CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP022600	Porphyrobacter HT-58-2 strain HT-58-2 chromosome, complete genome	3 crisprs	DEDDh,csa3,cas3,DinG,cas9	2	2	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022600_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022600_2

1954360-1954497

Orphan

Consensus_repeat	Method
CGCGCGCCTCAGCCTCGACGAACTCGCGCATGATGCGGCTCAGCTGGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022600_2

>merge|CP022600|2|1954360-1954497|CRISPRCasFinder
CGCGCGCCTCAGCCTCGACGAACTCGCGCATGATGCGGCTCAGCTGGACATCGACCCGCATGCGGATTTCTTCAGGGGGGGGCGGCCCGCGCGCGCCTCAGCCTCGACGAACTCGCGCATGATGCGGCTCAGCTGGAC

>CP022600|2|1|1954360-1954497|CRISPRCasFinder
CGCGCGCCTCAGCCTCGACGAACTCGCGCATGATGCGGCTCAGCTGGAC	ATCGACCCGCATGCGGATTTCTTCAGGGGGGGGCGGCCCG
CGCGCGCCTCAGCCTCGACGAACTCGCGCATGATGCGGCTCAGCTGGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP022600.1\|AUX69652.1\|1955079_1957626_-\|type-IV-secretion-system-protein-TraC	unknown	unknown	gnl\|CDD\|274279
CP022600.1\|AUX69651.1\|1954643_1955051_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX69647.1\|1948697_1949522_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|372692
CP022600.1\|AUX69650.1\|1953647_1954172_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|131818
CP022600.1\|AUX69646.1\|1944479_1947185_-\|conjugal-transfer-protein-TraG	unknown	unknown	gnl\|CDD\|369594
CP022600.1\|AUX69644.1\|1941435_1942802_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP022600.1\|AUX70919.1\|1947214_1948687_-\|conjugal-transfer-protein-TraH	unknown	unknown	gnl\|CDD\|368759
CP022600.1\|AUX69656.1\|1961335_1961908_-\|conjugal-transfer-protein-TraE	unknown	unknown	gnl\|CDD\|377500
CP022600.1\|AUX69658.1\|1962237_1962582_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX69645.1\|1943698_1944187_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224759
CP022600.1\|AUX69659.1\|1962930_1963383_+\|transcriptional-regulator	unknown	unknown	unknown
CP022600.1\|AUX70921.1\|1953012_1953621_-\|type-F-conjugative-transfer-system-protein-TraW	unknown	unknown	gnl\|CDD\|274276
CP022600.1\|AUX69655.1\|1960574_1961336_-\|conjugal-transfer-protein-TraK	unknown	unknown	gnl\|CDD\|368991
CP022600.1\|AUX69653.1\|1958356_1959247_-\|disulfide-bond-formation-protein-DsbC	unknown	unknown	gnl\|CDD\|239318
CP022600.1\|AUX70920.1\|1949508_1951197_-\|conjugal-transfer-protein-TraN	unknown	unknown	gnl\|CDD\|237072
CP022600.1\|AUX70922.1\|1957625_1958351_-\|conjugal-transfer-protein-TraV	unknown	unknown	unknown
CP022600.1\|AUX69654.1\|1959243_1960578_-\|conjugal-transfer-protein-TraB	unknown	unknown	gnl\|CDD\|319756
CP022600.1\|AUX69649.1\|1951999_1952968_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|377717
CP022600.1\|AUX69657.1\|1961920_1962208_-\|type-IV-conjugative-transfer-system-protein-TraL	unknown	unknown	gnl\|CDD\|377786
CP022600.1\|AUX69648.1\|1951238_1952003_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	unknown	unknown	gnl\|CDD\|370610

Protein	Function_ID	Function_description	E-value
CP022600.1\|AUX69652.1\|1955079_1957626_-\|type-IV-secretion-system-protein-TraC	gnl\|CDD\|274279	TIGR02746, hypothetical_protein, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.	0
CP022600.1\|AUX69647.1\|1948697_1949522_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	1.90545e-83
CP022600.1\|AUX69650.1\|1953647_1954172_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|131818	TIGR02771, Conjugal_transfer_protein_TraF, conjugative transfer signal peptidase TraF. This protein is found in apparent operons encoding elements of conjugative transfer systems. This family is homologous to a broader family of signal (leader) peptidases such as lepB. This family is present in both Ti-type and I-type conjugative systems.	6.58898e-21
CP022600.1\|AUX69646.1\|1944479_1947185_-\|conjugal-transfer-protein-TraG	gnl\|CDD\|369594	pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions.	3.87363e-97
CP022600.1\|AUX69644.1\|1941435_1942802_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.07358e-32
CP022600.1\|AUX70919.1\|1947214_1948687_-\|conjugal-transfer-protein-TraH	gnl\|CDD\|368759	pfam06122, TraH, Conjugative relaxosome accessory transposon protein. The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon.	7.93619e-131
CP022600.1\|AUX69656.1\|1961335_1961908_-\|conjugal-transfer-protein-TraE	gnl\|CDD\|377500	pfam05309, TraE, TraE protein. This family consists of several bacterial sex pilus assembly and synthesis proteins (TraE). Conjugal transfer of plasmids from donor to recipient cells is a complex process in which a cell-to-cell contact plays a key role. Many genes encoded by self-transmissible plasmids are required for various processes of conjugation, including pilus formation, stabilisation of mating pairs, conjugative DNA metabolism, surface exclusion and regulation of transfer gene expression. The exact function of the TraE protein is unknown.	8.86098e-61
CP022600.1\|AUX69645.1\|1943698_1944187_+\|hypothetical-protein	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	0.000233051
CP022600.1\|AUX70921.1\|1953012_1953621_-\|type-F-conjugative-transfer-system-protein-TraW	gnl\|CDD\|274276	TIGR02743, hypothetical_protein, type-F conjugative transfer system protein TraW. This protein is an essential component of the F-type conjugative transfer sytem for plasmid DNA transfer and has been shown to be localized to the periplasm.	1.48681e-72
CP022600.1\|AUX69655.1\|1960574_1961336_-\|conjugal-transfer-protein-TraK	gnl\|CDD\|368991	pfam06586, TraK, TraK protein. This family consists of several TraK proteins from Escherichia coli, Salmonella typhi and Salmonella typhimurium. TraK is known to be essential for pilus assembly but its exact role in this process is unknown.	8.6417e-63
CP022600.1\|AUX69653.1\|1958356_1959247_-\|disulfide-bond-formation-protein-DsbC	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	6.9128e-43
CP022600.1\|AUX70920.1\|1949508_1951197_-\|conjugal-transfer-protein-TraN	gnl\|CDD\|237072	PRK12355, PRK12355, type-F conjugative transfer system mating-pair stabilization protein TraN.	2.31098e-128
CP022600.1\|AUX69654.1\|1959243_1960578_-\|conjugal-transfer-protein-TraB	gnl\|CDD\|319756	cd16430, TraB, TraB is a homolog of VirB10 which forms part of core complex in Type IV secretion system (T4SS). This family contains TraB (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TraB is localized similarly to related proteins in other systems, but unlike in other systems, Neisseria gonorrhoeae TraB does not require the presence of other T4SS components for proper localization. It has been shown to be expressed with TraK (VirB9 homolog) at low levels in wild-type cells, suggesting that gonococcal T4SS may be present in single copy per cell and the small amounts of these proteins are sufficient for DNA secretion.	1.21462e-65
CP022600.1\|AUX69649.1\|1951999_1952968_-\|conjugal-transfer-protein	gnl\|CDD\|377717	pfam06834, TraU, TraU protein. This family consists of several bacterial TraU proteins. TraU appears to be more essential to conjugal DNA transfer than to assembly of pilus filaments.	4.94631e-134
CP022600.1\|AUX69657.1\|1961920_1962208_-\|type-IV-conjugative-transfer-system-protein-TraL	gnl\|CDD\|377786	pfam07178, TraL, TraL protein. This family consists of several bacterial TraL proteins. TraL is a predicted peripheral membrane protein which is thought to be involved in bacterial sex pilus assembly. The exact function of this family is unclear.	3.64536e-31
CP022600.1\|AUX69648.1\|1951238_1952003_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	6.25433e-33

