-	deoxyribonucleoside regulator	NA	NA	NA	NA
AVG13803.1\|3444166_3445120_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase IspH	NA	NA	NA	NA
AVG13804.1\|3445189_3446695_-	sensory transduction histidine kinase	W8CYF6	Bacillus_phage	1.4e-24	28.5
AVG13805.1\|3446695_3447385_-	response regulator MprA	W8CYM9	Bacillus_phage	2.3e-38	40.5
AVG13806.1\|3447545_3449054_-\|protease	putative serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-21	25.1

DBSCAN-SWA_33

3477407 : 3524033

Paenibacillus_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13834.1\|3477407_3478631_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13835.1\|3478841_3482009_-	putative membrane protein	NA	NA	NA	NA
AVG13836.1\|3482001_3482913_-	aldo/keto reductase	NA	NA	NA	NA
AVG13837.1\|3483087_3484260_-	DGQHR domain protein	NA	NA	NA	NA
AVG13838.1\|3484259_3485399_-	DGQHR domain protein	NA	NA	NA	NA
AVG13839.1\|3485551_3486598_-	peptidase M50	NA	NA	NA	NA
AVG13840.1\|3486613_3486982_-	Modulator of the general stress response	M1PLC0	Streptococcus_phage	1.7e-19	43.5
AVG13841.1\|3487043_3487976_-	putative RNA pseudouridine synthase YlyB	NA	NA	NA	NA
AVG13842.1\|3487972_3488542_-	Cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
AVG13843.1\|3488557_3490174_-	cobyric acid synthase CobQ	NA	NA	NA	NA
AVG13844.1\|3491301_3492105_-	cobalamin synthase CobS	NA	NA	NA	NA
AVG13845.1\|3492086_3492821_-	cobalamin biosynthesis protein	NA	NA	NA	NA
AVG13846.1\|3492905_3493082_-	cobalamin biosynthesis protein	NA	NA	NA	NA
AVG13847.1\|3493084_3493660_-	bifunctional adenosylcobalamin biosynthesis protein CobP	NA	NA	NA	NA
AVG13848.1\|3493792_3494839_-	nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase CobT	NA	NA	NA	NA
AVG13849.1\|3494896_3495685_-	putative ABC transporter ATP-binding protein YvrA	G3M9Y6	Bacillus_virus	9.8e-17	26.3
AVG13850.1\|3495686_3496727_-	putative ABC transporter permease protein YvrB	NA	NA	NA	NA
AVG13851.1\|3496749_3497745_-	putative ABC transporter substrate-binding lipoprotein YvrC	NA	NA	NA	NA
AVG13852.1\|3498236_3498542_-	hypothetical protein	NA	NA	NA	NA
AVG13853.1\|3498936_3499200_-	Spo0E like sporulation regulatory protein	NA	NA	NA	NA
AVG13854.1\|3499284_3500490_-	putative aminotransferase YugH	A0A1X6WGT4	Pacmanvirus	1.8e-06	24.4
AVG13855.1\|3500505_3500997_-	transcriptional regulator, AsnC family	NA	NA	NA	NA
AVG13856.1\|3501260_3501542_-	hypothetical protein	NA	NA	NA	NA
AVG13857.1\|3501769_3503101_-	transporter, major facilitator family protein	NA	NA	NA	NA
AVG13858.1\|3503127_3504315_-	putative lipoprotein YufN	NA	NA	NA	NA
AVG13859.1\|3504346_3504841_-	hypothetical protein	NA	NA	NA	NA
AVG13860.1\|3504973_3505393_-	membrane protein YshE	NA	NA	NA	NA
AVG13861.1\|3505492_3506164_-	PspA/IM30 family protein	NA	NA	NA	NA
AVG13862.1\|3506276_3508640_-	MutS2 protein MutS2	Q94M10	Lactobacillus_phage	1.8e-13	37.9
AVG13863.1\|3508963_3509332_+	Membrane protein of unknown function	NA	NA	NA	NA
AVG13864.1\|3509573_3509936_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
AVG13865.1\|3510016_3510550_-	cvpA family protein	NA	NA	NA	NA
AVG13866.1\|3510561_3513462_-	chromosome segregation protein SMC	NA	NA	NA	NA
AVG13867.1\|3513568_3516019_-\|tRNA	phenylalanine--tRNA ligase beta chain PheT	NA	NA	NA	NA
AVG13868.1\|3516042_3517071_-\|tRNA	phenylalanine--tRNA ligase alpha chain PheS	A0A2K9L3A8	Tupanvirus	1.7e-29	37.9
AVG13869.1\|3518171_3518687_-	type I signal peptidase-like protein	NA	NA	NA	NA
AVG13870.1\|3518854_3519778_+	putative oxidoreductase YajO	NA	NA	NA	NA
AVG13871.1\|3519884_3520181_+\|transposase	transposase family protein	NA	NA	NA	NA
AVG13872.1\|3520416_3520995_+\|transposase	transposase-like protein	A0A1B1P773	Bacillus_phage	1.5e-35	40.6
AVG13873.1\|3521125_3521626_-\|transposase	putative transposase InsK for insertion sequence element IS150	A0A2I6AZV9	Macacine_betaherpesvirus	5.2e-24	43.2
AVG13874.1\|3521903_3522221_-\|transposase	transposase IS3/IS911	NA	NA	NA	NA
AVG13875.1\|3522379_3522520_-	hypothetical protein	NA	NA	NA	NA
AVG13876.1\|3522523_3522745_-	putative DNA-binding protein	NA	NA	NA	NA
AVG13877.1\|3522809_3524033_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0