>CP022600.1|AUX69650.1|1953647_1954172_-|conjugal-transfer-protein-TraF
MRAADILAHSATARRLALLAGLGAGVLGLTALSSFATSHALMINASPSLPYWAIWTSRTGVPQRGDIIVFTPPASPLLKRHFGTRPRPFGKIVSGMPGDLVSREGRTFHVNGRPVATAKLTSRLGEPLALGPTGRVPENCYFVTTPHKDGFDSRYAAIGWICRDRMLGIGRPIL
>CP022600.1|AUX70921.1|1953012_1953621_-|type-F-conjugative-transfer-system-protein-TraW
MLACSAPAAAKDYGQHGTLWPVIEPDLLEQIKARLTHLEATGETARINERMRQRTIARVNRPEPVAGVAHAASYRSWPFDPTISAERDIADDTGRIIIARGTRVNPLDTVPLRAPLVFLDGDDNAQLAWANAHYGKTNAKLILVRGAPLALMKARQRRFYFDQGGALVKHFGIRAVPAVVEQQGRVLRVTETPVRTGGRASS
>CP022600.1|AUX69649.1|1951999_1952968_-|conjugal-transfer-protein
MLAISSPASADAGPGKCTGKFVNPITDVCWSCLFPISVGALKVWPSNRPDPANPDLPVCLCGIRPGMAMGFWEPVRLADVSMKPWCFVNLGGMKIDPGFDIGFKTMAGPSAVGGATQYHSQWHVHWYAYPLIYWMELVADFLCLEAGSVDILYVSEIDPLWQDSELTAIINPESVLFANPLALAACAADCAAATTRLPIDDLFWCAGCQGTMYPLNGNVSATIGHVQASRLALSRFSYKLHRQLVAWGTMGSKGLCGKYLMPVMRKQQYRFQATNPNPQTRGRYACAPIGASTTFMSAGQVYPAIGEDMGYLVWRKRNCCAL
>CP022600.1|AUX69648.1|1951238_1952003_-|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC
MRKPYTFPVLTFFVSLAALGGAAAQTSEPALDLAAIRARAQSDRDAAEALAAMARTRAQAVMVEADASALDAQGHVQGYVQATVTEARPRPDETFDFDQMVATAGSAAKGNLGEAPRFIAFASLSMPAPALRDMITRVNAAGGVVALRGFPAGSAKVLSEALGKVALDQDEMGSVGIDPRLFRAFNVTAVPTYVVASTDFDLCDGFDCQTQVPPHDRISGNVTADFALETIASRGGPAARMASHHLARLRGADQ
>CP022600.1|AUX70920.1|1949508_1951197_-|conjugal-transfer-protein-TraN
MAPAAKAQNAPQPSSATAAAKADGKAFGREQAAAAQGAATARPDANRIPGFGSNPAEARHFDDPAGMEREAAAQAASHSGYRTMRDSMDRRARFAPQDLDAVIARSKHINTDPLAFTSGMSVSGSHGRCVPLPPGSASSARYMATCNVGYAVSEERRSCAIPLRVAVETQPRYIYWCSEYGMGGQESCARFEAAGCERTIQTEIPCQTWPDAGGPRFCEEPGEPVSVMSCSAPVTGSDLKEIIATLATTSSRDESECEAFASDPGCSQTSEACTDSDPLTRIIDGVAVTRPCWAWERQYACAQYAEAQDCQTLGATPGCNLVGEECLSGEPCRTWERVYDCPLPDQPGSPNQFICDADVYCIDGSCETITREANDEFKDAVVALNAMDQARREFDPDSLTLFKGTRATCSSKVFGVLNCCKGKGFALVPGIQLLVSLGCSREEMLLHERDAQGLCAYVGTYCSDSFLGVCLTKKKAYCCFESKLSRILQEQGRKQLNKPWAKPRDEQCRGFTLDEFARLDLSQMDFSEVYAEFTEAARLPDELAVADDLQQKIEDFYTNATR
>CP022600.1|AUX69647.1|1948697_1949522_-|conjugal-transfer-protein-TraF
MPPDSAAARALALCLGTLACLGAHAAPVRAQEQLPTESIERQDSFYCQERKLGYWFYCTRPKPAQQTAPAAAQNATRQLDAITATLRELKAKAILEPTPANVTAYIRFQREQLDRASLFSDVWQRAIWQDPDLDYTLQRPVSTLGKRQWLDSRSAERDAVMAQLSQRYGLFYFFAQSCAACEVMSPIVQGVASRWTITVRAISTDGGPSRHFPGYTVETNQRRRMGLEPKITPAVVLWDALKNQPIPIGYGVMSADELQDRIFLLTSKEAGRDY
>CP022600.1|AUX70919.1|1947214_1948687_-|conjugal-transfer-protein-TraH
MKRRPHPASNQRTALTAKRIIAALLAVTLPLSSVSADVGSSMDSFLNDVGGAANVTGPTAFEGQSAGYYSLGNVWTRFPQKTTNIANLQLPRARAGCGGIDIFAGSFSFINASEIVAMMKAVANNAVGFAFSLAIDTVCPECSKIMQEFAQKAQLMNNLNINSCEMAQGLVGGIWPKGDLADKAVCEAIGNAEGIFTDYAAAKHGCGTRGQRASTTAQGSGTYDDVNPGVARNYTWTILRKSAFFSPNGNFDRELAEYAMTLLGTIICVPPTDNEPGKFVPVAGDASSTLVTSLLDGTNGSNVMIYDCDEPDKCLNPGFKPLSLAASKALRPRVSALIAGMVDAIREDRPITDAQKELLQVSSIPLYKILTVQAAYGRGMPTDDRETLAEIASVDLLFAVLDRIVSEAGRSMSSFIGADEAKIAMWQGQVNVVRQALADRQANTHLKVGAIMQIIEKTAFIENVLAASMSPGMAASLDWSRGVQTRALTH
>CP022600.1|AUX69646.1|1944479_1947185_-|conjugal-transfer-protein-TraG
MVEIFTVGGGDYLVNVFQAVAAWTGNGGYKSLLQVVMVMGLALSAITLAFNQDWRAWINWFLGATLIYSCLMVPRLDVRVTDRLNPTLAPAAVSNVPLGLALMASFTSQVGDYLTGSAEVVFGLPGDLNYSNNGMIYGARLYDATRSLRISDPEFAANLDEHFRQCVFYDVLLGRYSMKELAESGDIWTTIAPGSQARAQRFLTRDAGSGEVSSSIVTCREAYGALNGQWTSLVDSMGTVFGRQLYPNQTAALAKAKLFADLPVAYQYLTGVSASATDIFKQTLTINAMGQAMHSMSAASGAGNVDVYAQTRADIQTERTYGSIASNAMKWVPLLNIVLTVLFYALFPVLFPLFLMPKTGPIALKGYVTGFFYLAAWGPLFVILHMMLMYKGAADMAAATGANGLSLASFTGMADVNSDIGLLAGYLVASVPFLAGGVARGAMAISHHATSYLNPSQNAAEEAAREASTGNLALGNTSLENASVMTRQFSQGTIAPSFTYGAQQIRTVSDSGTVTASFGQASYDQLPNSSYPFTPTLGQEFTSRLSSMASQARANSESYVNVAAESTSSAVSKFRELRDQFSKSSSFESASGTSNADSIQTAFSEVDQASTNLQRQFGLSRRAADDITVSWFLNGEAGASAGLTNGVASANIGAKGGRNQSWTDSDIGIASEDRTRIFGSLSQISDSRNWSNTREGFVRSVSTASSSSVSTTASGLNASLTEAQSYTLEARRAEELANRLEHQASFFEGSSAAGSLNLSQAYRGWGLAEIETNRDFYGQARFDDAAFQLSEPGRALQAKFIASFADQVREEIEDRLTLPPGPAVERTSVSQARDVQDHTAGRGSGIMSHRQDAAAQEIADAVQGAHASGGARIKASRRDLERVTQKATGASPEAADDVKQW
>CP022600.1|AUX69645.1|1943698_1944187_+|hypothetical-protein
MRADLVPNTDTNVSDEKVISHFEVHQGIADQMEALAIELRSIPGSSVDTVPSPATLQAVLRKVYSARRKVDEIFGMQGFAVSPAWDIMMDLYQALDRGKAVSITSACIGSACPPTTALRWLQALENMQLIERSQDAFDKRRSVVTLTEGAKVKIASALAVYL
>CP022600.1|AUX69644.1|1941435_1942802_-|IS3-family-transposase
MKTQPSLKKSPPTKAPAEKVVKDIRRATRRHFSAEDKIRIVLDGLRGEDSIAELCRKEGIAQSLYYTWSKEFMEAGKRRLAGDTARAATTGEVQDLRREARALKECVADLTLENRLLKKKHDCGWGGRRMRYPASEKLEIIRIVEQSHLPAKRTLDQLGIARRTFYRWYDRYLEGGPEALEDRPSAPGRVWNRIAPEVQDQIVEMALEQSELSPRELAVRFTDEKRYFVSESTVYRLLKAHDLITSPAYVVIKAADQFHTKTTRPNEMWQTDFTYFKIIGWGWMYLSTVLDDFSRYIIAWKLCTNMRAEDVTETLDLALAASGCDSATVLHKPRLLSDNGPSYIAGELAEYIEANEMSHVRGAPCHPQTQGKIERWHQTLKNRILLENYFLPGDLEAQIEAFVEHYNHQRYHESLANVTPADAYFGRAPAIIKQRERIKRQTIEHRRLQHRKLAA
>CP022600.1|AUX69651.1|1954643_1955051_-|hypothetical-protein
MTTSPPLHLVATAERKPAQDNPLQSPPGGRKGWRARGSDLCFITMRASSFIGSSYLMALGAPLVFFLALSGGDGQSLFAHLANLAERFLAADDARQNQFLDEIKLVLIAAATLIAAWRLPRFLRDLERDLQGGKK
>CP022600.1|AUX69652.1|1955079_1957626_-|type-IV-secretion-system-protein-TraC
MALKLSTFTHSLLTGLLGDAEQAEAGRPSLMLDQLSDWLPYRVYDPGSRLYLNARSKGFVLSVTPLIGADERTGEILGQFFSEGLPPGACLQVLHWASPRISRIIAPWFGPRYLQGGVYEAIARHRAKHLYGLVWKSGSGDAPFHARHHQVIVSVSVPASKHVSHEELKQTRDGLIAMLRSLSLGVVEVGPESLIALIDDLTSPTTAPQEDLTAYNPNDAIAAQAIRHDIELVVQEDRMRLATERFRPTGKSHDGVPEIGAIYPDAFDVRHFAVRNTPARWAPWECARLIGDLFTDKLRFPCPAATMLCLVYPDREAAEARAGFKFMRTTSLSGTRSARFLPRIGEQAAEWQHVQAELQEGRRLVRVFYGLLTYSPLGRGDSDERAIKSIYKAAGWDLADERFLQIQGLLAAMPMTLADGLGADMERLKRLRTLLSTTAANIAPMQGEYLGGAHPHLLFVGRRGQPFFWSPFENEAGNHNVAICGKSGSGKSVLLQEMCAALRGAGAQVVVIDDGRSFEHSVKLQGGRFVEFTLAAGFCLNPFSMIDAARAAEDEDYRLDCFGMVKAIIGQMARHSAPLSDIERGLIDRAVNTVWNEAGTAATVTSVGEALSRTGHEMADDLATSLAPYMAGGTYGAFFEGAASLALDTDFTVFEMSDLGAREELRSVVLSAIMFMTSQAMTRTPRQVRKLLLIDEAWSMLKGGSMGEFVETYARTCRKYGGALATATQSLNDYYKSDGATAALENSDWMLILQQKPETIADFKASKRLDMDDRTETLIRSLKRSGNDYSEVFIKGPEVEAIGRLVLDEYSSTLFSSSPGTFAAIDAEVARGHQLADAIERIAFGPSS
>CP022600.1|AUX70922.1|1957625_1958351_-|conjugal-transfer-protein-TraV
MRHNIRLPLCATLAVLLSGCATFGTNVEGSFQCRAPQGDCAPSHIIDARAAGEIRQAETPRSTLRPPRMVDPGDQARTAERTLKIVFPARVDETGTLHDEAVAWAVIENPRWAAELRRRPGSEAATPLMRQLRRQLKTALEVRASTTDRDAAPDSDDDPSPLFSSSPSNHLSPLASPLVPPSTAREADAGASAPAAEGFDMPASPHDRAPRPSGSPSPLTYPSLEAIEAARSGASTPGEPK
>CP022600.1|AUX69653.1|1958356_1959247_-|disulfide-bond-formation-protein-DsbC
MSGQDNHSPARTSARWIRPAAAIASLIALSGATGWAAASLASTAKTPDTATVRTALELRLPKTPITQIDCKGLGGLCEVASKSTLFYIDRAARYLVIGRVYDMETRQDLTAARLLELNPDLLTAGAPRNAQAKEASQQAPRGSATKVSLAGLPAKGAIMWGPANGLKAVVFSDFNCAYCKKLEDELKAIGARVEERPIAIFGAESRREAERVLCAPRPDLALRLAYAGTALANPRPCDTSGLDANEAFARANGFNGTPVIVRPSDGAVLEGYRPAHVLRAFLAGKPMPAQTLTKKG
>CP022600.1|AUX69654.1|1959243_1960578_-|conjugal-transfer-protein-TraB
MSDTPTPAATAQTETVSIAPVANLNAATARRQKLLLIAIGAVVLAGGSWLILGGDDRAKGNDPHAAQTIDTAGLVNRDLSQREFVATYGNRLEAVSREQKALKDTSVPRSEIEAQLAALKSENQAMRTDGQAAIDAISAENAELRSRLASQSAPPPPNAPVPAYGPQAGGYDGRGRAPTPISTLGGPQGAGEPTFAAPGEVTLMSFGGDKAAGGGARAIRPEAPPVVVEDSPDYLPPNSYASARVIVGVDASAGVSSQTDPLPVVLRITGPARSVMQNGKVLTTRIEGCIVNGAARGDLSSEKVYVKLARMTCDQPGGRVAVSEVKGFISFAGKSGVRGRVVSREGNLVSQALLAGIVGGFGRGFSANANGIFAGQLGAGQQRPSLSATDIVAGGLGQGAGEAADTVSRYLIERAEQYQPVVEMPTGIAVEIVFLDGVYVRNSQ
>CP022600.1|AUX69655.1|1960574_1961336_-|conjugal-transfer-protein-TraK
MAYAHALRPAKWLASAAALALTLVGASPTLAADQFRQAADGSSIECAVSARELTRFALADDQFASVSKISSGTPYNDFAVTNEPLRGDIYVSVPETFAARAISFFATTRKGFVYKIACRIEPIPAVQVFITNPAIARNMAADWEKETPLTASAVRLIQAMADDRSVQGFEVRQVAASPARVGDLEVQLIADYEGSSLAGKVIRIANRGKANVTLAERDLAPAGALAVAIVRPVLAPGMSTTAFVVGANGEQGQ
>CP022600.1|AUX69656.1|1961335_1961908_-|conjugal-transfer-protein-TraE
MFADISHERQQTLLRQRNLFALTSAGLGIALVVATSLAATRDREVVLLPTVPRELTVSSAGVDADYLELVTRDTALVLLNRSPEGLDYWMGEILKLADPVSHGQLKADLVKIVAEQRGSDVTQAFVIRSMTVDPKGLTSEVTGTLKTFVGAQVIASDDRRFRFTWTYRGLRLALAGFAQLPIKDTSKEAR
>CP022600.1|AUX69657.1|1961920_1962208_-|type-IV-conjugative-transfer-system-protein-TraL
MADPYIIPRRLDDPELIGFWTIDEFAGMIVPFTWGILSQHIFIGIIVAFGAWFALRKAKAGRASSWVAHAAYWYLPAGLLGLKSTPPSHCRLLAG
>CP022600.1|AUX69658.1|1962237_1962582_-|hypothetical-protein
MQSPTLLQRAGVSCQRATKAKRAMTFVIPALIASLAAGTAYAGADTTFDPALAQFTNFLEGSGGKIITVLSLAGGLIGLASGRFSLGQVAVPVGVGIGVGTGVPIVTSVVTAVI
>CP022600.1|AUX69659.1|1962930_1963383_+|transcriptional-regulator
MHQSGIPTNASLARVLTHAIETADKPKHQIASEAGIHRVTLFKIMRGEHVISIDRAVRIFEICGACPHVAIVLTLAGEEVLACDWMRRDMGAFLDAFITSLPGQLDRTLGRRIADLRPRWAAGTSQLVAKLLAKHIDDLANREIGMTLIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022600_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022600_3

2823907-2824010

Orphan

Consensus_repeat	Method
GCATGCGCGCGCGATGGGTTCAGGGGGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022600_3

>merge|CP022600|3|2823907-2824010|CRISPRCasFinder
GCATGCGCGCGCGATGGGTTCAGGGGGGGCGCGGCTGACCGCGAGGCTCGGCACGCTCTCGCGAGCGCACGCCTGCATGCGCGCGCGATGGGTTCAGGGGGGGC

>CP022600|3|2|2823907-2824010|CRISPRCasFinder
GCATGCGCGCGCGATGGGTTCAGGGGGGGC	GCGGCTGACCGCGAGGCTCGGCACGCTCTCGCGAGCGCACGCCT
GCATGCGCGCGCGATGGGTTCAGGGGGGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP022600.1\|AUX70346.1\|2826389_2828558_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514
CP022600.1\|AUX70340.1\|2815964_2817647_-\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236239
CP022600.1\|AUX71003.1\|2834898_2836470_+\|protease	unknown	unknown	gnl\|CDD\|379142
CP022600.1\|AUX70336.1\|2812957_2813404_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX70344.1\|2821621_2822236_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX70343.1\|2821133_2821625_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378537
CP022600.1\|AUX70348.1\|2830156_2831713_+\|cryptochrome/photolyase-family-protein	unknown	unknown	gnl\|CDD\|225588
CP022600.1\|AUX70342.1\|2820347_2821010_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
CP022600.1\|AUX70349.1\|2831709_2832609_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376806
CP022600.1\|AUX70339.1\|2814486_2815923_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143465
CP022600.1\|AUX70341.1\|2818837_2820307_-\|cysteine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234705
CP022600.1\|AUX71001.1\|2824255_2824912_-\|fructose-6-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234947
CP022600.1\|AUX70347.1\|2828600_2830112_+\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX70345.1\|2824961_2825633_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378471
CP022600.1\|AUX70350.1\|2832711_2833347_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|239344
CP022600.1\|AUX70351.1\|2834123_2834792_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX71002.1\|2825629_2826334_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379394
CP022600.1\|AUX70337.1\|2813773_2813977_+\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX71000.1\|2817800_2818751_-\|D-2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240625
CP022600.1\|AUX70338.1\|2813973_2814384_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP022600.1\|AUX70346.1\|2826389_2828558_+\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0
CP022600.1\|AUX70340.1\|2815964_2817647_-\|acetolactate-synthase-large-subunit	gnl\|CDD\|236239	PRK08322, PRK08322, acetolactate synthase large subunit.	0
CP022600.1\|AUX71003.1\|2834898_2836470_+\|protease	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	4.83581e-20
CP022600.1\|AUX70348.1\|2830156_2831713_+\|cryptochrome/photolyase-family-protein	gnl\|CDD\|225588	COG3046, COG3046, Uncharacterized protein related to deoxyribodipyrimidine photolyase [General function prediction only].	0
CP022600.1\|AUX70343.1\|2821133_2821625_-\|hypothetical-protein	gnl\|CDD\|378537	pfam11008, DUF2846, Protein of unknown function (DUF2846). Some members in this family of proteins with unknown function are annotated as lipoproteins however this cannot be confirmed.	2.94751e-06
CP022600.1\|AUX70342.1\|2820347_2821010_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	7.46936e-44
CP022600.1\|AUX70349.1\|2831709_2832609_-\|hypothetical-protein	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.15533e-14
CP022600.1\|AUX70339.1\|2814486_2815923_-\|aldehyde-dehydrogenase	gnl\|CDD\|143465	cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like. Aldehyde dehydrogenase ALDH21A1 (gene name RNP123) was first described in the moss Tortula ruralis and is believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and ALDH21A1 expression represents a unique stress tolerance mechanism. So far, of plants, only the bryophyte sequence has been observed, but similar protein sequences from bacteria and archaea are also present in this CD.	0
CP022600.1\|AUX70341.1\|2818837_2820307_-\|cysteine--tRNA-ligase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	1.52943e-160
CP022600.1\|AUX71001.1\|2824255_2824912_-\|fructose-6-phosphate-aldolase	gnl\|CDD\|234947	PRK01362, PRK01362, fructose-6-phosphate aldolase.	5.8928e-149
CP022600.1\|AUX70345.1\|2824961_2825633_+\|hypothetical-protein	gnl\|CDD\|378471	pfam10677, DUF2490, Protein of unknown function (DUF2490). This is a bacterial family of uncharacterized proteins. They appear to belong to the outer membrane beta barrel superfamily.	7.83123e-18
CP022600.1\|AUX70350.1\|2832711_2833347_+\|glutathione-S-transferase	gnl\|CDD\|239344	cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.	6.30599e-31
CP022600.1\|AUX71002.1\|2825629_2826334_-\|hypothetical-protein	gnl\|CDD\|379394	pfam13852, DUF4197, Protein of unknown function (DUF4197). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 228 and 249 amino acids in length.	6.45119e-37
CP022600.1\|AUX71000.1\|2817800_2818751_-\|D-2-hydroxyacid-dehydrogenase	gnl\|CDD\|240625	cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomains but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric. Formate dehydrogenase (FDH) catalyzes the NAD+-dependent oxidation of formate ion to carbon dioxide with the concomitant reduction of NAD+ to NADH. FDHs of this family contain no metal ions or prosthetic groups. Catalysis occurs though direct transfer of the hydride ion to NAD+ without the stages of acid-base catalysis typically found in related dehydrogenases. FDHs are found in all methylotrophic microorganisms in energy production and in the stress responses of plants.	1.11784e-98