DBSCAN-SWA_34

3532477 : 3585272

Paenibacillus_phage(35.71%)

transposase,bacteriocin,integrase

attL 3532434:3532493|attR 3549697:3551087

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3532434:3532493	attL	NA	NA	NA	NA
AVG13886.1\|3532477_3533701_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13887.1\|3534570_3534672_-	hypothetical protein	NA	NA	NA	NA
AVG13888.1\|3534831_3535593_-	hypothetical protein	NA	NA	NA	NA
AVG13889.1\|3535871_3537095_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13890.1\|3537605_3537986_+	hypothetical protein	NA	NA	NA	NA
AVG13891.1\|3538129_3539035_+\|integrase	phage integrase family protein	A0A0A7AR08	Bacillus_phage	6.2e-92	57.0
AVG13892.1\|3539048_3540788_+\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	8.0e-96	36.9
AVG13893.1\|3540829_3541339_-\|transposase	transposase	NA	NA	NA	NA
AVG13894.1\|3541356_3541914_-\|transposase	transposase	NA	NA	NA	NA
AVG13895.1\|3542313_3542814_+\|transposase	putative transposase InsK for insertion sequence element IS150	A0A2I6AZV9	Macacine_betaherpesvirus	5.2e-24	43.2
AVG13896.1\|3543360_3543522_-	hypothetical protein	NA	NA	NA	NA
AVG13897.1\|3543707_3544889_+	putative membrane protein	NA	NA	NA	NA
AVG13898.1\|3545004_3545658_+	hypothetical protein	NA	NA	NA	NA
AVG13899.1\|3545932_3546640_-	cAMP-binding protein	NA	NA	NA	NA
AVG13900.1\|3546711_3546876_-	Rubredoxin-2	NA	NA	NA	NA
AVG13901.1\|3547199_3548096_-	metallo-beta-lactamase family protein	NA	NA	NA	NA
AVG13902.1\|3548488_3549712_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13903.1\|3550180_3550882_+	nitric oxide-dependent regulator	NA	NA	NA	NA
AVG13904.1\|3551485_3552709_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
3549697:3551087	attR	NA	NA	NA	NA
AVG13905.1\|3553184_3553664_+	hypothetical protein	NA	NA	NA	NA
AVG13906.1\|3554053_3554410_-	hypothetical protein	NA	NA	NA	NA
AVG13907.1\|3554803_3556492_-	copper resistance protein CopC	NA	NA	NA	NA
AVG13908.1\|3556664_3556949_-	hypothetical protein	NA	NA	NA	NA
AVG13909.1\|3557672_3557915_+	hypothetical protein	NA	NA	NA	NA
AVG13910.1\|3558204_3559011_+	histidine kinase	NA	NA	NA	NA
AVG13911.1\|3559007_3559685_+	response regulator receiver domain protein	NA	NA	NA	NA