>CP022600.1|AUX70344.1|2821621_2822236_-|hypothetical-protein
MQPVAADAQETQAAGQVPVAGDVADNPEPSADAPAVPVSDLLLPKGYQILIAVEKEVGSKISGTGQSFPIRLAQAVTIDGVEVLPAGITGEGQVVHAKKAGMAGSAGELVLAARYLDFAGRRIELRSFKFIEEGDAILSRGQNNIDLASATNAVIGPLGFLIGGGNTTIAPGTLATAKTRNDEAFDRPAAAPEEHDRSNEEGMP
>CP022600.1|AUX70343.1|2821133_2821625_-|hypothetical-protein
MKKLVAAIAIAAAMPVATAVTAPAALAQAEGGFEIPTPPEGKGQIIFYRTGGLSGAALGCAVFDVGAEDKLSSLGAGRYFVLVSEPGPRSFTVKSLETKDALTLEIEPDETQFVRCKIKSGFMSGRADIAPSTENEFRSKYKNPKLVDGDDMSEAVRATNYPQ
>CP022600.1|AUX70342.1|2820347_2821010_-|nitroreductase
MNVTEAVTTRRSIRAFLDKPVDLETLTRVMDKARWAASGCNYQPWEASIVTGQPLKDLQAKITSSAPQQAEYDWAAPGQEDAYKERLNAVSAGMFGAMGIARDDGAGRMAAMMKNAVSFDAPAVLFVYFPRLMKEAQWSDTGMWLQTVALLLREEGLDSCFQEYMALYANVIREFLGLDHERYMFFCGMAIGYRDPDAPVNNFERQRVPLAEQVKFIGFE
>CP022600.1|AUX70341.1|2818837_2820307_-|cysteine--tRNA-ligase
MTDAPLKLFNSLTRTLEVFEPVHPGEARVYSCGPTVYNYPHIGNMRAYVFADVLGRTLTWKGLKLTHVINITDVGHLTDDADAGEDKMEKMAAERAQSIWDIAEHYKQAYWADVRALNIRQPAQWTVATDYVPQMIEFAKGIADKHCYELESGLYFDVSTVADYGRLARANTEEGEGRIEAVEGKRNAADFAIWRKTPPGETRQMEWDSPWGKGAPGWHLECSVMSGEVLGFPFDIHTGGIDHREIHHPNEIAQNQAHCCTNGLDDPRNSGARIWMHNNFLVERSGKMSKSSGEFLRLQLLIDRGYHPLAYRLMCLQAHYRSELEFSWEGLGAALTRLKRMVMAFDKWHDKLSDTDVPGDSWEYERVTRDLIARFDAAIAQDLNTAEALTVLEEMLGLKKVAPECIVTAAVRMDSVLGLDLGRLERADLRIRPKSATITEAEIEAALARRTEARAAKDFATSDAIRDELAAAGVEVMDGDPLGWEWKLG
>CP022600.1|AUX71000.1|2817800_2818751_-|D-2-hydroxyacid-dehydrogenase
MTARPVTLAISGLIRPMLEPHLPAGLDVRWFMTHEEALEAVAEAEIGWFDSNSKEDMVRSLMAAKKLKWLNSIYAGLDFLPMDVLIERGITVTNGAGINAITIAEYVVMGMLNIAKGYREVVRAQERHEWLFDSPGKRELAGSKALLLGYGAIGKLIQPRLEAFDVEVTVVRRSGGEGVLRPHEWRARLGEFDWVILAVPATPETEGMIGAAELAAMKSDAVIVNIARGSVIDQPALVQALEKKAIGAAFLDVTTPEPLPADHPLWSLDNAHITMHLSGRAQDKMFLRSGQRFLDNLAKYLRGEPVAPVFDPRLGY
>CP022600.1|AUX70340.1|2815964_2817647_-|acetolactate-synthase-large-subunit
MSDTKKASDLFIECLEAEGVEYIFGVPGEENLDFLESLSHSTKIKLILTRHEQGAGFMAATYGRHTGKTGVFLATLGPGATNMVTAVAYSQLGGMPTLAITGQKPIKKSKQGRFQILEVVAMMSPITKYAHQLASADNIPSRVREAIRLAEEEKPGAVHLEFPEDIAEEHTSSRPLAPSLARRPSAEAKAVRQAVLALEGAKKPILVIGAGANRKMTGRMLRQFIDKTGIPFVTTQMGKGVVDERHPLFLGCAALSAGDFVHRAIEDADCIVNIGHDVIEKPPFFMKNDGEGAVGSDSPPVVIHVSTKTAEVDPVYFPHIEVIGDIANAIYQIKEDIVPQGRWDFKRMLEYRAAEVAHTAPLAADTRFPIFPPHLVAQVRGAMPEDGIICLDNGVYKIWFARGYTAYLPNTVLLDNALATMGAGLPSAMMSAMLYPDRKVMAICGDGGFMMNSQEMETAVRLGLNLTVLILRDDAYGMIRWKQANMGFKDFGLTYGNPDFVAYAESYGAIGHRVTSSEHLTDLLAHCRDTPGVHLIDCPVDYTENDQILNIDIKRLSKEL
>CP022600.1|AUX70339.1|2814486_2815923_-|aldehyde-dehydrogenase
MKLKDTYPLYLNNKAVQPNTDLAVTDKYTGEVAFRTALATPDIIEEGIAGAVRAAEPMARLASYEKQDVLMHCVRRFRERFDELSFALCVEAGKPIKDAEGEVTRLIDTFRIAAEEAVRNYGEVQPLDISPRAKGYMGMWKRVPIGPCSFISPFNFPLNLAAHKIAPAIAVGCPFVMKPASKTPLGAIIMGEVLAECDVLPEGAFSILPASRDGADLFTEDERLKLLSFTGSPGVGWDLKAKAGKKKVVLELGGNAAVIIDKDADLADALERVIFGAFYQSGQSCIGVQRILIHANVYDTFKAMLVERAGKLIAGDPKDRETFIGPMISDGEAKRLKGWIDDAVAAGATLLCGGGLTRGNMLEATLLEGVPEDAKAKNEEAFGPLAILQRFDDFDAALEEVNNSKFGLQAGIFTRDLFQMFDAWDRLDVGGVVINDVPSYRVDNMPYGGVKDSGLGREGIRFAMEDMSEIRNLVIRRT
>CP022600.1|AUX70338.1|2813973_2814384_+|hypothetical-protein
MMLTESLRDPFAHIFADLDTIEIKSLHAALRPRRTLADRVRAAVLGLTGGAGTVLAHEEKAWASITFAGTRHEVVMEFCGADAVVAGEELIERLPDHEFTLPGQLVADATITKVDHRFGAMERLEVTAVLLLLEEG
>CP022600.1|AUX70337.1|2813773_2813977_+|hypothetical-protein
MLLRTIETFLRAHAMPATKFGRLAAHDPRFVLDLRMGRTPRPETELRTRAWMQGYADCAAAEQKEAA
>CP022600.1|AUX70336.1|2812957_2813404_-|hypothetical-protein
MALSFAIGLVFFAIGERKARSHGLAKSRDLSAIEGRVAALEQSLKMQRDLLTEAIEEMRGKVEAAEKQASLAITHADQLYFNQHETVGKAEKLHAELSKRFEETIKGMQGESGIGFHAADEIRRAKSEAEEALIKLEDILAKLEGRWE
>CP022600.1|AUX71001.1|2824255_2824912_-|fructose-6-phosphate-aldolase
MKFFADTAEIDAIKDLAATGLLDGVTTNPSLIAKSGRDFMEVTREICGIVDGPVSAEVVALDHATMMKEAEVLRKIADNVCIKVPLTVDGLKTCKALTGEGTMVNVTLCFSANQALLAAKAGATFISPFVGRHDDNGFDGMDLIEDIRLIYDNYNFATEILVASVRHTTHVLQAAKIGADVMTAPPKVIHDLFKHVLTDKGIEGFLADWAKTGQSILK
>CP022600.1|AUX70345.1|2824961_2825633_+|hypothetical-protein
MGQRMTLGPMRSALLLAAMLAAWQPSKARAGEEDTQFWLNAIATGQIGEGTTLTIDATQRWRGDEEVGNDQQTIRVMVEQQVADNTRLGGGIMLFDTAGLTEIRTHQQATVIVGRIEARTRLEQRFFDGADRMELRLRQRFTYNQPIANNWRASAGVEWLGIMQSRRADEGRSTEQWRFQTNLIHRAAPNLEVGAIYWLVVFPRGPRPDRVSHIPQATLIYRF
>CP022600.1|AUX71002.1|2825629_2826334_-|hypothetical-protein
MTVNVTTAAQSFTRRRLLAGAAGAGTLLLLPACATTGGFSMVEAVRRMLLLASENAFARLTEPGGFWDQQVAQLGLGSVLGARGDVLSRILTSGLVKDQLEDRFANLAIDASFRAAPVVTDAIQVIGLENAIDLVRGGPNAASDFLRAEMGSALIDAMVPELGQAMRLSRDPLLGQALGSLTGVDVAGVADRFGRQVDDAIWGEIAREEAAIRARPEDTRDPVLIGVFGGLGRI
>CP022600.1|AUX70346.1|2826389_2828558_+|primosomal-protein-N'
MNRVRLLVLNAALGPLDYRLPDGVDAPAGSVVIAPLGPRKVTGIVWDEGRLPGEDIAFERLRPIVEVLPVPPLPAPLRRLIEWTADYYCAPLASVARMALSSGGALGGPATMTEYRLTGSEATGRLTAKRKTALEKLAGEQGTMRELAGMAGVSEGVLRGMAGAGLLEPVTVQIDRPYPIADPDHAPPDLSDDQRAVAGRLVSAVNTRAFAPFLLDGVTGSGKTETYFEPVAQAIRQGRQVLVLLPEIALTENFLARFAARFGTAPVLWHSSLKSTERRRAWRAIANGEAQVVVGARSALFLPYANLGLIVVDEAHEVSFKQDDGVRYNARDVAVMRARFEGVPVVLASATPALESLHMAAQGIYEKLDLPSRFGGASLPAVRLVNLTEEKPGSQRWLAGPLIEALRDRLDKGEQSLLFLNRRGYAPLTLCRNCGHRFKCPSCSAWLVEHRLSSRLACHHCGFETRVPDACPECGEKDCLVACGPGVERIADEVRDLFPDARVALATSDTLNTPERAAQFIAMAQDKAIDIIIGTQLVTKGFHFPDLTLVGVVDADLGLEGGDLRAGERTFSQIAQVAGRAGRGAKPGEVLIQTRHPDAPVIAALANGDRDAFYAAETEGRRDAGAPPFGRWAAIILSSEDEKEAREAAVRLGDVRPRLAEVQILGPAPAPLSLLRGRYRYRFLVNARRSANLQAVLRDWIGSIRFAPGVRVGVDIDPYSFV
>CP022600.1|AUX70347.1|2828600_2830112_+|hypothetical-protein
MVPRLCLFVMALCLAWCFALPVHAQAWLRAESDHYVVHARLDEAELRSLMQSIEEFDRVLHGLMPAETRHGRKPELYLTDRPARIARAANFGASAVCQDHAELPIAYALYTTDPTGERDPSEVFYCLTQFHLGNGFFRPKPMWVTAGLSHYFATASSKERGLFTIGKPRSIRPIRGITSAAMTEALMVRFRHRTEAEYSRFLDLSRVIASPLLIEPQYAGVLDRYIDAYVTGRSMEDAARELGDLEALATELGQRRIVAPMRRVRIQPMFVADVTVRRMARDEIALIDLRIERLLETRLNASARELGELTRRFPDSALVWYEYAAAEYARVQNSDFGGRPVFRGFGFSNGELIVMANPYSDAEAWRAVNKALSLDPDLAPARRLRAEILLARLVREGNPDDPAAYDEVRAMLGPLARAPEREPLAAALYHQSYVEQDREPPEAALNQLRRAFLANAGVGDFRYAYATAQSRRGEKNEARSLLISMLNDPAFQAAAFRALEVTQ
>CP022600.1|AUX70348.1|2830156_2831713_+|cryptochrome/photolyase-family-protein
MTAPVLVPILGDQLSHNLSSLDGLSPASTVVLMMEVWDEATYVKHHKQKIVLIFSAMRHFADELRAEGWQVDYIRLDDPENTGSFTGEVARAIQRHAPGEIRVTESGEWRVAQAMLEWEGRFACPVSILPDTRFVATHAEFRKFAEGRKHLTMEYFYREMRRKTGLLMEGDKPVAGVWNLDSENREPPKAGLKAPPTPKFAPDAITQEVIALVAERFPDHFGDLEPFGWPVTRAEALEAAEAFFARRLEKFGPYQDAMVHGEDDLYHSMLSTSLNCGLLDPLELCRAAEDAYKSGRAPLNSVEGFIRQIIGWREYVRGFYWHQMPGLAEANELGATRPLPEFFWTGKTDMRCLADCIRTTQEDAHAHHIQRLMVLGNFCLIAGIDPRAVADWYLAVYADAFEWVELPNVAGMVLYADGGRLATKPYAASGNYINKMSDYCGKCRYKVSQKTGPNACPFNPLYWHFMDRNRARLESNHRIGRIYATWDKMGEAKQAEYLQSAEKFLDSLEPARKGWARA
>CP022600.1|AUX70349.1|2831709_2832609_-|hypothetical-protein
MDIVETAPAPAPLWKRIIDFPLVTMLIALALVAAVMVPVNIVGGFFGEPVGWDIVEPVVAVTLIVALIGLQKLVLRRLGSRKHDDLPFAAAPRDLAMGVFGAGALFSLIVGIAALLGAYVIDGWGGMTSWVFILFWAGFNAGFIEELIFRGILFRWIEEFGGSWAALFITSGLFGLVHMGNDNATWMSGLTIAAVAGTLLGGAYMLTRSLWLPVGLHFGWNVTQGLVWDVPVSGYDGDGLVDARLVGDPLISGGAFGLEASVIALVVGGVAGAWMVWRAVRAGEVMAPWWARRGVAAGA
>CP022600.1|AUX70350.1|2832711_2833347_+|glutathione-S-transferase
MLTIHHLRLSQSERIVWLAEELGLEYDLKLYTRRTDNRLAPDDYKALHPMGIAPVITDGDFVLGESGAIMDYIVAKYAPGTALVPGADHPDFADHLFYYHWANATFMTNGMMALVAQFMGAAEMPPFVADRVQKGWAIVEKRLGEAEYFGGTQLTTADIMMGFQLTTSRAMSGMGIEGMPNLQAYLKRIGERPAYQRAMAKCEPGMPPKLD
>CP022600.1|AUX70351.1|2834123_2834792_-|hypothetical-protein
MTKWLLFAATGVLALSGPAQAQKQAQLQEGVGATFKIADKAFTFAVPEGYCLPEGADLALAEAYADFDTINFTHASIQRCDAVYEDYSLIKSMRKAKPVNVTKAIFVPLMARTLENELGGQLFESGLDQARKDLSAGTGDSLKLGEAAARSAGFDADCAYILGSAQVSVGELSQVMNFATCMTLVEGQVFAVHAYADAKREVPDDTLKARSRAIAASLALVP
>CP022600.1|AUX71003.1|2834898_2836470_+|protease
MSKVRQRAAAVLLWVMLAFALAIPASADPGDVDAAARGVVRVVIIGSEDGQPVPVSHGTGFAVSPTRIVTNAHVVREVLQDDTLRIGIVPPEGAGGAFGRVVAVSPRNDLALLEIAKGALRLPPLALAGGPGANLGEVAAVGYPMNVDLAQGLDLSDIFRAQPPVKSRGFLSGERPSRQFDTILHTAPIARGNSGGPLLDPCGRVIGVNSFSADSNSGEAEFYFAVSLRELLPFLRTNGVEPVVNTLPCRSIDELNADERQRLEAEQSQARALLAERAETLRETRERARIAAQMDVLAERENRMALALIALLTATAAGYCAFAWRGMEARRTHGRIAAAASAAAVVTAVLLWITRPGLAEIEDRVAAAIAEVEGSNKPAPAAGSEAAEGALICTLVPERSRVTSARTDDVAFDWSADGCVNDRTQYGLGPAGEWQRVFAAQEDAAVAVNTFEPATRTLRTDRYLLGQEALAAAREARAAYTPPSCGVSDAARTLGEQQSALIAALPARPNERLVYSCKAKGGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022600_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022600_4

3170652-3170759

Orphan

Consensus_repeat	Method
CTTCTTGGCAGGTGCCTTCTTGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022600_4

>merge|CP022600|4|3170652-3170759|CRISPRCasFinder
CTGATCGGCAACTTACTTCTTGGCAGCGGCTTTCTTGGCCGGAGCCTTCTTGGCCGCCGGTTTTTCTTCAGCCGGAGCTTCAGCCTTTTTCGCCGGAGCCTTCTTGGC

>CP022600|4|3|3170652-3170759|CRISPRCasFinder
CTGATCGGCAACTTACTTCTTGGC	AGCGGCTTTCTTGGCCGGAGCCTTCTTGGCCGCCGGTTTTTCTTCAGCCGGAGCTTCAGC
CTTTTTCGCCGGAGCCTTCTTGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP022600.1\|AUX70628.1\|3172489_3172798_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371696
CP022600.1\|AUX70634.1\|3177356_3178382_-\|sporulation-protein	unknown	unknown	gnl\|CDD\|276807
CP022600.1\|AUX70637.1\|3180165_3181536_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
CP022600.1\|AUX71044.1\|3163249_3163837_+\|RNA-polymerase-subunit-sigma	unknown	unknown	gnl\|CDD\|105710
CP022600.1\|AUX70633.1\|3175967_3177272_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225193
CP022600.1\|AUX70623.1\|3166050_3167313_-\|ATP-dependent-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
CP022600.1\|AUX70626.1\|3169937_3170525_-\|hypothetical-protein	unknown	unknown	unknown
CP022600.1\|AUX70620.1\|3163833_3164619_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227648
CP022600.1\|AUX70629.1\|3172861_3174274_+\|ribosome-biogenesis-GTPase-Der	unknown	unknown	gnl\|CDD\|234628
CP022600.1\|AUX70621.1\|3164771_3165326_+\|beta-Ig-H3/fasciclin	unknown	unknown	gnl\|CDD\|225214
CP022600.1\|AUX70635.1\|3178639_3179362_+\|chromosome-partitioning-protein-ParA	unknown	unknown	gnl\|CDD\|349760
CP022600.1\|AUX70632.1\|3175553_3175754_-\|ferredoxin	unknown	unknown	gnl\|CDD\|225458
CP022600.1\|AUX70625.1\|3168381_3169914_+\|amidase	unknown	unknown	gnl\|CDD\|236161
CP022600.1\|AUX70624.1\|3167510_3168215_-\|ATP-dependent-Clp-endopeptidase,-proteolytic-subunit-ClpP	unknown	unknown	gnl\|CDD\|178955
CP022600.1\|AUX70636.1\|3179383_3180109_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|310261
CP022600.1\|AUX70631.1\|3174930_3175413_-\|bacterioferritin	unknown	unknown	gnl\|CDD\|153099
CP022600.1\|AUX70622.1\|3165520_3165886_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238509
CP022600.1\|AUX70618.1\|3161638_3162307_+\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	unknown	unknown	gnl\|CDD\|234603
CP022600.1\|AUX70619.1\|3162314_3163250_+\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
CP022600.1\|AUX70630.1\|3174280_3174763_+\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|378544

Protein	Function_ID	Function_description	E-value
CP022600.1\|AUX70628.1\|3172489_3172798_+\|hypothetical-protein	gnl\|CDD\|371696	pfam11730, DUF3297, Protein of unknown function (DUF3297). This family is expressed in Proteobacteria and Actinobacteria. The function is not known.	5.35799e-44
CP022600.1\|AUX70634.1\|3177356_3178382_-\|sporulation-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	3.31137e-19
CP022600.1\|AUX70637.1\|3180165_3181536_+\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	9.15064e-08
CP022600.1\|AUX71044.1\|3163249_3163837_+\|RNA-polymerase-subunit-sigma	gnl\|CDD\|105710	PRK12514, PRK12514, RNA polymerase sigma factor; Provisional.	4.79906e-50
CP022600.1\|AUX70633.1\|3175967_3177272_-\|hypothetical-protein	gnl\|CDD\|225193	COG2311, COG2311, Predicted membrane protein [Function unknown].	8.67653e-64
CP022600.1\|AUX70623.1\|3166050_3167313_-\|ATP-dependent-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	0
CP022600.1\|AUX70620.1\|3163833_3164619_+\|hypothetical-protein	gnl\|CDD\|227648	COG5343, COG5343, Uncharacterized protein conserved in bacteria [Function unknown].	2.50904e-24
CP022600.1\|AUX70629.1\|3172861_3174274_+\|ribosome-biogenesis-GTPase-Der	gnl\|CDD\|234628	PRK00093, PRK00093, GTP-binding protein Der; Reviewed.	0
CP022600.1\|AUX70621.1\|3164771_3165326_+\|beta-Ig-H3/fasciclin	gnl\|CDD\|225214	COG2335, COG2335, Secreted and surface protein containing fasciclin-like repeats [Cell envelope biogenesis, outer membrane].	2.19348e-44
CP022600.1\|AUX70635.1\|3178639_3179362_+\|chromosome-partitioning-protein-ParA	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	6.24031e-30
CP022600.1\|AUX70632.1\|3175553_3175754_-\|ferredoxin	gnl\|CDD\|225458	COG2906, Bfd, Bacterioferritin-associated ferredoxin [Inorganic ion transport and metabolism].	1.15401e-05
CP022600.1\|AUX70625.1\|3168381_3169914_+\|amidase	gnl\|CDD\|236161	PRK08137, PRK08137, amidase; Provisional.	0
CP022600.1\|AUX70624.1\|3167510_3168215_-\|ATP-dependent-Clp-endopeptidase,-proteolytic-subunit-ClpP	gnl\|CDD\|178955	PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed.	7.29914e-144
CP022600.1\|AUX70636.1\|3179383_3180109_+\|hypothetical-protein	gnl\|CDD\|310261	pfam05534, HicB, HicB family. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches.	0.000379886
CP022600.1\|AUX70631.1\|3174930_3175413_-\|bacterioferritin	gnl\|CDD\|153099	cd00907, Bacterioferritin, Bacterioferritin, ferritin-like diiron-binding domain. Bacterioferritins, also known as cytochrome b1, are members of a broad superfamily of ferritin-like diiron-carboxylate proteins. Similar to ferritin in architecture, Bfr forms an oligomer of 24 subunits that assembles to form a hollow sphere with 432 symmetry. Up to 12 heme cofactor groups (iron protoporphyrin IX or coproporphyrin III) are bound between dimer pairs. The role of the heme is unknown, although it may be involved in mediating iron-core reduction and iron release. Each subunit is composed of a four-helix bundle which carries a diiron ferroxidase center; it is here that initial oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of ferric-hydroxyphosphate at the core. Some bacterioferritins are composed of two subunit types, one conferring heme-binding ability (alpha) and the other (beta) bestowing ferroxidase activity.	1.47719e-76
CP022600.1\|AUX70622.1\|3165520_3165886_+\|hypothetical-protein	gnl\|CDD\|238509	cd01038, Endonuclease_DUF559, Domain of unknown function, appears to be related to a diverse group of endonucleases.	8.90624e-23
CP022600.1\|AUX70618.1\|3161638_3162307_+\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	gnl\|CDD\|234603	PRK00056, mtgA, monofunctional biosynthetic peptidoglycan transglycosylase; Provisional.	2.92465e-98
CP022600.1\|AUX70619.1\|3162314_3163250_+\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	5.93495e-82
CP022600.1\|AUX70630.1\|3174280_3174763_+\|GTP-binding-protein	gnl\|CDD\|378544	pfam11026, DUF2721, Protein of unknown function (DUF2721). This family is conserved in bacteria. The function is not known.	8.667e-24