AVG13912.1\|3559774_3560398_+	hypothetical protein	NA	NA	NA	NA
AVG13913.1\|3560454_3562881_-	copper-exporting P-type ATPase A	A0A218MNH6	uncultured_virus	8.2e-115	38.0
AVG13914.1\|3562975_3563176_-	copper insertion chaperone and transporter component-like protein	A0A218MNH0	uncultured_virus	6.3e-05	40.0
AVG13915.1\|3563196_3563505_-	Copper-sensitive operon repressor	NA	NA	NA	NA
AVG13916.1\|3563573_3564059_-	dihydrofolate reductase DfrA	A0A0N9S8H6	Staphylococcus_phage	1.1e-31	42.5
AVG13917.1\|3564113_3565070_-	thymidylate synthase ThyA	A0A0N9SH48	Staphylococcus_phage	6.7e-121	63.7
AVG13918.1\|3565099_3565369_-	ribokinase-like protein	NA	NA	NA	NA
AVG13919.1\|3565683_3566118_-	UspA domain-containing protein	NA	NA	NA	NA
AVG13920.1\|3566339_3566729_-	glycine cleavage system H protein GcvH	NA	NA	NA	NA
AVG13921.1\|3567343_3568450_+	aminomethyltransferase GcvT	NA	NA	NA	NA
AVG13922.1\|3568490_3569846_+	putative glycine dehydrogenase [decarboxylating] subunit 1	E3SN07	Prochlorococcus_phage	1.4e-55	38.4
AVG13923.1\|3569842_3571309_+	putative glycine dehydrogenase [decarboxylating] subunit 2	E3ST28	Prochlorococcus_phage	6.8e-80	39.4
AVG13924.1\|3571669_3572209_+	hypothetical protein	NA	NA	NA	NA
AVG13925.1\|3572350_3573745_-	sporulation kinase A	NA	NA	NA	NA
AVG13926.1\|3573957_3575070_-	sigmaI modulating factor-like protein	NA	NA	NA	NA
AVG13927.1\|3575062_3575881_-	RNA polymerase sigma factor SigI	NA	NA	NA	NA
AVG13928.1\|3576100_3577060_+	hypothetical protein	NA	NA	NA	NA
AVG13929.1\|3577314_3577740_-	hypothetical protein	NA	NA	NA	NA
AVG13930.1\|3577849_3579073_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.4e-227	99.8
AVG13931.1\|3579323_3579524_+	hypothetical protein	NA	NA	NA	NA
AVG13932.1\|3579570_3581541_+	glycosyl hydrolase, family 15	NA	NA	NA	NA
AVG13933.1\|3581578_3581974_-	glycine cleavage system H protein GcvH	NA	NA	NA	NA
AVG13934.1\|3582118_3582664_-	thioredoxin-like protein YkuU	NA	NA	NA	NA
AVG13935.1\|3582888_3583977_-	3-isopropylmalate dehydrogenase LeuB	NA	NA	NA	NA
AVG13936.1\|3584328_3584658_+	hypothetical protein	NA	NA	NA	NA
AVG13937.1\|3584936_3585272_+\|bacteriocin	putative bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_35