>CP022600.1|AUX70626.1|3169937_3170525_-|hypothetical-protein
MHTDRRQFGISVIAIASLLLTGCFTGEDDGIANEILFNTAHPLKTGPGRICALSRNDCMDIRIVRDDSKTSGYMLSLPQEGVESPLFMRALKGAGIPPDTYVMMSFGDEDGLASDAYGLALASRQSDGGWLIMHPECAYAKQTAIEEDFPWVRLEIAFGTPVCRIASDGLTDARLYTTLSALTNQDEKFRLYEGG
>CP022600.1|AUX70625.1|3168381_3169914_+|amidase
MTYRTLSRPALALMLATSSVAAFAQTSETIAIAEKPPAAMADAARQIERIRNLDDAGPMLNAVIAYDPNAAAIAVTMTERLLAGRTVLVKDNIETREFPTTAGSLALKDNMTGRDAPMIANLRRNGGVVLGKANLSEWANIRSDNSTSGWSAVGGLTRNPYAIDRNTCGSSSGSGAAIAAGFAWAAIGTETNGSITCPASINGIVGFKPSVGIVSRTHVVPISSTQDTAGPMTKTVYDAALLLTAIAGEDPADPVTLTAKRVADYTQDLETASLKGVRIGVMRDQVGNRDDLTAVFNAALADMERAGAVLVDISFKPNSQMYGDSFTVLMFELREEMGKYLASIPAFKDGKTPRSLADLIEFNTAHADAEMRWFGQELFEQAEATTDREAYETARENAVRIAGEETLDKLLADNNVQFLVAPTRGPAWVSDLVNGDNFNGSVGFGSPSAIAGYPHLTVPMGAIEGLPVGISIMGAKWDDHAVLKAGAAYEKARTAVLPAPTFERWQPAER
>CP022600.1|AUX70624.1|3167510_3168215_-|ATP-dependent-Clp-endopeptidase,-proteolytic-subunit-ClpP
MIDLFGNAGETYGTQGQFTRDPLTGALVPVVVEQTSRGERSFDIFSRLLRERIVFVTGQVEDGMASLIVAQLLFLESENPSKPISMYINSPGGVVTAGLAIYDTMQYIKPRVSTVCIGQAASMGSFLLAAGEPGMRIALPNARIMIHQPSGGARGMASDIEIQAREILRIRSRMNDLYVKFTGRSLDEIEKAMDRDTFLEAEEAKAFGLVDKVFETRPDTEETGGEDGSGGAPE
>CP022600.1|AUX70623.1|3166050_3167313_-|ATP-dependent-protease-ATP-binding-subunit-ClpX
MTKLSGSDSKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCNDIIREETKAGIAGKKDGEIPTPMDIFTTLNDYVIGQDRAKRVLSVAVHNHYKRLKHSGKAGDVELAKSNILLVGPTGSGKTLLAQTLARTFDVPFTMADATTLTEAGYVGEDVENIILKLLQASDYNVEKAQHGIVYIDEIDKITRKAENPSITRDVSGEGVQQALLKLMEGTTASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDKIIADRLQKRSIGFGAHVADPDKRRVGELLEKSEPEDLLKFGLIPEFVGRLPVIATLHDLDVPALVTILKEPKNALVKQYRKLFELEDVELTFTDDALQAIAERAIKRKTGARGLRSIVEGLLLDTMFDLPDMEGVTEIVIDADVVAGKKEPIRVIGEAKKEEAA
>CP022600.1|AUX70622.1|3165520_3165886_+|hypothetical-protein
MRKGDHNYALARTQRKAPSLPEGLLWRELRGKAGGVKFRRQHPVGRYVLDFYCAAAKCGFEIDGIVHEMRDRPMRDAARDEFLTQQGIQVDRIPARAVLDDPVGVAEGMVRMCRAIIEGER
>CP022600.1|AUX70621.1|3164771_3165326_+|beta-Ig-H3/fasciclin
MTPKTTLTAVIAAALAGTTGLVAVPALADNHMEAKAAPNIVETAVSTGTHNTLVAAVQAAGLVDTLASPGPFTIFAPTDAAFAKLPAGTVETLVKPENKGTLTAILTYHAVAGKVTAGDLIKLINANGGKATITTVQGGTLTAMLDGGKVVITDAKGGKTTVTQADVMTSNGVIHVTDGVFLPA
>CP022600.1|AUX70620.1|3163833_3164619_+|hypothetical-protein
MSGPDQTPENDVTRDDPMIAAEWALGLLEGEELLAARGKYATDPAFAWRKAWWDNWFAPWTDEMAGAAEPGEHVWDSIAARLAEQQAATSGEVDGNAPAANVVALQARVRRWQWVAGLSSLAAAVAFALFLSSPLGSPVAPPAQIAAATQPMVATVPIGETGLRLDVTYIPESEQMLVAAIGLTADGVHDHELWLVPADGTPLQSLGVVEPGAVRSMILPDTVTAKLGDGAALVLTREPIGGKPDGQDAGPVVAKGAFTRV
>CP022600.1|AUX71044.1|3163249_3163837_+|RNA-polymerase-subunit-sigma
MAARPRPTPDEAREALRDAMARLAAGDQSALEEIYRATRVKLFGITLRILGDRKEAEDALQDVYVNLWQRADRYDPTRASPIAWLAAFARNRAIDRLRTGKVRAGAVGIEEAAPLPDESPLADALLVDAEQAAQIHKCIAGLDERTQTHIRAAFFDGYTYAQLAEQADVPLGTMKSWIRRGLQRLRACLEASEQS
>CP022600.1|AUX70619.1|3162314_3163250_+|cation-transporter
MHAHAHHHHHGHDHHGHAHGHHHHAPADFGNAFLIGIGLNAGFVIVEAAAGFHFGSMALVADAGHNLSDVLALVLAWGASIAAKRPPQGRFTYGYKSSTILAALANALLLAVAIGAILFETLHRMMALAEPQPTAMMIVAGIGIGINALTAMLFLKGQSDINIRGAYLHMVADALVSLGVVVAGAAILLSGLWWIDPLVSLVIVAVIAWGTWGLARDSLMMGLLATPPGIDLAEVRAHLASFDGVSAVHDLHIWPMSTTETALTAHLVMPDRLAPDSFLRDVAASLEERFGVGHATLQIESGENPCGKGCS
>CP022600.1|AUX70618.1|3161638_3162307_+|monofunctional-biosynthetic-peptidoglycan-transglycosylase
MSSIIRILAKVFGAFVGLTLVLVVLFRFVPIPVTATMLMDENGITKDWESLDNIDRNLVSAVIAAEDSRFCEHFGFDAEAIEQAMRENLEGGRVRGGSTISQQTAKNVFLWQGGGYFRKGLEAWFTFWIEAVWGKRRIMEVYLNVAETGIGTYGAEAGAQRYFGHSAARLSADEASRMAAALPSPKKRSVKNPGGWLLRHGNRIEQRIGIVRRDALDACVYN
>CP022600.1|AUX70628.1|3172489_3172798_+|hypothetical-protein
MSEETPDIVPATAGADVPPDHLSVNPRSPFFDAEKLQRGVGIRFKDRVRTDIEEYSISEGWVRVQAGKAVDRKGQPLTIKLTGPVEAWYEDLGENPPVAKKG
>CP022600.1|AUX70629.1|3172861_3174274_+|ribosome-biogenesis-GTPase-Der
MSLPKKPEVVIIGRPNVGKSTLFNRLVGKKLALVDDQPGVTRDRRMGDAVIAGLKFTIVDTAGWEDEDELSLPGRMRKQTEASLAGADAALFVIDARAGLTPLDEEIARYLREQEVPVVVVANKAEGAAGESGAMEAYALGLGEPLAMSAEHGEGIADLFGGLWPIIGAKSEEWEEAQDIARAEAEAMDEDDRPLGPLKLAIVGRPNAGKSTLINRLLGEDRLLTGPEAGITRDSIAIDWEWTDPKTGETREIRLIDTAGMRKKKNVTEKLEKLSVADARRAVDFAEVVVLLLDATQGLEHQDLKIASLVLEEGRALMIAINKWDVAEDASKLFNGIRAALDDGLAQVRGLPLFAVSAKTGKGLDQMLGAAFELREAWSKRVPTSALNRWFDDALEANPPPAPGGKRIKLRYITQAGTRPPRFVIFGSRLDLLPKSYERYLVNGIRAKLGFDAVPVRVTLKTNKNPYAKE
>CP022600.1|AUX70630.1|3174280_3174763_+|GTP-binding-protein
MLLDLIASGTHTPFVFEIFERTASTPRVQQVVQLSLAPAFLLSGIGAIMNVIMSRMIWIAQRVEKIEDKLEEERSPKQVRELGWLMRRRKLMQGAILFSTAAAVMISAVIMLLFISAYITAQIGTVIAALWVLTMALLVTGLVFFLLETRLAAIGAVEKP
>CP022600.1|AUX70631.1|3174930_3175413_-|bacterioferritin
MKGDPKVIDYLNQCLTNELTAINQYWLHYRVLDNWGMKKLAAYERHESIEEMEHADKLAERILFLEALPNFQAIHKLKVGETVEEVLKADLALEHEAIPLLKDAAEYARSVKDHTSAALFEDILKNEEEHVDFLETQFEMIERMGLHNYCQLQSQAAGEG
>CP022600.1|AUX70632.1|3175553_3175754_-|ferredoxin
MYICICNAIRETDLRKAALTCDGDAEATYACLGKRPNCGQCLDEAQEIIEQERVAAACNLFAVEVA
>CP022600.1|AUX70633.1|3175967_3177272_-|hypothetical-protein
MNATSIPQSADDVLNETGSAAVAVAPVSTGERIDTLDFIRGIAVMGILAANIIAFGQPFEAYMYPAAFKGDPGDPGGWMWIAQFILIDGKMRGLFTLLFGAGMYLFMEKAWARGASRGLQAWRLVILMCFGMVHFFFIWPGDILFYYALFGFVALACMKWSVKTQLWVGLGGYMLGALLLAFTIFPWLIVDTSFGEASPELLEQRAGMIAEIDNTLARGDIPNAAIAAGDYGTLVTHRITEQWYEPLTNAMLFGFETLPLMLVGMALYRMGFFNGGFAREKLLRWGWIGVIAGALAHLAIGLAVQSTGFSYYGTLAGFVGMSPLPRLWMALGLAALLVAYAPGATGWVGDRVRAAGRAAFTNYLGTSVVMMLVFHGWALGLFGQLNRPQLYIVVALACVLMLAWSKPWLDRYRYGPLEWLWRCLTYRTVFPLKK
>CP022600.1|AUX70634.1|3177356_3178382_-|sporulation-protein
MARIMLTKKTATATALALLAAGPVLADVKAGVDAWSAGDYARAVVEWQGPASAGDPDALFNLAQAYRLGRGVEIDNVRARQLYEQAASLGHVKAADNYGLMLFQEGEQERAMPMIRAAADRGDPRAQYVLGLSHFNADYAPRDWVRAYALMTLANGAGLPQARDALMQMDRYVPQAQRVQAQGVAREIEAGAKSQRAAELAAAELGSRPAVVPAVAAAPAPVAAPLAVPVVTARVQPAPATVAAAPVVAAPAAVPASTAAPAPRQGRWRVQLGAFGVAGNADRLWSQIGSHSALAGTKKTLVPSGKVTRLLATGFASEAEAGRACAALKRDGKDCVVAGQG
>CP022600.1|AUX70635.1|3178639_3179362_+|chromosome-partitioning-protein-ParA
MRVLALASQKGGSGKTTLSGHLAVQAQRAGAGPVVLIDIDPQGSLADWWNEREAEYPAFAQTTVARLANDLAVLRQQGFKLAVIDTPPAITMAIQSVISVAELIVVPTRPSPHDLRAVGATVDLCERAGKPLVFVVNAATPKAKITSEAAVALSQHGTVAPITLHHRTDFAASMIDGRTVMEVDPESRSAAEIAALWRYIADRLEKNFRRTVFAPAPNGVGQPMGGVPRPAGGFGRRVAQ
>CP022600.1|AUX70636.1|3179383_3180109_+|hypothetical-protein
MSDPGFASLGPTLLARKGGAKPAMRPQVAPLVIDETTPIAEDQLEDLGWNDMGHDDAGDAGFADGADIVPISADIAADQIAAGAGPIVRRQQRRLEERVLADAVMTGPEDSEPEYDADDEELYGVDYAGGYDVADEDDVEEAFEASDESEDDAAVTGFTPLAPVQAPAPSPVRTKAPRVPAVQAGRRAAFTLRLDADRHLKLRLAATMQGVSAQALVTEALDRLLAEYGELDVIASHLKRH
>CP022600.1|AUX70637.1|3180165_3181536_+|hypothetical-protein
MNMDRSTKTGFTAPRLALAVTTAVAAFALSGCTTAAAPRADLSFSNAQTALAKGQVDKAIAHAEAAVLAEPRNPGFRALLGAAYMEAGRFQSAATSFNDALDLGDENPRTVLSFALAKTAMGDSGAAVAVLDEYARVIDPADLGLALALAGQPERGVHVLINAVRASEEASPKLRQNLAYTYALAGNWRAARVMAAEDVPADQLDARITEWAAMTAPEMYQQRIASLLNVTPRADSGQPQRLALANFPAQEVMVAEAAAQAPVEVAAAEPMSAVAPAPARAAEPASFAQAFAASEPSISTAQAAPAPAAASGVRFVSNPVVQQLPASSERAAPRMAASTQRRMAAAAAPAPVASDKSANTHLVQLGSYDSKLEAERGWAVLKGKFPALKDHDVVITEAVVNGRTFWRVAAAGFGAMSAKSMCSTVKSAGRGCFAYAASSPPAGAVDRGIRMASRTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP022600_1	1.1\|70132\|18\|CP022600\|CRT	70132-70149	18	CP022600.1	83229-83246	2	0.889
CP022600_1	1.4\|70288\|18\|CP022600\|CRT	70288-70305	18	CP022600.1	83229-83246	2	0.889
CP022600_1	1.4\|70288\|18\|CP022600\|CRT	70288-70305	18	CP022600.1	2802247-2802264	2	0.889
CP022600_1	1.4\|70288\|18\|CP022600\|CRT	70288-70305	18	CP022600.1	2912410-2912427	2	0.889

1. spacer 1.1|70132|18|CP022600|CRT matches to position: 83229-83246, mismatch: 2, identity: 0.889

ccatcattgccattaccg	CRISPR spacer
ccaccattgccgttaccg	Protospacer
***.*******.******

2. spacer 1.4|70288|18|CP022600|CRT matches to position: 83229-83246, mismatch: 2, identity: 0.889

ccgccgttgccgttaccg	CRISPR spacer
ccaccattgccgttaccg	Protospacer
**.**.************

3. spacer 1.4|70288|18|CP022600|CRT matches to position: 2802247-2802264, mismatch: 2, identity: 0.889

ccgccgttgccgttaccg	CRISPR spacer
ccggcgttaccgttaccg	Protospacer
*** ****.*********

4. spacer 1.4|70288|18|CP022600|CRT matches to position: 2912410-2912427, mismatch: 2, identity: 0.889

ccgccgttgccgttaccg	CRISPR spacer
ccgcctttgccgtgaccg	Protospacer
***** ******* ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	MT028491	Ochrobactrum phage vB_OspM_OC, complete genome	5631-5660	7	0.767
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	MT028491	Ochrobactrum phage vB_OspM_OC, complete genome	5667-5696	7	0.767
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	AP013479	Uncultured Mediterranean phage uvMED DNA, complete genome, group G18, isolate: uvMED-CGR-U-MedDCM-OCT-S35-C8	21909-21938	7	0.767
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	276507-276542	7	0.806
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	MF417967	Uncultured Caudovirales phage clone 3S_16, partial genome	6611-6640	8	0.733
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	MN694812	Marine virus AFVG_250M735, complete genome	9093-9122	8	0.733
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	MN694812	Marine virus AFVG_250M735, complete genome	9105-9134	8	0.733
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	NC_006936	Lactobacillus phage phiJL-1, complete genome	12285-12314	8	0.733
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	12285-12314	8	0.733
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	380465-380500	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	87124-87159	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP017185	Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence	62747-62782	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	CP027480	Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence	42057-42092	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	MN175388	Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence	43165-43200	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	398-433	8	0.778
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_MF190369	Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence	26186-26221	8	0.778
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	620632-620661	9	0.7
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	114172-114207	9	0.75
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_AP019635	Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence	45097-45132	9	0.75
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	225022-225057	9	0.75
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1919958-1919993	9	0.75
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1919958-1919993	9	0.75
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_LR594663	Variovorax sp. RA8 plasmid 2	247210-247245	9	0.75
CP022600_1	1.3\|70240\|30\|CP022600\|CRT	70240-70269	30	NZ_CP028515	Carboxydocella thermautotrophica strain 041T plasmid pCCELLA01, complete sequence	25210-25239	10	0.667
CP022600_1	1.5\|70324\|36\|CP022600\|CRT	70324-70359	36	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	308422-308457	10	0.722

1. spacer 1.3|70240|30|CP022600|CRT matches to MT028491 (Ochrobactrum phage vB_OspM_OC, complete genome) position: , mismatch: 7, identity: 0.767

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
tttccgttaccgttgccgttaccattattg	Protospacer
..*.*******************.** ..*

2. spacer 1.3|70240|30|CP022600|CRT matches to MT028491 (Ochrobactrum phage vB_OspM_OC, complete genome) position: , mismatch: 7, identity: 0.767

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
tttccgttaccgttgccgttaccattattg	Protospacer
..*.*******************.** ..*

3. spacer 1.3|70240|30|CP022600|CRT matches to AP013479 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G18, isolate: uvMED-CGR-U-MedDCM-OCT-S35-C8) position: , mismatch: 7, identity: 0.767

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
cttttcttaccgttaccgttaccgtttttc	Protospacer
*.**. ********.************..

4. spacer 1.5|70324|36|CP022600|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 7, identity: 0.806

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
gcgtcgttgccgctgccgttcccgcagccggcgacg	Protospacer
 ***********************. **** .  **

5. spacer 1.3|70240|30|CP022600|CRT matches to MF417967 (Uncultured Caudovirales phage clone 3S_16, partial genome) position: , mismatch: 8, identity: 0.733

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ctcaggttaccgttaccgttaccttttctc	Protospacer
*..  *********.******** ****.

6. spacer 1.3|70240|30|CP022600|CRT matches to MN694812 (Marine virus AFVG_250M735, complete genome) position: , mismatch: 8, identity: 0.733

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ttgccattaccgttgccattaccgttgcca	Protospacer
.. .*.***********.******** **.

7. spacer 1.3|70240|30|CP022600|CRT matches to MN694812 (Marine virus AFVG_250M735, complete genome) position: , mismatch: 8, identity: 0.733

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ttcccattaccgttgccattaccgttgcca	Protospacer
....*.***********.******** **.