3622988 : 3672107

Paenibacillus_phage(35.71%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG13979.1\|3622988_3624212_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG13980.1\|3624585_3626529_-	ABC-type antimicrobial peptide transport system, permease component	NA	NA	NA	NA
AVG13981.1\|3626515_3627286_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	9.5e-33	36.4
AVG13982.1\|3627537_3628128_-	putative lipoprotein	NA	NA	NA	NA
AVG13983.1\|3628676_3628997_+	small acid soluble protein	NA	NA	NA	NA
AVG13984.1\|3629060_3629507_+	heat shock protein	NA	NA	NA	NA
AVG13985.1\|3629508_3630048_-	hypothetical protein	NA	NA	NA	NA
AVG13986.1\|3630127_3630352_+	hypothetical protein	NA	NA	NA	NA
AVG13987.1\|3630348_3630870_+	hypothetical protein	NA	NA	NA	NA
AVG13988.1\|3630894_3631194_+	hypothetical protein	NA	NA	NA	NA
AVG13989.1\|3631817_3632573_+	hypothetical protein	NA	NA	NA	NA
AVG13990.1\|3632588_3633296_+	ABC transporter-like protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.0e-08	27.4
AVG13991.1\|3633406_3633697_-	hypothetical protein	NA	NA	NA	NA
AVG13992.1\|3633797_3634028_-	oxidoreductase-like protein	NA	NA	NA	NA
AVG13993.1\|3634099_3634738_-	IMPACT family member YigZ	A0A1X9I5T8	Streptococcus_phage	1.7e-35	44.0
AVG13994.1\|3634930_3636283_-	glucose-6-phosphate isomerase Pgi	NA	NA	NA	NA
AVG13995.1\|3636432_3637521_+	putative 2-hydroxy-3-oxopropionate reductase GarR	NA	NA	NA	NA
AVG13996.1\|3637584_3639609_-	transketolase Tkt	A0A2K9L6P9	Tupanvirus	1.2e-15	23.6
AVG13997.1\|3639732_3640629_-	formyltetrahydrofolate deformylase PurU	NA	NA	NA	NA
AVG13998.1\|3640667_3641813_-	putative endonuclease 4	A0A2H4UU70	Bodo_saltans_virus	2.0e-26	31.1
AVG13999.1\|3642020_3642446_+	hypothetical protein	NA	NA	NA	NA
AVG14000.1\|3642718_3642931_-	hypothetical protein	NA	NA	NA	NA
AVG14001.1\|3642942_3643833_-	beta-lactamase domain-containing protein	Q332B9	Clostridium_botulinum_C_phage	5.8e-58	46.4
AVG14002.1\|3644101_3644452_+	hypothetical protein	NA	NA	NA	NA
AVG14003.1\|3644553_3646071_+	PTS system glucose-specific EIICBA component PtsG	NA	NA	NA	NA
AVG14004.1\|3646149_3646323_+	hypothetical protein	NA	NA	NA	NA
AVG14005.1\|3646797_3648021_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.8e-227	99.8
AVG14006.1\|3648048_3648855_+	putative transcriptional regulatory protein YclJ	W8CYM9	Bacillus_phage	4.2e-39	41.4
AVG14007.1\|3648851_3650627_+	sensor histidine kinase ResE	W8CYF6	Bacillus_phage	3.3e-28	33.3
AVG14008.1\|3650747_3651578_+	putative polysaccharide deacetylase YheN	NA	NA	NA	NA
AVG14009.1\|3653107_3653374_+	hypothetical protein	NA	NA	NA	NA
AVG14010.1\|3653557_3653803_-	hypothetical protein	NA	NA	NA	NA
AVG14011.1\|3653812_3654343_-	hypothetical protein	NA	NA	NA	NA
AVG14012.1\|3654847_3656071_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14013.1\|3656063_3656333_-	hypothetical protein	NA	NA	NA	NA
AVG14014.1\|3656652_3656895_-	hypothetical protein	NA	NA	NA	NA
AVG14015.1\|3657000_3658149_-	mannitol-1-phosphate 5-dehydrogenase MtlD	NA	NA	NA	NA
AVG14016.1\|3658150_3658591_-	mannitol-specific phosphotransferase enzyme IIA component MtlF	NA	NA	NA	NA
AVG14017.1\|3658634_3660755_-	transcriptional regulator MtlR	NA	NA	NA	NA
AVG14018.1\|3660840_3662289_-	PTS system mannitol-specific EIICB component MtlA	NA	NA	NA	NA
AVG14019.1\|3662832_3663108_-	hypothetical protein	NA	NA	NA	NA
AVG14020.1\|3663635_3664118_-	hypothetical protein	NA	NA	NA	NA
AVG14021.1\|3664216_3664645_-	DNA polymerase III PolC-like protein	A2I2Z6	Vibrio_virus	8.4e-23	54.8
AVG14022.1\|3664817_3665189_-	hypothetical protein	NA	NA	NA	NA
AVG14023.1\|3665221_3666445_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14024.1\|3666559_3666742_-	hypothetical protein	NA	NA	NA	NA
AVG14025.1\|3666716_3667100_-	hypothetical protein	NA	NA	NA	NA
AVG14026.1\|3667116_3668073_-	multidrug resistance protein	NA	NA	NA	NA
AVG14027.1\|3668284_3668410_-	hypothetical protein	NA	NA	NA	NA
AVG14028.1\|3668498_3668951_-	transcriptional regulator-like protein	NA	NA	NA	NA
AVG14029.1\|3669096_3669321_-	hypothetical protein	NA	NA	NA	NA
AVG14030.1\|3669812_3670148_-\|transposase	transposase	NA	NA	NA	NA
AVG14031.1\|3670254_3670779_+	glycosyl transferase	NA	NA	NA	NA
AVG14032.1\|3670883_3672107_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.5e-226	99.5

DBSCAN-SWA_36

3866313 : 3926281

Paenibacillus_phage(28.57%)

tRNA,transposase,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG14200.1\|3866313_3866874_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
AVG14201.1\|3867014_3867215_+	hypothetical protein	NA	NA	NA	NA
AVG14202.1\|3867317_3868001_-	ankyrin-repeat containing protein	A0A0K2CZQ0	Paenibacillus_phage	6.9e-11	70.2
AVG14203.1\|3868028_3869252_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14204.1\|3869306_3869480_-	hypothetical protein	NA	NA	NA	NA
AVG14205.1\|3869728_3870328_-	50S ribosomal protein L25	NA	NA	NA	NA
AVG14206.1\|3870406_3871804_-	bifunctional protein GlmU	M1PC96	Moumouvirus	2.3e-29	33.0
AVG14207.1\|3871932_3872217_-	putative septation protein SpoVG	NA	NA	NA	NA
AVG14208.1\|3872332_3872722_-	RutC family protein YabJ	NA	NA	NA	NA
AVG14209.1\|3872741_3873563_-	HTH-type transcriptional repressor PurR	NA	NA	NA	NA
AVG14210.1\|3873724_3874582_-	4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE	NA	NA	NA	NA
AVG14211.1\|3874692_3874875_-	Small, acid-soluble spore protein, alpha/beta type	NA	NA	NA	NA
AVG14212.1\|3875094_3875370_-	hypothetical protein	NA	NA	NA	NA
AVG14213.1\|3875614_3876493_-\|protease	sporulation-specific protease YabG	NA	NA	NA	NA
AVG14214.1\|3876543_3877449_-	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AVG14215.1\|3877445_3878000_-	ribonuclease M5-like protein	NA	NA	NA	NA
AVG14216.1\|3878117_3879269_-	3D domain protein	S6BUU4	Bacillus_phage	8.1e-12	45.2
AVG14217.1\|3880021_3880765_+	ABC-type transporter ATP-binding protein EcsA	A0A2H4PQG7	Staphylococcus_phage	4.6e-24	30.7
AVG14218.1\|3880764_3881979_+	protein EcsB	NA	NA	NA	NA
AVG14219.1\|3881971_3882739_-	hydrolase, TatD family protein	NA	NA	NA	NA
AVG14220.1\|3882776_3884042_-	metal-dependent phosphohydrolase	E3T4P8	Cafeteria_roenbergensis_virus	6.6e-23	30.9
AVG14221.1\|3884388_3884643_+	transition state regulatory protein AbrB	A0A0K2CZ86	Paenibacillus_phage	1.5e-22	66.7
AVG14222.1\|3884767_3885637_-	ribosomal RNA small subunit methyltransferase I	M1PLC5	Streptococcus_phage	6.4e-62	46.7
AVG14223.1\|3885647_3886403_-	putative methyltransferase	NA	NA	NA	NA
AVG14224.1\|3886493_3886829_-	initiation-control protein YabA	NA	NA	NA	NA
AVG14225.1\|3886847_3887657_-	stage 0 sporulation protein YaaT	NA	NA	NA	NA
AVG14226.1\|3887659_3888637_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-25	38.0
AVG14227.1\|3888688_3889135_-	hypothetical protein	NA	NA	NA	NA
AVG14228.1\|3889181_3889511_-	hypothetical protein	NA	NA	NA	NA
AVG14229.1\|3889543_3890209_-	thymidylate kinase Tmk	M1PSC7	Streptococcus_phage	5.1e-43	44.6
AVG14230.1\|3890279_3891749_-	lysine decarboxylase-like protein	NA	NA	NA	NA
AVG14231.1\|3891943_3892129_-	Inhibitor of sigma-G Gin	NA	NA	NA	NA
AVG14232.1\|3892295_3892811_+	hypothetical protein	NA	NA	NA	NA
AVG14233.1\|3899014_3899872_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AVG14234.1\|3900864_3902454_-	galactose-1-phosphate uridylyltransferase GalT	NA	NA	NA	NA
AVG14235.1\|3902473_3903463_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	9.6e-54	38.9
AVG14236.1\|3903464_3904607_-	galactokinase GalK	NA	NA	NA	NA
AVG14237.1\|3904853_3905720_+	Msm operon regulatory protein MsmR	NA	NA	NA	NA
AVG14238.1\|3905952_3906915_-	putative ABC transporter permease protein YufQ	NA	NA	NA	NA
AVG14239.1\|3906915_3907995_-	putative ABC transporter permease protein YufP	NA	NA	NA	NA
AVG14240.1\|3907984_3909532_-	putative ABC transporter ATP-binding protein YufO	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.2e-12	31.0
AVG14241.1\|3909674_3910700_-	putative lipoprotein YufN	A0A0A7DN02	Lactobacillus_phage	9.4e-36	31.2
AVG14242.1\|3910977_3912234_-	threonine dehydratase biosynthetic	NA	NA	NA	NA
AVG14243.1\|3912535_3912880_+	hypothetical protein	NA	NA	NA	NA
AVG14244.1\|3912788_3913097_-	hypothetical protein	NA	NA	NA	NA
AVG14245.1\|3913142_3914366_-\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	1.1e-227	99.8
AVG14246.1\|3914646_3916716_-	putative multidrug resistance ABC transporter ATP-binding/permease protein YheH	W8CYL7	Bacillus_phage	5.3e-46	29.5
AVG14247.1\|3916712_3918473_-	putative multidrug resistance ABC transporter ATP-binding/permease protein YheI	W8CYL7	Bacillus_phage	9.1e-47	28.2
AVG14248.1\|3918642_3918786_-	hypothetical protein	NA	NA	NA	NA
AVG14249.1\|3919065_3919608_-	Glyoxal reductase	A0A2H4PQR8	Staphylococcus_phage	2.1e-50	52.0
AVG14250.1\|3919680_3919896_-	Glyoxal reductase	A0A1V0SKP9	Klosneuvirus	6.5e-08	49.1
AVG14251.1\|3920046_3920325_-	hypothetical protein	NA	NA	NA	NA
AVG14252.1\|3920336_3920990_-	ABC-type transporter ATP-binding protein EcsA	A0A076FI99	Aureococcus_anophage	1.1e-10	27.6
AVG14253.1\|3921205_3922429_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14254.1\|3922754_3923039_-	hypothetical protein	NA	NA	NA	NA
AVG14255.1\|3923541_3924765_+\|transposase	transposase	A0A0K2CZ57	Paenibacillus_phage	4.7e-228	100.0
AVG14256.1\|3926041_3926281_-\|bacteriocin	putative bacteriocin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: CP019652.1|AVG12935.1|2589913_2590324_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP019652.1|AVG12935.1|2589913_2590324_+|hypothetical-protein

2589913_2590324_+

136 aa aa

2468126-2713146

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP019652_1	Orphan	1.1\|1615762\|32\|CP019652\|PILER-CR,CRT	1615762-1615793	32	2659342-2659373	1
CP019652_1	Orphan	1.8\|1615763\|31\|CP019652\|CRISPRCasFinder	1615763-1615793	31	2659343-2659373	1

1. spacer 1.1|1615762|32|CP019652|PILER-CR,CRT matches to CP019652 position: 2659342-2659373, mismatch: 1

ttgtttcgatgctatatttatacgcatcaata	CRISPR spacer
ttgtttcgatgctatatttgtacgcatcaata	Protospacer
*******************.************

2. spacer 1.8|1615763|31|CP019652|CRISPRCasFinder matches to CP019652 position: 2659343-2659373, mismatch: 1

tgtttcgatgctatatttatacgcatcaata	CRISPR spacer
tgtttcgatgctatatttgtacgcatcaata	Protospacer
******************.************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP019653

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP019652

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information