8. spacer 1.3|70240|30|CP022600|CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 8, identity: 0.733

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ttactgctaccgttgccgttactgttaccg	Protospacer
.. ..*.***************.*** ***

9. spacer 1.3|70240|30|CP022600|CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 8, identity: 0.733

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ttactgctaccgttgccgttactgttaccg	Protospacer
.. ..*.***************.*** ***

10. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttgctc	Protospacer
..*.********.******* *********** *.

11. spacer 1.5|70324|36|CP022600|CRT matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttagca	Protospacer
..*.********.******* ***********  *.

12. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP017185 (Enterobacter roggenkampii strain DSM 16690 plasmid pDSMZ16690, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttggtg	Protospacer
..*.********.******* ***********  .*

13. spacer 1.5|70324|36|CP022600|CRT matches to CP027480 (Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgtcgcca	Protospacer
..*.********.******* **********. **.

14. spacer 1.5|70324|36|CP022600|CRT matches to MN175388 (Cronobacter sp. strain CR-13-12 plasmid pCR-13-12-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttagca	Protospacer
..*.********.******* ***********  *.

15. spacer 1.5|70324|36|CP022600|CRT matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttagca	Protospacer
..*.********.******* ***********  *.

16. spacer 1.5|70324|36|CP022600|CRT matches to NZ_MF190369 (Enterobacter cloacae strain A1137 plasmid pA1137, complete sequence) position: , mismatch: 8, identity: 0.778

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgttagca	Protospacer
..*.********.******* ***********  *.

17. spacer 1.3|70240|30|CP022600|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.7

ccttcgttaccgttgccgttaccgtttccg	CRISPR spacer
ttcaggttgccgttgccgttaccgttcagg	Protospacer
...  ***.*****************.  *

18. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg------	CRISPR spacer
------ttgccgttgccgttgccgttgccgttgccgcggtct	Protospacer
      ******.******* *********** ***

19. spacer 1.5|70324|36|CP022600|CRT matches to NZ_AP019635 (Enterobacter sp. 18A13 plasmid pECC18A13-1, complete sequence) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttgccgttgccgttgccgttgccgttgccgctggca	Protospacer
..*.********.******* *********.*  *.

20. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
aggccgttgccgttgccgttgccgttgccgatatgg	Protospacer
  *.********.******* ********* * . *

21. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
aggccgttgccgttgccgttgccgttgccgatatgg	Protospacer
  *.********.******* ********* * . *

22. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
aggccgttgccgttgccgttgccgttgccgatatgg	Protospacer
  *.********.******* ********* * . *

23. spacer 1.5|70324|36|CP022600|CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 9, identity: 0.75

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
tggccgttgccgttgccgttgccgttgccggtgttg	Protospacer
. *.********.******* ********* * ..*

24. spacer 1.3|70240|30|CP022600|CRT matches to NZ_CP028515 (Carboxydocella thermautotrophica strain 041T plasmid pCCELLA01, complete sequence) position: , mismatch: 10, identity: 0.667

ccttcgttaccgttgccgttaccgtttccg------	CRISPR spacer
------ttgccgttaccattgccgtttccgtttttc	Protospacer
      **.*****.**.**.*********

25. spacer 1.5|70324|36|CP022600|CRT matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

ccgtcgttgccgctgccgttcccgttgccgttcccg	CRISPR spacer
ttcaggttgccgttgccgttcccattgccgtttagg	Protospacer
..   *******.**********.********.  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

282967 : 292593

Dinoroseobacter_phage(16.67%)

tail,portal,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUX70735.1\|282967_284287_+	ATP-binding protein	A0A1V0DY66	Dinoroseobacter_phage	5.0e-74	40.5
AUX68350.1\|284301_285456_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	8.6e-46	34.8
AUX68351.1\|285455_285761_+	hypothetical protein	NA	NA	NA	NA
AUX70737.1\|285685_286177_+	peptidase U35	A0A2H4JAI0	uncultured_Caudovirales_phage	1.7e-14	39.4
AUX68352.1\|286354_287515_+\|capsid	phage major capsid protein	Q8W627	Enterobacteria_phage	1.2e-79	45.9
AUX68353.1\|287601_288198_+	hypothetical protein	NA	NA	NA	NA
AUX68354.1\|288363_288759_+	DUF3168 domain-containing protein	NA	NA	NA	NA
AUX68355.1\|288763_289171_+\|tail	phage tail protein	NA	NA	NA	NA
AUX68356.1\|289167_289482_+	hypothetical protein	NA	NA	NA	NA
AUX68357.1\|289478_289679_+	hypothetical protein	NA	NA	NA	NA
AUX68358.1\|289671_290256_+\|tail	tail tape measure protein	D6PEW0	uncultured_phage	2.8e-05	27.8
AUX68359.1\|290271_292593_+	TIGR02217 family protein	A0A0K1LLZ8	Rhodobacter_phage	8.9e-34	41.1

DBSCAN-SWA_2

339653 : 406982

Pseudomonas_phage(18.18%)

transposase,protease,tRNA,integrase

attL 375016:375064|attR 408323:408371

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUX68396.1\|339653_340916_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AUX68397.1\|341023_342091_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	5.2e-05	35.4
AUX68398.1\|342182_343004_+	protein-(glutamine-N5) methyltransferase, release factor-specific	NA	NA	NA	NA
AUX68399.1\|343266_343977_+	hypothetical protein	NA	NA	NA	NA
AUX68400.1\|343982_345590_+	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AUX68401.1\|345689_346913_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.8e-95	48.2
AUX68402.1\|346937_347360_-	hypothetical protein	NA	NA	NA	NA
AUX68403.1\|347410_347809_-	hypothetical protein	NA	NA	NA	NA
AUX68404.1\|347896_348433_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AUX68405.1\|348510_349665_-	CoA transferase	NA	NA	NA	NA
AUX68406.1\|349669_350554_-	alpha/beta hydrolase	NA	NA	NA	NA
AUX68407.1\|350553_351204_-	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AUX68408.1\|351209_351836_-	hypothetical protein	NA	NA	NA	NA
AUX68409.1\|352303_353026_-	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AUX68410.1\|353530_355837_+	AAA family ATPase	E5ESM9	Bathycoccus_sp._RCC1105_virus	7.7e-46	42.3
AUX68411.1\|355973_358811_-	DNA polymerase I	A0A1B1IST8	uncultured_Mediterranean_phage	2.5e-46	28.1
AUX68412.1\|359062_359329_+	hypothetical protein	NA	NA	NA	NA
AUX68413.1\|359430_360477_-	serine hydrolase	NA	NA	NA	NA
AUX68414.1\|360737_363038_+	DUF305 domain-containing protein	NA	NA	NA	NA
AUX68415.1\|363110_363722_-\|protease	ATP-dependent protease	NA	NA	NA	NA
AUX68416.1\|363718_364657_-	co-chaperone YbbN	A0A1X9I9P5	Staphylococcus_phage	1.2e-10	35.3
AUX68417.1\|365143_367336_+	TonB-dependent receptor	NA	NA	NA	NA
AUX68418.1\|367432_368608_-	saccharopine dehydrogenase	NA	NA	NA	NA
AUX68419.1\|368885_369440_-	dCTP deaminase	S5VM63	Pseudomonas_phage	6.8e-65	66.1
AUX68420.1\|369513_370371_-	sterol desaturase	NA	NA	NA	NA
AUX68421.1\|370528_370948_-	hypothetical protein	NA	NA	NA	NA
AUX68422.1\|370947_371181_-	dihydrolipoamide acyltransferase	NA	NA	NA	NA
AUX68423.1\|372171_373140_-	pyruvate dehydrogenase	NA	NA	NA	NA
AUX68424.1\|373236_374001_-	3-ketoacyl-ACP reductase	NA	NA	NA	NA
AUX68425.1\|374442_374880_-	hypothetical protein	NA	NA	NA	NA
375016:375064	attL	NA	NA	NA	NA
AUX68426.1\|375204_376371_+\|integrase	integrase	NA	NA	NA	NA
AUX70746.1\|376728_377895_+\|integrase	integrase	A0A220NQQ9	Corynebacterium_phage	5.5e-08	30.2
AUX68427.1\|377885_380018_+\|integrase	integrase	NA	NA	NA	NA
AUX68428.1\|380014_380494_+	hypothetical protein	NA	NA	NA	NA
AUX70747.1\|380679_381396_-	glutaredoxin	NA	NA	NA	NA
AUX68429.1\|381505_381892_+	MerR family transcriptional regulator	NA	NA	NA	NA
AUX68430.1\|381936_382863_-	hypothetical protein	NA	NA	NA	NA
AUX68431.1\|382867_383257_-	hypothetical protein	NA	NA	NA	NA
AUX70748.1\|383279_384131_-	copper resistance protein CopB	NA	NA	NA	NA
AUX68432.1\|384355_386098_-	copper-binding protein	NA	NA	NA	NA
AUX70749.1\|386121_386670_-	RNA polymerase subunit sigma-24	NA	NA	NA	NA
AUX68433.1\|386702_387143_-	heavy metal resistance protein	NA	NA	NA	NA
AUX68434.1\|387139_387418_-	hypothetical protein	NA	NA	NA	NA
AUX68435.1\|387660_387993_+	hypothetical protein	NA	NA	NA	NA
AUX68436.1\|388817_390092_+	transporter	NA	NA	NA	NA
AUX68437.1\|390094_391246_+	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AUX68438.1\|394691_394988_+	hypothetical protein	NA	NA	NA	NA
AUX68439.1\|395136_395748_+	RND transporter	NA	NA	NA	NA
AUX68440.1\|395740_398224_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.1e-120	40.6
AUX68441.1\|398267_398615_-	DUF3703 domain-containing protein	NA	NA	NA	NA
AUX68442.1\|398685_399108_+	transcriptional regulator	NA	NA	NA	NA
AUX68443.1\|399167_400472_-	hypothetical protein	NA	NA	NA	NA
AUX68444.1\|400497_403467_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	7.0e-209	39.9
AUX68445.1\|403558_404935_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	6.9e-42	28.7
AUX68446.1\|405014_405344_-	heavy metal transporter	NA	NA	NA	NA
AUX68447.1\|405356_405752_-	mercury transporter MerT	NA	NA	NA	NA
AUX68448.1\|405828_406251_+	transcriptional regulator	NA	NA	NA	NA
AUX68449.1\|406421_406982_+\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	4.6e-45	79.3
408323:408371	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022600

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection