CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP014131	Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed2, complete sequence	1 crisprs	NA	1	0
CP014132	Staphylococcus epidermidis strain FDAARGOS_161 chromosome, complete genome	0 crisprs	csa3,DinG,cas3,DEDDh,WYL	0	185
CP014130	Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed1, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP014131_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP014131_1

4609-4721

Orphan

Consensus_repeat	Method
AGGGACGTTTTTAAAATTATGTCACTTATAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP014131_1

>merge|CP014131|1|4609-4721|CRISPRCasFinder
AGGGACGTTTTTAAAATTATGTCACTTATATGCTTTATCCTCTATATAATAGGTGTTATAATTCGTTTGATCATTATTATAGAGGGACGTTTTTAAAATTATGTCACTTATAT

>CP014131|1|1|4609-4721|CRISPRCasFinder
AGGGACGTTTTTAAAATTATGTCACTTATAT	GCTTTATCCTCTATATAATAGGTGTTATAATTCGTTTGATCATTATTATAG
AGGGACGTTTTTAAAATTATGTCACTTATAT

Protein	Function_ID	Function_description	E-value
CP014131.1\|AVG08178.1\|560_1940_+\|MFS-transporter	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.64833e-53
CP014131.1\|AVG08184.1\|6849_7773_-\|aspartate-carbamoyltransferase	gnl\|CDD\|234849	PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit.	1.39616e-71
CP014131.1\|AVG08180.1\|2848_4057_+\|recombinase	gnl\|CDD\|366451	pfam01076, Mob_Pre, Plasmid recombination enzyme. With some plasmids, recombination can occur in a site specific manner that is independent of RecA. In such cases, the recombination event requires another protein called Pre. Pre is a plasmid recombination enzyme. This protein is also known as Mob (conjugative mobilisation).	4.67844e-30
CP014131.1\|AVG08182.1\|5645_6257_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	6.30073e-09
CP014131.1\|AVG08181.1\|4740_5598_+\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|227814	COG5527, COG5527, Protein involved in initiation of plasmid replication [DNA replication, recombination, and repair].	9.35015e-79
CP014131.1\|AVG08185.1\|7765_8656_-\|molybdopterin-biosynthesis-protein-MoeB	gnl\|CDD\|181302	PRK08223, PRK08223, hypothetical protein; Validated.	1.78336e-40

>CP014131.1|AVG08180.1|2848_4057_+|recombinase
MKLAWNTQKNKMSDVKGKEMEQERKGRIKNDEIDLKRTNLNFDLVEDERHLYHRVKDRVDYYKEQGSRVQKNSVVMYSNIITLSKEEADRMGETRTKHYFKTCKDYFSERFGEANVVSAKVHMDESAPHMHLHFIPVNHQGRLSARTAMNRQAINHIHDELTTHLCQQGFDVERGSTDDNKTYIQDIHEYKKKAKVLSELDQQIETKKQLLRDINDLHDEKENLTRDIQNLKRKNHFLQEDSQQAQEDIDLYKQLRTISRDDFRKDEEKYQKEIKAYEASLSGLRMNYRDLDKRNQHLTTQNNQLEHHLDMLNARHQAMNDMVRNDTRILFAGLRCALKDRNIELSAEIKYQRMPEVGIDPDTVDQGALTHAYQGDVSGIDHHIRKPSAPIKKETENDLELE
>CP014131.1|AVG08179.1|1974_2394_-|hypothetical-protein
MPKKQNSKEKILTIRVSQSQYEKICALADIREMNVTEYIRHTAIGNRIKPTVIEQIKESSEVSELFKKDNEALKSNNQALQRHIHQLEDEIDQLRQENDVFHHLLQHFDSTAFLNFNTYRDDRPLKNAIKRLKEQYNSK
>CP014131.1|AVG08178.1|560_1940_+|MFS-transporter
MNSSKYFDHLVVFTAGIGMFLSTLDSGIINVALPTLSKSFNVDASFISWSITLYTLLLTGTIIIFGRLSDKYNRLNIYSIGLTVFLISSILCGFSNNVVELITFRGLQGIGAAMLQGTATAIITTTIPEHRQGPALGTLSILLGIGPVLGPSIGGLLISIGNWRWIFWINIPFIFIGLIGCLLLKKYIKEPKSVSIHLDIRGNSLLFVSIFCLLVSLTSWSHHSFFNISVYSNFLIFIVTFCLFIVWELKTNHPIINLRLFKNISFSSSIFAIFVFGGTTSLGFIIPPYILEKINHLSSWQIGLVNLTSPLGLVLISKITGKLISRVGNTILMTVGLVIMIASYTSLGLLQYILNPITISLLLLIYGIGGGFFLPSNTSAIMGTVSKDMQGTVGATQRMVQNIGIAVYTAITSLFISNQSQTNQLITGASHAWLFASATLFLSLLPFLLKLLHHKSEAT
>CP014131.1|AVG08181.1|4740_5598_+|RepB-family-plasmid-replication-initiator-protein
MSGETVVYRNEMNLVPLRRFTSTEVDLFFTLCNKLKEQDTRKVIIPFEELKYLSNYYTRSQERFINDLEHVYDKMLNLTYVERNGRSFEKFVLFTSYKVDLDEECLSISVNPDLKHILNSITADFTKFELKEMTHLKSTYAKNMFRLLKQYKHTGYIKINISDFKNRLDIPKTYQMNDITKRVLKPIINELSSIFNNLNINKIKAKKGRKIEWLEFTFDAEKRIHNKRQPQMTNVGKQRQYISREKTPRWLEERTYEKNLKSEYDPQLEKERKAFLKQLQLDWED
>CP014131.1|AVG08182.1|5645_6257_-|helix-turn-helix-domain-containing-protein
MSMNKSKVAEIRKQKSLTQENLAEKAYVTVRTIQRMEAGEEVSSETLKSVSNALDVTVNELFESISSSDKEEEIMEISKEQQKQFNYRKNELFTIKLITFSFIFVFLGLFGIFVGELEGLEQNIYRIIWIFALFLSLAIMYYFLNVFISKKLDKKYPMTIGMKNRNRKNEPVKNGWDFMARYWWIVFPIGGFLSWLIPELTGK
>CP014131.1|AVG08183.1|6313_6511_+|hypothetical-protein
MKRQLLQNYILKRKYISNFTKSIRKDILKVTNSRYIIVCENPQRAGWGFLFTYVLVVIDKEHNQQ
>CP014131.1|AVG08184.1|6849_7773_-|aspartate-carbamoyltransferase
MINNLLSMENLNLNDVNSLFEKADYYEKALKDKKVIKDLEGKILATLFYQPSTRTRMSFTSAMYRLGGQVIDMGGPKVARTDDYFDESMSDTIKYIEQYSDIMVMRHFQNYTVEKASKITHIPMINAGDGTNEHPTQALLDLYTMTKELNGLEDKVIGIGGDINCRVIRSIVIGLEKFDIKKIIFLLPNGEELNSDILNLLKNTDYSIVHNVERVLEQADILDIIPFELPDFNSAYSEKVDEKPSLENNLIVSKEKFNDKNRIPILSPGPREAELSSDTDDMDNVIFTKQAYNGLLIRMSLLYYFLH
>CP014131.1|AVG08185.1|7765_8656_-|molybdopterin-biosynthesis-protein-MoeB
MNSKVIKYTADFNEKRYWERIKRNLGWLGDTDEEAKKRQKKISEVVIGIAGCGGIGGAVAERLVRLGVRHIKVADPDHFELSNINRQFGASLDNLGRNKAEVVGESIFNISKDVNVDVYPEGINNSTADDFVEGCDYVLDKIELFELEARYALHKAFKKSERCKFMLTVPVFGHRAFFFKWTKDSMSAEDYFGIKPGSELDEQNTRKIVYSLFPEYPQFPSKERLDDWLIYNKECPIFAGCPPLAQGLLVERLSFEIADLKDIPEYKELPSTPSYSMFDSASWETKIVEREENIID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP014131_1	1.1\|4640\|51\|CP014131\|CRISPRCasFinder	4640-4690	51	NZ_CP023971	Staphylococcus lugdunensis strain FDAARGOS_381 plasmid unnamed1, complete sequence	6757-6807	0	1.0
CP014131_1	1.1\|4640\|51\|CP014131\|CRISPRCasFinder	4640-4690	51	NZ_CP014131	Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed2, complete sequence	4640-4690	0	1.0
CP014131_1	1.1\|4640\|51\|CP014131\|CRISPRCasFinder	4640-4690	51	NZ_CP053958	Staphylococcus capitis strain FDAARGOS_753 plasmid unnamed1	460-510	3	0.941
CP014131_1	1.1\|4640\|51\|CP014131\|CRISPRCasFinder	4640-4690	51	NZ_CP053958	Staphylococcus capitis strain FDAARGOS_753 plasmid unnamed1	14579-14629	3	0.941

1. spacer 1.1|4640|51|CP014131|CRISPRCasFinder matches to NZ_CP023971 (Staphylococcus lugdunensis strain FDAARGOS_381 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gctttatcctctatataataggtgttataattcgtttgatcattattatag	CRISPR spacer
gctttatcctctatataataggtgttataattcgtttgatcattattatag	Protospacer
***************************************************

2. spacer 1.1|4640|51|CP014131|CRISPRCasFinder matches to NZ_CP014131 (Staphylococcus epidermidis strain FDAARGOS_161 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gctttatcctctatataataggtgttataattcgtttgatcattattatag	CRISPR spacer
gctttatcctctatataataggtgttataattcgtttgatcattattatag	Protospacer
***************************************************

3. spacer 1.1|4640|51|CP014131|CRISPRCasFinder matches to NZ_CP053958 (Staphylococcus capitis strain FDAARGOS_753 plasmid unnamed1) position: , mismatch: 3, identity: 0.941

gctttatcctctatataataggtgttataattcgtttgatcattattatag	CRISPR spacer
tctttattctctatataataggtgttataattcgtttaatcattattatag	Protospacer
 ******.*****************************.*************

4. spacer 1.1|4640|51|CP014131|CRISPRCasFinder matches to NZ_CP053958 (Staphylococcus capitis strain FDAARGOS_753 plasmid unnamed1) position: , mismatch: 3, identity: 0.941

gctttatcctctatataataggtgttataattcgtttgatcattattatag	CRISPR spacer
tctttattctctatataataggtgttataattcgtttaatcattattatag	Protospacer
 ******.*****************************.*************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8513

Paramecium_bursaria_Chlorella_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08187.1\|1362_1569_+	copper resistance protein CopZ	NA	NA	NA	NA
AVG08188.1\|1622_2621_-	lactate dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	6.3e-37	32.1
AVG08189.1\|2633_3809_-	N-succinyldiaminopimelate aminotransferase	NA	NA	NA	NA
AVG08190.1\|3938_4079_+	hypothetical protein	NA	NA	NA	NA
AVG08191.1\|4120_4894_-	CHAP domain-containing protein	NA	NA	NA	NA
AVG08192.1\|5492_7301_-	acyltransferase	B5WZU0	Pseudomonas_phage	1.1e-34	30.1
AVG08193.1\|7805_8513_-	transglycosylase IsaA	Q4Z8Z7	Staphylococcus_phage	2.1e-31	41.1

DBSCAN-SWA_2

16408 : 20893

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08201.1\|16408_17608_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG08202.1\|18276_18993_-	DNA integration/recombination/inversion protein	NA	NA	NA	NA
AVG08203.1\|19198_20893_-\|transposase	IS1182-like element ISSep1 family transposase	A0ZS58	Staphylococcus_virus	1.1e-243	77.6

DBSCAN-SWA_3

25178 : 25997

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08208.1\|25178_25997_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	M4QNT1	Ostreococcus_lucimarinus_virus	2.1e-38	36.0

DBSCAN-SWA_4

34672 : 36010

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08215.1\|34672_36010_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-20	24.4

DBSCAN-SWA_5

41065 : 41956

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08221.1\|41065_41956_+	class I fructose-bisphosphate aldolase	A0A0K0KVJ8	Prochlorococcus_phage	7.2e-08	29.2

DBSCAN-SWA_6

45932 : 111840

Vibrio_phage(11.76%)

protease,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08225.1\|45932_48560_-	pyruvate, phosphate dikinase	A0A2I7RQW7	Vibrio_phage	7.1e-88	40.5
AVG08226.1\|48922_50503_-	acyl--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.2e-75	36.0
AVG08227.1\|50820_51267_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVG08228.1\|51294_51513_-	hypothetical protein	NA	NA	NA	NA
AVG08229.1\|51957_53133_-	amidohydrolase	NA	NA	NA	NA
AVG08230.1\|53449_55168_-\|holin	oxygen-dependent choline dehydrogenase	A0A1V0SI18	Klosneuvirus	4.5e-59	33.1
AVG08231.1\|55327_56818_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
AVG08232.1\|57295_57859_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AVG08233.1\|57908_59531_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	6.0e-21	22.6
AVG08234.1\|59953_61252_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AVG08235.1\|61614_62151_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.3e-36	47.4
AVG08236.1\|62147_63998_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	4.2e-244	65.7
AVG08237.1\|64315_64621_-	hypothetical protein	NA	NA	NA	NA
AVG08238.1\|64973_65573_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	3.9e-26	44.6
AVG08239.1\|65588_66767_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	3.2e-48	31.9
AVG08240.1\|66790_67690_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AVG08241.1\|67710_68322_-	precorrin-2 dehydrogenase	NA	NA	NA	NA
AVG08242.1\|68408_69197_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AVG08243.1\|69209_70928_-	assimilatory sulfite reductase (NADPH) hemoprotein subunit	NA	NA	NA	NA
AVG08244.1\|70947_72792_-	assimilatory sulfite reductase (NADPH) flavoprotein subunit	NA	NA	NA	NA
AVG08245.1\|73090_73822_-	phosphoadenylyl-sulfate reductase	M4W6M9	Bacillus_phage	1.1e-09	23.5
AVG08246.1\|74026_74128_+	hypothetical protein	NA	NA	NA	NA
AVG08247.1\|74137_74614_-	glutathione peroxidase	NA	NA	NA	NA
AVG08248.1\|74626_75961_-	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
AVG08249.1\|75977_76418_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVG08250.1\|76637_77387_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
AVG08251.1\|77392_78718_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AVG08252.1\|78862_79972_-	5,10-methylene-tetrahydrofolate dehydrogenase	NA	NA	NA	NA
AVG08253.1\|79968_81153_-	5,10-methylene-tetrahydrofolate dehydrogenase	NA	NA	NA	NA
AVG08254.1\|81282_82875_-	solute:sodium symporter family transporter	A0A240F3J2	Aeromonas_phage	1.5e-43	28.6
AVG10404.1\|83396_83984_-	DUF4064 domain-containing protein	NA	NA	NA	NA
AVG08255.1\|84090_86103_-	ABC transporter permease	NA	NA	NA	NA
AVG08256.1\|86104_86854_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-30	36.8
AVG10405.1\|86964_87861_-	sensor histidine kinase	NA	NA	NA	NA
AVG08257.1\|87866_88532_-	DNA-binding response regulator	NA	NA	NA	NA
AVG08258.1\|88562_88742_-	hypothetical protein	NA	NA	NA	NA
AVG08259.1\|89039_90509_+	alkaline phosphatase	NA	NA	NA	NA
AVG08260.1\|90631_92176_-	NmrA family protein	NA	NA	NA	NA
AVG10406.1\|92366_94376_-	glycosyl transferase family 1	NA	NA	NA	NA
AVG08261.1\|94896_94998_-	DUF2648 domain-containing protein	NA	NA	NA	NA
AVG08262.1\|95403_96741_-	hypothetical protein	A0A0D3MVF0	Staphylococcus_phage	5.3e-47	46.1
AVG10407.1\|97156_97258_-	hypothetical protein	NA	NA	NA	NA
AVG08263.1\|97535_98735_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4
AVG08264.1\|98831_100511_-\|transposase	IS1182 family transposase ISSep1	A0ZS58	Staphylococcus_virus	1.1e-243	77.6
AVG08265.1\|103848_105531_-\|transposase	IS1182-like element ISSep1 family transposase	A0ZS58	Staphylococcus_virus	8.5e-244	77.6
AVG08266.1\|107353_107965_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.2e-17	36.4
AVG08267.1\|108060_108507_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVG08268.1\|108678_110328_+	pyruvate decarboxylase	NA	NA	NA	NA
AVG08269.1\|110673_111840_-	CapA family protein	A0A2H4JG01	uncultured_Caudovirales_phage	5.7e-106	49.3

DBSCAN-SWA_7

134899 : 136867

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08285.1\|134899_136867_+	CHAP domain-containing protein	A0A0A7RUS8	Clostridium_phage	4.0e-11	36.3

DBSCAN-SWA_8

163327 : 167884

Streptococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08301.1\|163327_164527_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG08302.1\|164609_166304_-\|transposase	IS5/IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.5e-240	77.9
AVG08303.1\|166684_167884_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4

DBSCAN-SWA_9

171368 : 172142

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08307.1\|171368_172142_-	phosphonates import ATP-binding protein PhnC	G9BWD6	Planktothrix_phage	3.5e-27	37.6

DBSCAN-SWA_10

187049 : 187685

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08320.1\|187049_187685_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase	A0A2H4UVM0	Bodo_saltans_virus	3.3e-15	27.9

DBSCAN-SWA_11

203158 : 204751

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10409.1\|203158_204751_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.6e-18	21.4

DBSCAN-SWA_12

208512 : 210917

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08341.1\|208512_209466_-	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	E3SJ83	Synechococcus_phage	2.1e-13	28.7
AVG08342.1\|209507_210917_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.1e-34	28.5

DBSCAN-SWA_13

222234 : 229437

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08352.1\|222234_229437_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	3.5e-153	26.8

DBSCAN-SWA_14

233658 : 234555

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08356.1\|233658_234555_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.7e-07	23.9

DBSCAN-SWA_15

242676 : 243105

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08364.1\|242676_243105_-	FosB family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	8.4e-31	56.0

DBSCAN-SWA_16

250310 : 252130

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08372.1\|250310_250946_-	ABC transporter permease	G3M9Y4	Bacillus_virus	1.9e-07	25.6
AVG08373.1\|250942_252130_-	osmoprotectant	Q6GZ03	Mycoplasma_phage	1.4e-19	32.9

DBSCAN-SWA_17

259596 : 267250

Tetraselmis_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08380.1\|259596_261843_-	formate acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	8.5e-183	44.2
AVG08381.1\|262308_263082_-	ABC transporter permease	NA	NA	NA	NA
AVG08382.1\|263083_263779_-	lantibiotic ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-38	39.7
AVG08383.1\|264490_265681_-	MFS transporter	NA	NA	NA	NA
AVG08384.1\|265692_266442_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-14	26.5
AVG08385.1\|266434_267250_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-09	25.1

DBSCAN-SWA_18

274293 : 280475

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08392.1\|274293_274983_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.5e-25	33.2
AVG08393.1\|275110_275884_-	diacetyl reductase	NA	NA	NA	NA
AVG08394.1\|276052_277429_-	MFS transporter	NA	NA	NA	NA
AVG08395.1\|277457_280475_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	8.7e-199	57.4

DBSCAN-SWA_19

304152 : 305004

Staphylococcus_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08410.1\|304152_305004_-\|protease	serine protease	A0A2H4PQP1	Staphylococcus_phage	6.4e-06	29.3

DBSCAN-SWA_20

312119 : 313658

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08415.1\|312119_313658_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.2e-14	26.6

DBSCAN-SWA_21

318440 : 319208

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08419.1\|318440_319208_-	short-chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-18	32.4

DBSCAN-SWA_22

334909 : 336930

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08436.1\|334909_335224_+	ArsR family transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	6.2e-31	59.6
AVG10415.1\|335226_336516_+	arsenical efflux pump membrane protein ArsB	A0A2H4PQU3	Staphylococcus_phage	4.3e-187	81.6
AVG08437.1\|336534_336930_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	3.2e-61	84.0

DBSCAN-SWA_23

342723 : 344172

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10416.1\|342723_344172_-	hypothetical protein	A0A2H5BHF5	Acinetobacter_phage	4.3e-10	22.1

DBSCAN-SWA_24

348837 : 351637

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08445.1\|348837_350088_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.6e-34	32.1
AVG08446.1\|350080_351637_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.3e-219	74.5

DBSCAN-SWA_25

359935 : 365524

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08457.1\|359935_361063_-	alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	6.9e-16	30.9
AVG08458.1\|361560_362058_+	spermidine acetyltransferase	NA	NA	NA	NA
AVG08459.1\|362368_363529_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.1e-29	31.4
AVG08460.1\|363788_364349_-	hypothetical protein	NA	NA	NA	NA
AVG08461.1\|364551_365226_+\|transposase	IS6-like element IS257 family transposase	A0A0N9RU54	Staphylococcus_phage	2.0e-127	99.1
AVG08462.1\|365257_365524_-	replication initiator protein A	A0A0S2MVK1	Bacillus_phage	5.8e-06	34.9

DBSCAN-SWA_26

368628 : 370247

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08465.1\|368628_369486_+	YitT family protein	M1Q1P6	Streptococcus_phage	4.2e-29	32.6
AVG08466.1\|369635_370247_-	transposon DNA-invertase	M9Q1K0	Clostridium_phage	8.9e-18	32.8

DBSCAN-SWA_27

375953 : 387142

Staphylococcus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08471.1\|375953_376301_-	transcriptional regulator	E4ZFI8	Streptococcus_phage	2.4e-12	35.8
AVG08472.1\|376319_376937_-	cadmium transporter	NA	NA	NA	NA
AVG08473.1\|377709_378048_-	replication protein	NA	NA	NA	NA
AVG08474.1\|378825_379500_+\|transposase	IS6-like element IS257 family transposase	A0A0N9RU54	Staphylococcus_phage	2.0e-127	99.1
AVG08475.1\|380911_381100_-	CsbD family protein	NA	NA	NA	NA
AVG08476.1\|382083_382758_+\|transposase	IS6-like element IS257 family transposase	A0A0N9RU54	Staphylococcus_phage	2.0e-127	99.1
AVG08477.1\|384142_385492_+	recombinase family protein	A0A2H4J388	uncultured_Caudovirales_phage	3.3e-20	24.5
AVG08478.1\|385513_387142_+	recombinase RecB	A0A0S2SXR4	Bacillus_phage	3.2e-46	34.0

DBSCAN-SWA_28

397552 : 407653

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08488.1\|397552_398353_-	MBL fold metallo-hydrolase	A0A2H4J3R0	uncultured_Caudovirales_phage	2.9e-40	36.4
AVG08489.1\|398972_399764_-	hypothetical protein	NA	NA	NA	NA
AVG08490.1\|399764_401111_-	hypothetical protein	NA	NA	NA	NA
AVG08491.1\|401094_402927_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.6e-30	31.4
AVG08492.1\|402939_403641_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	6.0e-42	39.2
AVG08493.1\|403684_403777_-	hypothetical protein	NA	NA	NA	NA
AVG08494.1\|404691_405975_-	adenylosuccinate synthetase	L7Y4J5	Megavirus	8.0e-69	34.8
AVG08495.1\|406252_407653_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.2e-112	48.9

DBSCAN-SWA_29

414075 : 423594

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08502.1\|414075_415080_+	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	2.5e-81	52.6
AVG08503.1\|415607_416894_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.1e-89	52.2
AVG08504.1\|417720_418554_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AVG08505.1\|418944_421626_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.8e-121	36.4
AVG08506.1\|421662_423594_-	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	3.2e-146	46.0

DBSCAN-SWA_30

433800 : 439961

Gordonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08516.1\|433800_434640_+	nucleoid occlusion protein	A0A1C9EHY8	Gordonia_phage	4.7e-09	33.1
AVG08517.1\|434901_435063_+	hypothetical protein	NA	NA	NA	NA
AVG08518.1\|435040_435400_+	DUF3147 domain-containing protein	NA	NA	NA	NA
AVG08519.1\|435415_435811_+	DUF3147 domain-containing protein	NA	NA	NA	NA
AVG08520.1\|435776_436316_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AVG08521.1\|436535_437105_+	XRE family transcriptional regulator	D2XQ11	Bacillus_virus	2.5e-06	31.8
AVG08522.1\|437292_437922_-	YIP1 family protein	NA	NA	NA	NA
AVG08523.1\|438159_439278_+	RND transporter	NA	NA	NA	NA
AVG08524.1\|439274_439961_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-33	37.6

DBSCAN-SWA_31

446369 : 447128

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08530.1\|446369_447128_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	37.6

DBSCAN-SWA_32

458160 : 461992

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08537.1\|458160_458835_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	9.9e-127	98.2
AVG08538.1\|459190_459655_-	damage-inducible protein DinB	NA	NA	NA	NA
AVG08539.1\|460130_460361_-	hypothetical protein	NA	NA	NA	NA
AVG08540.1\|460511_461150_-	ABC-2 transporter permease	NA	NA	NA	NA
AVG08541.1\|461149_461992_-	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	4.1e-05	25.5

DBSCAN-SWA_33

470487 : 479217

Pandoravirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08550.1\|470487_471663_-	PLP-dependent transferase	A0A0B5JD48	Pandoravirus	1.8e-14	25.9
AVG08551.1\|471659_472763_-	cystathionine gamma-synthase	A0A0B5JD48	Pandoravirus	1.3e-11	26.3
AVG08552.1\|473491_474334_+	chromosome partitioning protein ParB	A0A1C9EHW0	Gordonia_phage	3.2e-10	29.3
AVG08553.1\|474488_475364_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
AVG08554.1\|475384_475588_+	DUF951 domain-containing protein	NA	NA	NA	NA
AVG08555.1\|475599_476697_+	redox-regulated ATPase YchF	NA	NA	NA	NA
AVG08556.1\|476929_477121_-	hypothetical protein	U3PCX8	Staphylococcus_phage	4.4e-24	83.3
AVG08557.1\|477194_478004_-	lysozyme	NA	NA	NA	NA
AVG08558.1\|478388_478685_+	30S ribosomal protein S6	NA	NA	NA	NA
AVG08559.1\|478707_479217_+	single-stranded DNA-binding protein	A0A2H4JCF2	uncultured_Caudovirales_phage	4.8e-65	90.5

DBSCAN-SWA_34

484321 : 485845

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08571.1\|484321_485845_-	alkyl hydroperoxide reductase subunit F	A0A249XZT7	Enterococcus_phage	7.1e-40	33.4

DBSCAN-SWA_35

495078 : 500967

Klosneuvirus(20.0%)

protease,integrase

attL 486571:486588|attR 500585:500602

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
486571:486588	attL	NA	NA	NA	NA
AVG08582.1\|495078_496545_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.7e-94	39.8
AVG08583.1\|496711_498253_+	GMP synthase (glutamine-hydrolyzing)	A0A1V0SH76	Hokovirus	3.6e-23	32.6
AVG08584.1\|498491_499397_-\|protease	CAAX protease	NA	NA	NA	NA
AVG08585.1\|499805_499967_-\|integrase	integrase	A0A2I6PEN0	Staphylococcus_phage	7.8e-06	60.9
AVG08586.1\|500022_500553_-	hypothetical protein	A0A2H4IYV6	uncultured_Caudovirales_phage	5.5e-16	54.1
AVG08587.1\|500565_500967_-	hypothetical protein	Q4ZCB6	Staphylococcus_virus	2.9e-33	51.1
500585:500602	attR	NA	NA	NA	NA

DBSCAN-SWA_36

505837 : 506101

Staphylococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08593.1\|505837_506101_-	hypothetical protein	Q4ZCB7	Staphylococcus_virus	1.3e-10	46.2

DBSCAN-SWA_37

516537 : 522906

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10420.1\|516537_517446_+	cysteine synthase family protein	A0A1X9I5F1	Streptococcus_phage	7.7e-50	39.1
AVG08604.1\|517438_518584_+	bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase	NA	NA	NA	NA
AVG08605.1\|518830_519856_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-31	37.7
AVG08606.1\|519858_520518_+	ABC transporter permease	NA	NA	NA	NA
AVG08607.1\|520561_521407_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
AVG08608.1\|521931_522906_+	N-acetylmuramoyl-L-alanine amidase	Q6A204	Oenococcus_phage	6.2e-21	41.8

DBSCAN-SWA_38

539277 : 540984

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08620.1\|539277_540984_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.1e-54	41.2

DBSCAN-SWA_39

550068 : 557527

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08625.1\|550068_550680_+	thymidylate kinase	M1PSC7	Streptococcus_phage	4.1e-47	48.3
AVG08626.1\|550713_551043_+	hypothetical protein	NA	NA	NA	NA
AVG08627.1\|551348_552275_+	DNA polymerase III subunit delta'	A0A292GC45	Xanthomonas_phage	1.8e-06	31.9
AVG08628.1\|552276_553080_+	signal peptidase II	NA	NA	NA	NA
AVG08629.1\|553096_553444_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
AVG08630.1\|553539_554265_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AVG08631.1\|554257_554506_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
AVG08632.1\|554507_555347_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.0e-57	44.8
AVG08633.1\|555556_557527_+\|tRNA	methionine--tRNA ligase	A0A1V0SEZ7	Hokovirus	1.3e-94	32.0

DBSCAN-SWA_40

563790 : 566255

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08642.1\|563790_565146_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L821	Tupanvirus	4.4e-25	31.4
AVG08643.1\|565289_566255_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.6e-48	36.7

DBSCAN-SWA_41

576888 : 585970

uncultured_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08653.1\|576888_577428_+	hypoxanthine-guanine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.0e-12	29.8
AVG08654.1\|577702_579805_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	H8ZJI5	Ostreococcus_tauri_virus	4.9e-108	48.8
AVG08655.1\|580059_580941_+	redox-regulated molecular chaperone Hsp33	NA	NA	NA	NA
AVG08656.1\|581277_582210_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	3.2e-107	63.9
AVG08657.1\|582505_583324_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	6.8e-21	30.5
AVG08658.1\|583301_583667_+	dihydroneopterin aldolase	NA	NA	NA	NA
AVG08659.1\|583667_584147_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AVG08660.1\|584482_585970_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	5.8e-95	39.8

DBSCAN-SWA_42

597813 : 602331

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08661.1\|597813_599178_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	5.8e-17	24.7
AVG08662.1\|599274_600162_+	pyridoxal 5'-phosphate synthase lyase subunit PdxS	NA	NA	NA	NA
AVG10421.1\|600164_600722_+	pyridoxal 5'-phosphate synthase glutaminase subunit PdxT	NA	NA	NA	NA
AVG08663.1\|601131_602331_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4

DBSCAN-SWA_43

606033 : 608487

Escherichia_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08668.1\|606033_608487_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	1.6e-134	41.2

DBSCAN-SWA_44

614324 : 619113

Catovirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08673.1\|614324_615725_+\|tRNA	cysteine--tRNA ligase	A0A1V0SAQ2	Catovirus	9.1e-58	31.6
AVG08674.1\|615717_616116_+	ribonuclease III	NA	NA	NA	NA
AVG08675.1\|616105_616873_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
AVG08676.1\|616869_617397_+	hypothetical protein	NA	NA	NA	NA
AVG08677.1\|617466_618042_+	RNA polymerase sigma factor	NA	NA	NA	NA
AVG08678.1\|618165_618309_+	50S ribosomal protein L33	NA	NA	NA	NA
AVG08679.1\|618371_618554_+	protein translocase subunit SecE	NA	NA	NA	NA
AVG08680.1\|618564_619113_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	6.6e-12	32.9

DBSCAN-SWA_45

622971 : 634112

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08685.1\|622971_626523_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	8.0e-50	24.2
AVG08686.1\|626654_630278_+	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	6.2e-66	24.7
AVG08687.1\|630605_630866_+	50S ribosomal protein L7ae-like protein	NA	NA	NA	NA
AVG08688.1\|630956_631370_+	30S ribosomal protein S12	NA	NA	NA	NA
AVG08689.1\|631440_631911_+	30S ribosomal protein S7	NA	NA	NA	NA
AVG08690.1\|632030_634112_+	elongation factor G	E4ZFJ7	Streptococcus_phage	3.8e-68	28.6

DBSCAN-SWA_46

638144 : 639095

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08694.1\|638144_639095_+	ornithine cyclodeaminase family protein	A0A1V0SL93	Klosneuvirus	4.0e-17	29.4

DBSCAN-SWA_47

649487 : 650150

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08704.1\|649487_650150_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	2.3e-19	33.9

DBSCAN-SWA_48

658947 : 659900

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08711.1\|658947_659148_-	protein-tyrosine-phosphatase	A0A2H4PQT9	Staphylococcus_phage	4.8e-21	70.8
AVG08712.1\|659147_659696_-	hypothetical protein	A0A2H4PQU3	Staphylococcus_phage	4.9e-68	71.1
AVG08713.1\|659723_659900_-	arsenic transporter	A0A2H4PQU3	Staphylococcus_phage	4.1e-08	58.2

DBSCAN-SWA_49

671902 : 672553

Harp_seal_herpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08728.1\|671902_672553_+	uracil-DNA glycosylase	A0A0R5YU95	Harp_seal_herpesvirus	2.1e-41	45.0

DBSCAN-SWA_50

684719 : 690055

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08740.1\|684719_686087_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.0e-105	47.2
AVG08741.1\|686055_686478_-	transcriptional regulator	NA	NA	NA	NA
AVG08742.1\|686633_687572_+	aldo/keto reductase	NA	NA	NA	NA
AVG08743.1\|688188_688665_+	N-acetyltransferase	NA	NA	NA	NA
AVG08744.1\|688756_690055_+	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	5.5e-25	30.9

DBSCAN-SWA_51

695084 : 696107

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08750.1\|695084_696107_+	zinc-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	5.5e-36	28.9

DBSCAN-SWA_52

706847 : 707624

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08764.1\|706847_707624_+	alpha/beta hydrolase	A0A1D8EVD1	Mycobacterium_phage	8.4e-05	28.2

DBSCAN-SWA_53

723163 : 723910

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08782.1\|723163_723910_-	metal ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.4e-11	32.7

DBSCAN-SWA_54

731146 : 741736

Streptomyces_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08790.1\|731146_731545_+	glycerol-3-phosphate cytidylyltransferase	A0A222YWT0	Streptomyces_phage	2.9e-17	39.9
AVG08791.1\|731686_731797_+	hypothetical protein	NA	NA	NA	NA
AVG08792.1\|731885_732035_+	hypothetical protein	NA	NA	NA	NA
AVG08793.1\|732527_734255_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.7e-102	40.4
AVG08794.1\|734540_735770_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AVG08795.1\|736306_737140_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-43	37.3
AVG08796.1\|737498_738296_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	9.2e-15	31.2
AVG08797.1\|738615_739116_+	hypothetical protein	NA	NA	NA	NA
AVG08798.1\|739340_740408_+	hypothetical protein	NA	NA	NA	NA
AVG08799.1\|740686_741736_+	alpha/beta hydrolase	A0A0G2Y6Q1	Acanthamoeba_polyphaga_mimivirus	4.9e-16	23.3

DBSCAN-SWA_55

745706 : 746468

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08804.1\|745706_746468_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.2e-19	30.7

DBSCAN-SWA_56

756453 : 756930

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08813.1\|756453_756930_+	cupin	A0A291ATU0	Pandoravirus	1.7e-16	37.5

DBSCAN-SWA_57

765962 : 766529

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08825.1\|765962_766529_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.7e-21	35.2

DBSCAN-SWA_58

769638 : 773024

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08830.1\|769638_771333_+	cysteine ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.2e-18	29.1
AVG08831.1\|771329_773024_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	1.2e-14	24.4

DBSCAN-SWA_59

778125 : 779499

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08837.1\|778125_779499_+	deoxyribodipyrimidine photo-lyase	A0A2H4UV63	Bodo_saltans_virus	1.9e-47	37.0

DBSCAN-SWA_60

790628 : 802723

Staphylococcus_phage(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08846.1\|790628_791468_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.2e-60	43.0
AVG08847.1\|791609_791702_+	hypothetical protein	NA	NA	NA	NA
AVG08848.1\|791670_792777_+	glycosyltransferase	A8CG95	Salmonella_phage	6.3e-62	43.2
AVG08849.1\|792846_793812_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.8e-17	30.6
AVG08850.1\|793901_794591_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.2e-33	34.8
AVG08851.1\|794565_795039_-	DoxX family protein	NA	NA	NA	NA
AVG08852.1\|795089_795527_-	hypothetical protein	NA	NA	NA	NA
AVG08853.1\|795932_796031_+	hypothetical protein	NA	NA	NA	NA
AVG08854.1\|796657_797857_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4
AVG08855.1\|798187_798787_-	hypothetical protein	NA	NA	NA	NA
AVG08856.1\|798888_799602_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	1.6e-55	44.8
AVG08857.1\|799602_800022_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AVG08858.1\|800026_800698_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	4.1e-64	55.7
AVG08859.1\|800994_801582_+	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	5.7e-38	42.4
AVG08860.1\|801571_802723_+	anthranilate synthase component I family protein	A0A0B5J984	Pandoravirus	7.5e-26	39.6

DBSCAN-SWA_61

805881 : 819494

Streptococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08865.1\|805881_807822_+	lipoteichoic acid synthase	W6LM83	Streptococcus_phage	3.0e-107	38.5
AVG08866.1\|808497_809697_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4
AVG08867.1\|809899_809998_+	hypothetical protein	NA	NA	NA	NA
AVG08868.1\|810274_811090_-	ZIP family metal transporter	NA	NA	NA	NA
AVG08869.1\|811217_813101_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.6e-55	30.2
AVG10429.1\|813111_814893_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	1.0e-77	37.1
AVG08870.1\|815092_816067_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.0e-24	31.0
AVG08871.1\|816059_817574_+	glycine/betaine ABC transporter permease	NA	NA	NA	NA
AVG08872.1\|817776_818832_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	9.3e-23	27.1
AVG08873.1\|818954_819494_+	5'(3')-deoxyribonucleotidase	A0A0A0PKY7	Bacillus_phage	1.1e-30	40.7

DBSCAN-SWA_62

824146 : 834580

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08876.1\|824146_825652_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	5.5e-61	34.0
AVG08877.1\|825935_826436_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.1e-50	70.1
AVG08878.1\|826449_827325_-	EamA/RhaT family transporter	NA	NA	NA	NA
AVG08879.1\|828079_828478_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	2.0e-71	100.0
AVG08880.1\|828440_830546_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A2H4J2N6	uncultured_Caudovirales_phage	0.0e+00	100.0
AVG08881.1\|830664_831633_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A2H4J4P3	uncultured_Caudovirales_phage	3.9e-185	100.0
AVG08882.1\|831607_831871_+	hypothetical protein	A0A2H4IYB4	uncultured_Caudovirales_phage	5.5e-17	100.0
AVG08883.1\|831886_832861_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	5.0e-164	99.4
AVG08884.1\|832844_833804_+	iron ABC transporter permease	A0A2H4J116	uncultured_Caudovirales_phage	4.1e-17	100.0
AVG08885.1\|833800_834580_+	iron ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.1e-18	33.6

DBSCAN-SWA_63

846013 : 849072

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08897.1\|846013_846655_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.1e-38	48.3
AVG08898.1\|846799_847666_+	DegV family protein	NA	NA	NA	NA
AVG08899.1\|847989_849072_+	DNA/RNA helicase	A0A1X9I5S6	Streptococcus_phage	6.8e-45	37.0

DBSCAN-SWA_64

855220 : 856021

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08904.1\|855220_856021_+	CHAP domain-containing protein	A0A173GBC8	Staphylococcus_phage	5.6e-12	44.6

DBSCAN-SWA_65

859759 : 862594

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08908.1\|859759_862594_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	58.2

DBSCAN-SWA_66

866729 : 871726

Streptococcus_phage(40.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08913.1\|866729_867662_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.2e-83	48.6
AVG08914.1\|867837_868746_+	RNase adaptor protein RapZ	A0A0R8VB27	Thermobifida_phage	3.6e-07	33.6
AVG08915.1\|868745_869741_+	hypothetical protein	A1IMD5	Streptococcus_phage	2.6e-51	39.8
AVG08916.1\|869869_870814_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.4e-54	40.6
AVG08917.1\|871141_871726_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.1e-52	54.7

DBSCAN-SWA_67

881359 : 891634

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08927.1\|881359_882664_+	enolase	W6LP63	Streptococcus_phage	4.3e-195	80.3
AVG08928.1\|882829_883288_+	hypothetical protein	NA	NA	NA	NA
AVG08929.1\|883356_883590_+	protein-export membrane protein SecG	NA	NA	NA	NA
AVG08930.1\|883890_884631_+	carboxylesterase	NA	NA	NA	NA
AVG08931.1\|884665_887044_+	ribonuclease R	Q0GXV6	Lactococcus_phage	8.1e-91	38.6
AVG08932.1\|887068_887539_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.4e-71	88.5
AVG08933.1\|888090_888765_-	hypothetical protein	NA	NA	NA	NA
AVG08934.1\|888777_889275_-	recombinase	A0A0A8WF08	Clostridium_phage	5.4e-13	35.9
AVG10432.1\|889374_889554_+	hypothetical protein	NA	NA	NA	NA
AVG08935.1\|889697_890240_-	hypothetical protein	A0A2H4PQM7	Staphylococcus_phage	1.8e-25	54.5
AVG08936.1\|891400_891634_-	hypothetical protein	Q4ZCB8	Staphylococcus_virus	1.0e-22	64.9

DBSCAN-SWA_68

897048 : 901554

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08943.1\|897048_897990_+	cation transporter	A0A1V0SED0	Indivirus	1.1e-11	33.6
AVG08944.1\|898387_898471_-	epsilon family phenol-soluble modulin	NA	NA	NA	NA
AVG08945.1\|899355_899556_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.0e-19	69.2
AVG08946.1\|900176_900401_-	hypothetical protein	NA	NA	NA	NA
AVG08947.1\|900424_900709_-	hypothetical protein	NA	NA	NA	NA
AVG08948.1\|900807_901554_-	hypothetical protein	W5R8K6	Staphylococcus_phage	1.1e-38	42.0

DBSCAN-SWA_69

907257 : 912366

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08959.1\|907257_907974_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	9.8e-16	30.2
AVG08960.1\|908054_908597_+	nitroreductase	NA	NA	NA	NA
AVG08961.1\|908779_909103_-	thioredoxin	NA	NA	NA	NA
AVG08962.1\|909245_909599_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.6e-19	45.9
AVG08963.1\|909772_910153_+	glycine cleavage system protein H	NA	NA	NA	NA
AVG08964.1\|910306_910399_+	hypothetical protein	NA	NA	NA	NA
AVG08965.1\|910412_910799_+	topiosmerase	NA	NA	NA	NA
AVG08966.1\|910791_911088_+	thioredoxin	NA	NA	NA	NA
AVG08967.1\|911340_912366_+	methionine import ATP-binding protein MetN 1	G9BWD6	Planktothrix_phage	1.8e-26	37.9

DBSCAN-SWA_70

915928 : 919401

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08973.1\|915928_916690_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	8.5e-10	28.3
AVG08974.1\|916784_918092_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AVG08975.1\|918159_919401_+	cysteine desulfurase	Q2XUY6	environmental_halophage	4.1e-110	44.0

DBSCAN-SWA_71

924172 : 925021

Golden_Marseillevirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08980.1\|924172_925021_+	DUF72 domain-containing protein	A0A1D6Y809	Golden_Marseillevirus	5.4e-13	25.9

DBSCAN-SWA_72

932083 : 934752

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08990.1\|932083_933541_+	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9L3I8	Tupanvirus	9.5e-42	27.5
AVG08991.1\|933537_934752_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	4.5e-21	28.0

DBSCAN-SWA_73

939002 : 942641

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08998.1\|939002_939362_+	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	1.2e-14	38.6
AVG10434.1\|939631_940840_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AVG08999.1\|941159_942641_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	6.3e-49	34.5

DBSCAN-SWA_74

945925 : 947620

Staphylococcus_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09003.1\|945925_947620_-\|transposase	IS5/IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.5e-240	77.9

DBSCAN-SWA_75

955455 : 956049

Aureococcus_anophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09013.1\|955455_956049_+	peptidylprolyl isomerase	A0A076FI46	Aureococcus_anophage	6.6e-26	41.3

DBSCAN-SWA_76

959238 : 964725

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09016.1\|959238_960438_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG09017.1\|960940_962131_+	ornithine--oxo-acid transaminase	A0A1V0SKB7	Klosneuvirus	7.3e-32	29.4
AVG09018.1\|962239_963484_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AVG09019.1\|963675_964725_-	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	2.5e-36	39.2

DBSCAN-SWA_77

974731 : 978406

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09027.1\|974731_978406_+	helicase-exonuclease AddAB subunit AddA	S5M596	Bacillus_phage	6.8e-20	22.1

DBSCAN-SWA_78

983493 : 1080614

Bacillus_phage(27.91%)

protease,tail,tRNA,transposase,terminase,integrase,portal,head,holin,capsid

attL 979574:979593|attR 1086834:1086853

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
979574:979593	attL	NA	NA	NA	NA
AVG09033.1\|983493_985317_+	acetyltransferase	B5WZU0	Pseudomonas_phage	9.5e-31	30.7
AVG09034.1\|985525_988135_+	ATP-dependent chaperone ClpB	A0A1C3S747	Escherichia_phage	1.6e-119	35.0
AVG09035.1\|988415_989615_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4
AVG09036.1\|989873_990068_-	DUF2929 domain-containing protein	NA	NA	NA	NA
AVG09037.1\|990349_991291_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
AVG09038.1\|991302_992547_+	beta-ketoacyl-[acyl-carrier-protein] synthase II	NA	NA	NA	NA
AVG09039.1\|992617_992989_-	DUF3899 domain-containing protein	NA	NA	NA	NA
AVG09040.1\|993230_994157_+	ABC transporter permease	NA	NA	NA	NA
AVG09041.1\|994156_995227_+	ABC transporter permease	NA	NA	NA	NA
AVG09042.1\|995241_996321_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-18	29.6
AVG09043.1\|996313_997252_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-21	31.9
AVG09044.1\|997278_998922_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AVG09045.1\|998979_999969_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AVG09046.1\|1000259_1000655_+	transcriptional regulator Spx	NA	NA	NA	NA
AVG09047.1\|1001009_1001732_+	adaptor protein MecA	NA	NA	NA	NA
AVG09048.1\|1001821_1002808_+	transcription factor	NA	NA	NA	NA
AVG09049.1\|1002858_1004667_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	3.7e-51	26.9
AVG09050.1\|1005130_1005928_-	DsbA family protein	NA	NA	NA	NA
AVG10435.1\|1005950_1006316_-	globin	NA	NA	NA	NA
AVG09051.1\|1006397_1006988_-	CYTH domain-containing protein	NA	NA	NA	NA
AVG09052.1\|1007271_1007619_+	hypothetical protein	NA	NA	NA	NA
AVG09053.1\|1007635_1008271_+	GTP pyrophosphokinase	NA	NA	NA	NA
AVG09054.1\|1008284_1009094_+	NAD(+) kinase	NA	NA	NA	NA
AVG09055.1\|1009090_1009945_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AVG09056.1\|1009969_1011355_+	magnesium transporter	NA	NA	NA	NA
AVG09057.1\|1011364_1013209_+	sodium:proton antiporter	NA	NA	NA	NA
AVG09058.1\|1013920_1014544_+	DUF443 domain-containing protein	NA	NA	NA	NA
AVG09059.1\|1014604_1014868_+	type II secretion protein	A0A1X9I6T6	Streptococcus_phage	1.2e-08	40.0
AVG09060.1\|1015140_1015344_-	hypothetical protein	A0A0N7GFG6	Staphylococcus_phage	1.1e-07	74.3
AVG09061.1\|1015374_1015608_+	hypothetical protein	NA	NA	NA	NA
AVG09062.1\|1016002_1017202_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG09063.1\|1017505_1017976_+	hypothetical protein	E3SJC5	Synechococcus_phage	9.9e-25	39.7
AVG09064.1\|1017984_1018362_+	glucose-6-phosphate 1-dehydrogenase	NA	NA	NA	NA
AVG10436.1\|1018726_1020739_+	daunorubicin resistance protein DrrC	A0A1B1IVR3	uncultured_Mediterranean_phage	7.6e-106	36.1
AVG09065.1\|1022069_1022285_+	recombinase	NA	NA	NA	NA
AVG09066.1\|1022358_1022730_+\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
AVG09067.1\|1022951_1023722_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AVG09068.1\|1024119_1025205_-	AI-2E family transporter	NA	NA	NA	NA
AVG09069.1\|1025430_1026186_+	esterase family protein	NA	NA	NA	NA
AVG09070.1\|1026339_1026849_+	hypothetical protein	NA	NA	NA	NA
AVG09071.1\|1027112_1028306_-	MFS transporter	NA	NA	NA	NA
AVG09072.1\|1028283_1029459_-	diacylglycerol beta-glucosyltransferase	NA	NA	NA	NA
AVG09073.1\|1029979_1031464_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
AVG09074.1\|1031453_1031699_+	hypothetical protein	NA	NA	NA	NA
AVG09075.1\|1031702_1033265_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	1.7e-36	26.9
AVG09076.1\|1033573_1034380_+	hypothetical protein	S5MAL1	Bacillus_phage	3.9e-29	37.7
AVG09077.1\|1034590_1036348_+\|protease	serine protease	W5SAB9	Pithovirus	4.6e-06	24.3
AVG09078.1\|1036365_1037724_+	Ktr system potassium uptake protein D	NA	NA	NA	NA
AVG09079.1\|1037817_1039368_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AVG09080.1\|1039470_1040073_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVG09081.1\|1040078_1040264_-	DUF2187 domain-containing protein	NA	NA	NA	NA
AVG09082.1\|1040468_1041455_+	lipoate--protein ligase	NA	NA	NA	NA
AVG09083.1\|1041532_1041751_-	IDEAL domain-containing protein	NA	NA	NA	NA
AVG09084.1\|1041843_1041939_+	hypothetical protein	NA	NA	NA	NA
AVG09085.1\|1041965_1042541_+	competence protein ComK	NA	NA	NA	NA
AVG10437.1\|1043062_1043605_-\|integrase	site-specific integrase	A0A2H4JGN1	uncultured_Caudovirales_phage	7.3e-56	61.9
AVG09086.1\|1044191_1044857_-	hypothetical protein	NA	NA	NA	NA
AVG09087.1\|1044869_1045244_-	hypothetical protein	NA	NA	NA	NA
AVG09088.1\|1045399_1045735_-	XRE family transcriptional regulator	A0A2I6PEN2	Staphylococcus_phage	1.4e-28	58.9
AVG09089.1\|1045895_1046087_+	XRE family transcriptional regulator	A0A2I6PEL6	Staphylococcus_phage	9.5e-19	65.1
AVG09090.1\|1046140_1046449_+	DUF771 domain-containing protein	Q4ZC28	Staphylococcus_virus	7.7e-10	37.4
AVG09091.1\|1046519_1047065_-	hypothetical protein	NA	NA	NA	NA
AVG09092.1\|1047163_1047358_+	hypothetical protein	NA	NA	NA	NA
AVG09093.1\|1047505_1048774_+	helicase SNF2	A0A1B1P7L4	Bacillus_phage	4.1e-134	57.6
AVG09094.1\|1048751_1049048_+	nuclease	A0A1B1P7M6	Bacillus_phage	3.1e-24	57.1
AVG09095.1\|1049047_1050859_+	NTP-binding protein	A0A1B1P7N0	Bacillus_phage	1.7e-165	58.0
AVG09096.1\|1050877_1051084_+	hypothetical protein	A0A1B1P7N6	Bacillus_phage	1.9e-09	52.4
AVG09097.1\|1051135_1051618_+	DUF669 domain-containing protein	A0A2H4J1S8	uncultured_Caudovirales_phage	8.9e-21	38.4
AVG09098.1\|1051667_1053386_+	hypothetical protein	A0A1B1P7M5	Bacillus_phage	2.9e-207	63.3
AVG09099.1\|1053402_1053753_+	hypothetical protein	NA	NA	NA	NA
AVG09100.1\|1053783_1054002_+	DUF3310 domain-containing protein	Q4ZC12	Staphylococcus_virus	3.2e-26	77.1
AVG09101.1\|1054008_1054740_+	hypothetical protein	H9A0T0	Staphylococcus_phage	2.1e-61	49.6
AVG09102.1\|1054804_1055125_+	hypothetical protein	A0A2H4J2H9	uncultured_Caudovirales_phage	4.6e-42	81.6
AVG09103.1\|1055322_1055619_-	hypothetical protein	A0A1W6JPR4	Staphylococcus_phage	7.9e-12	41.5
AVG09104.1\|1055686_1055932_+	hypothetical protein	NA	NA	NA	NA
AVG09105.1\|1056010_1056205_+	hypothetical protein	NA	NA	NA	NA
AVG09106.1\|1056234_1058106_+	DNA primase	A0A1B1P7L5	Bacillus_phage	3.6e-211	58.5
AVG09107.1\|1058427_1058919_+	RNA polymerase subunit sigma-70	A0A0K2CNQ1	Brevibacillus_phage	5.7e-07	28.4
AVG09108.1\|1059974_1060265_+	HNH endonuclease	D2XR61	Bacillus_phage	2.5e-18	42.2
AVG09109.1\|1060584_1060923_+\|terminase	terminase	D2XR14	Bacillus_phage	1.0e-10	38.2
AVG09110.1\|1060906_1062541_+\|terminase	terminase large subunit	A0A0U4B089	Bacillus_phage	6.9e-182	56.4
AVG09111.1\|1062556_1063693_+\|portal	phage portal protein	A0A0U4IIQ9	Bacillus_phage	4.0e-88	43.8
AVG09112.1\|1063692_1064424_+\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	1.1e-41	42.0
AVG09113.1\|1064448_1065606_+\|capsid	phage major capsid protein	A0A0U4JIF4	Bacillus_phage	7.4e-98	52.0
AVG09114.1\|1065632_1065941_+	hypothetical protein	A0A2H4JF26	uncultured_Caudovirales_phage	5.9e-10	38.0
AVG09115.1\|1065912_1066242_+\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
AVG09116.1\|1066241_1066580_+	hypothetical protein	NA	NA	NA	NA
AVG09117.1\|1066579_1067017_+	hypothetical protein	NA	NA	NA	NA
AVG09118.1\|1067022_1067727_+\|tail	phage tail protein	NA	NA	NA	NA
AVG09119.1\|1067750_1068095_+	hypothetical protein	NA	NA	NA	NA
AVG09120.1\|1068148_1068361_+	hypothetical protein	NA	NA	NA	NA
AVG09121.1\|1068424_1072606_+\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	7.4e-63	42.6
AVG09122.1\|1072608_1073379_+\|tail	phage tail protein	NA	NA	NA	NA
AVG09123.1\|1073375_1076831_+	hypothetical protein	M1PRQ3	Streptococcus_phage	1.3e-20	24.0
AVG09124.1\|1076851_1077262_+	hypothetical protein	A0A0K2FLF1	Brevibacillus_phage	1.6e-07	36.0
AVG09125.1\|1077298_1077580_+	hypothetical protein	NA	NA	NA	NA
AVG09126.1\|1077581_1077968_+\|holin	holin	D7RWK5	Brochothrix_phage	2.1e-12	33.9
AVG09127.1\|1078020_1078941_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6JNM6	Staphylococcus_phage	3.7e-68	64.0
AVG09128.1\|1078937_1080614_-\|transposase	IS1182-like element ISSep1 family transposase	A0ZS58	Staphylococcus_virus	1.4e-243	77.6
1086834:1086853	attR	NA	NA	NA	NA

DBSCAN-SWA_79

1085636 : 1085852

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09134.1\|1085636_1085852_-	NINE protein	A0A060AN66	Enterococcus_phage	1.6e-06	40.4

DBSCAN-SWA_80

1096222 : 1100230

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09146.1\|1096222_1100230_-	bifunctional autolysin	A0A1J0MFI1	Staphylococcus_phage	2.6e-57	49.2

DBSCAN-SWA_81

1104029 : 1105232

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09150.1\|1104029_1105232_+	methicillin resistance protein FmtA	G8IDB2	Mycobacterium_phage	1.4e-06	22.8

DBSCAN-SWA_82

1111703 : 1126335

Synechococcus_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09157.1\|1111703_1112564_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.4e-37	39.2
AVG09158.1\|1112768_1113251_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	5.2e-21	43.3
AVG09159.1\|1113237_1114365_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AVG09160.1\|1114365_1115070_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	H8ZMN3	Synechococcus_phage	1.6e-47	42.5
AVG09161.1\|1115069_1115330_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AVG09162.1\|1115331_1116003_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AVG09163.1\|1115995_1118185_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.7e-140	40.4
AVG09164.1\|1118163_1119648_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	9.4e-45	31.9
AVG09165.1\|1119640_1120672_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.1e-64	43.4
AVG09166.1\|1120671_1121238_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.7e-29	40.0
AVG09167.1\|1121254_1122733_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	4.9e-78	51.1
AVG09168.1\|1122758_1124000_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AVG09169.1\|1124132_1124972_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AVG09170.1\|1124931_1126335_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-14	28.8

DBSCAN-SWA_83

1131517 : 1132690

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09175.1\|1131517_1132690_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	2.9e-73	41.5

DBSCAN-SWA_84

1142540 : 1143092

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09185.1\|1142540_1143092_-	peptide deformylase	E3SLL2	Synechococcus_phage	4.9e-15	44.8

DBSCAN-SWA_85

1147601 : 1151372

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09190.1\|1147601_1149008_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.8e-48	29.3
AVG09191.1\|1149309_1149588_+	hypothetical protein	NA	NA	NA	NA
AVG09192.1\|1149726_1150266_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVG09193.1\|1150277_1151372_+	spermidine/putrescine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.4e-37	43.0

DBSCAN-SWA_86

1160259 : 1163574

Erysipelothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09203.1\|1160259_1162107_+	translational GTPase TypA	A0A2K5B2A5	Erysipelothrix_phage	3.4e-20	42.2
AVG09204.1\|1162374_1163574_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4

DBSCAN-SWA_87

1176392 : 1179286

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09215.1\|1176392_1177319_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	1.8e-09	42.2
AVG09216.1\|1177348_1177468_+	hypothetical protein	NA	NA	NA	NA
AVG09217.1\|1177539_1177791_+	DUF2129 domain-containing protein	NA	NA	NA	NA
AVG09218.1\|1177800_1178190_-	hypothetical protein	NA	NA	NA	NA
AVG09219.1\|1178256_1178799_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AVG09220.1\|1178800_1179286_+	phosphopantetheine adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.1e-26	41.5

DBSCAN-SWA_88

1186128 : 1187187

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09227.1\|1186128_1187187_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	3.6e-30	35.5

DBSCAN-SWA_89

1191690 : 1196331

Bodo_saltans_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09232.1\|1191690_1193400_+	DNA polymerase/3'-5' exonuclease PolX	A0A2H4UV14	Bodo_saltans_virus	4.0e-15	23.0
AVG09233.1\|1193409_1195758_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.4e-13	39.8
AVG09234.1\|1196016_1196331_+	thiol reductase thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.3e-25	47.6

DBSCAN-SWA_90

1202935 : 1203523

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09240.1\|1202935_1203523_+	non-canonical purine NTP pyrophosphatase	A0A2H4UUV7	Bodo_saltans_virus	1.6e-08	26.9

DBSCAN-SWA_91

1223936 : 1226687

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09263.1\|1223936_1226687_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	4.7e-90	27.4

DBSCAN-SWA_92

1231278 : 1235889

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09269.1\|1231278_1232586_+	uracil permease	Q9KX94	Enterobacteria_phage	5.2e-55	34.9
AVG09270.1\|1232611_1233493_+	aspartate carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.3e-30	31.3
AVG09271.1\|1233510_1234788_+	dihydroorotase	NA	NA	NA	NA
AVG09272.1\|1234788_1235889_+	carbamoyl-phosphate synthase small chain	R4TGJ8	Halovirus	5.1e-64	36.0

DBSCAN-SWA_93

1239782 : 1240394

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09275.1\|1239782_1240394_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	6.8e-26	32.8

DBSCAN-SWA_94

1243599 : 1250526

Abalone_herpesvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09279.1\|1243599_1244223_+	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	4.2e-23	35.3
AVG09280.1\|1244222_1244435_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AVG09281.1\|1244972_1246172_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	5.6e-40	32.0
AVG09282.1\|1246171_1248580_+	primosomal protein N'	NA	NA	NA	NA
AVG09283.1\|1248687_1248891_-	NINE protein	A0A060AN66	Enterococcus_phage	1.2e-08	44.4
AVG09284.1\|1249112_1249601_+	peptide deformylase-like protein	NA	NA	NA	NA
AVG09285.1\|1249593_1250526_+\|tRNA	methionyl-tRNA formyltransferase	M4QRX9	Synechococcus_phage	4.3e-11	30.3

DBSCAN-SWA_95

1253673 : 1255677

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09289.1\|1253673_1255677_+	Stk1 family PASTA domain-containing Ser/Thr kinase	M1PCM5	Moumouvirus	1.8e-22	35.7

DBSCAN-SWA_96

1265692 : 1267676

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09300.1\|1265692_1266427_+	beta-ketoacyl-ACP reductase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-18	30.7
AVG09301.1\|1266590_1266824_+	acyl carrier protein	E3SSM9	Prochlorococcus_phage	1.6e-07	63.3
AVG09302.1\|1266938_1267676_+	ribonuclease 3	G8DDA3	Micromonas_pusilla_virus	4.5e-24	31.8

DBSCAN-SWA_97

1283780 : 1284551

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09315.1\|1283780_1284551_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	3.3e-25	41.2

DBSCAN-SWA_98

1288615 : 1295150

Indivirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09319.1\|1288615_1290685_+	DNA topoisomerase 1	A0A1V0SCS0	Indivirus	1.5e-104	39.3
AVG09320.1\|1290709_1292017_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
AVG09321.1\|1292241_1293132_+	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	4.2e-24	29.3
AVG09322.1\|1293135_1293678_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AVG09323.1\|1293746_1295150_+	HslU--HslV peptidase ATPase subunit	A0A1B2IDZ7	Erwinia_phage	2.9e-27	25.3

DBSCAN-SWA_99

1299778 : 1300549

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09329.1\|1299778_1300549_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	6.6e-26	43.0

DBSCAN-SWA_100

1304826 : 1316508

Streptococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10440.1\|1304826_1309137_+	PolC-type DNA polymerase III	A0A1X9I5C8	Streptococcus_phage	8.5e-22	40.1
AVG09333.1\|1309315_1309783_+	ribosome maturation factor	NA	NA	NA	NA
AVG09334.1\|1309803_1311027_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AVG09335.1\|1311044_1311329_+	DUF448 domain-containing protein	NA	NA	NA	NA
AVG09336.1\|1311328_1311646_+	hypothetical protein	NA	NA	NA	NA
AVG09337.1\|1311650_1313813_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	3.5e-24	25.3
AVG09338.1\|1314115_1314466_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
AVG09339.1\|1314603_1315521_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AVG09340.1\|1315536_1316508_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SJE1	Klosneuvirus	6.0e-08	32.1

DBSCAN-SWA_101

1321440 : 1327141

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09344.1\|1321440_1323834_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	4.3e-84	48.7
AVG09345.1\|1323836_1324550_+	GntR family transcriptional regulator	NA	NA	NA	NA
AVG10441.1\|1324670_1325852_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.0e-38	28.9
AVG09346.1\|1325851_1327141_+	insulinase family protein	M1NN74	Moumouvirus	7.9e-16	24.2

DBSCAN-SWA_102

1331606 : 1332656

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09352.1\|1331606_1332656_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	3.2e-124	68.8

DBSCAN-SWA_103

1339028 : 1339646

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09358.1\|1339028_1339646_+	hypothetical protein	A0A2H4J3M4	uncultured_Caudovirales_phage	1.9e-39	44.6

DBSCAN-SWA_104

1342962 : 1347536

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09363.1\|1342962_1345584_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	3.8e-41	23.3
AVG09364.1\|1345598_1347536_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.1e-61	30.6

DBSCAN-SWA_105

1355358 : 1355835

Fowlpox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09372.1\|1355358_1355835_-	glutathione peroxidase	Q70H87	Fowlpox_virus	1.1e-26	43.7

DBSCAN-SWA_106

1360838 : 1364755

Bacillus_phage(33.33%)

head,integrase

attL 1353236:1353250|attR 1365053:1365067

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1353236:1353250	attL	NA	NA	NA	NA
AVG09377.1\|1360838_1361084_-\|integrase	integrase	A0A1B1P8I7	Bacillus_phage	6.1e-10	66.0
AVG09378.1\|1361528_1362875_+\|head	phage head morphogenesis protein	A0A1J0MFV1	Staphylococcus_phage	9.1e-140	57.5
AVG09379.1\|1362880_1363072_+	LSM domain protein	NA	NA	NA	NA
AVG09380.1\|1363248_1363626_+	DUF4355 domain-containing protein	NA	NA	NA	NA
AVG09381.1\|1363632_1363821_+	hypothetical protein	NA	NA	NA	NA
AVG09382.1\|1364071_1364755_-	hypothetical protein	A0A2H4J5B8	uncultured_Caudovirales_phage	2.4e-11	50.0
1365053:1365067	attR	NA	NA	NA	NA

DBSCAN-SWA_107

1368059 : 1374459

Anomala_cuprea_entomopoxvirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09386.1\|1368059_1368944_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.4e-25	31.5
AVG09387.1\|1368940_1369672_+	ABC transporter permease	NA	NA	NA	NA
AVG09388.1\|1369671_1370766_+	sensor histidine kinase	NA	NA	NA	NA
AVG09389.1\|1370762_1371365_+	DNA-binding response regulator	NA	NA	NA	NA
AVG09390.1\|1371533_1371722_-	hypothetical protein	NA	NA	NA	NA
AVG09391.1\|1371877_1372423_+	thermonuclease	A0A1P8CWK6	Bacillus_phage	2.8e-23	47.7
AVG09392.1\|1373259_1374459_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4

DBSCAN-SWA_108

1384931 : 1390264

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09402.1\|1384931_1386446_+	catalase	A0A2K9L0T1	Tupanvirus	7.5e-90	42.8
AVG09403.1\|1386535_1386685_+	50S ribosomal protein L33	NA	NA	NA	NA
AVG09404.1\|1386850_1387120_+	30S ribosomal protein S14	NA	NA	NA	NA
AVG09405.1\|1387273_1388251_+	guanosine monophosphate reductase	Q4ZCY7	Staphylococcus_virus	5.2e-169	89.2
AVG09406.1\|1388264_1389290_+	CAP domain-containing protein	U5Q0C0	Bacillus_phage	1.5e-17	35.9
AVG09407.1\|1389643_1390264_-	LexA repressor	A0A1B2APZ1	Phage_Wrath	7.7e-17	63.8

DBSCAN-SWA_109

1394498 : 1395623

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09413.1\|1394498_1395623_+	exonuclease sbcCD subunit D	Q4Z9B9	Staphylococcus_phage	1.0e-11	25.0

DBSCAN-SWA_110

1399335 : 1400976

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09416.1\|1399335_1400976_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.6e-21	25.2

DBSCAN-SWA_111

1406094 : 1410494

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09421.1\|1406094_1408095_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	5.9e-119	41.4
AVG09422.1\|1408091_1410494_+	DNA topoisomerase 4 subunit A	G3M9Z5	Bacillus_virus	1.3e-104	33.8

DBSCAN-SWA_112

1420048 : 1421311

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09430.1\|1420048_1421311_+	DNA repair protein	O64031	Bacillus_phage	1.5e-96	45.0

DBSCAN-SWA_113

1424532 : 1426097

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09433.1\|1424532_1425099_+	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.3e-23	34.7
AVG09434.1\|1425101_1426097_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.7e-29	31.1

DBSCAN-SWA_114

1435108 : 1442581

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09444.1\|1435108_1435798_-	peptide ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	3.0e-14	27.9
AVG09445.1\|1435800_1436577_-	ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	4.0e-07	23.9
AVG09446.1\|1436539_1437394_-	ABC transporter permease	NA	NA	NA	NA
AVG09447.1\|1437383_1438403_-	ABC transporter permease	NA	NA	NA	NA
AVG09448.1\|1438563_1438899_-	hypothetical protein	NA	NA	NA	NA
AVG09449.1\|1439146_1440958_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	3.8e-149	46.1
AVG09450.1\|1441051_1441699_-	phosphate transport system regulatory protein PhoU	NA	NA	NA	NA
AVG09451.1\|1441705_1442581_-	phosphate ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.4e-16	30.1

DBSCAN-SWA_115

1447406 : 1449014

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09456.1\|1447406_1449014_+	ABC transporter ATP-binding protein	A0A1V0SKJ1	Klosneuvirus	9.5e-51	25.5

DBSCAN-SWA_116

1456623 : 1461576

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09464.1\|1456623_1457889_+	diaminopimelate decarboxylase	A0A0P0YM38	Yellowstone_lake_phycodnavirus	5.8e-11	24.3
AVG09465.1\|1458437_1458650_+	hypothetical protein	NA	NA	NA	NA
AVG09466.1\|1458639_1458840_-	cold-shock protein CspA	Q9AZD3	Lactococcus_phage	2.5e-17	64.6
AVG09467.1\|1459020_1459329_-	DUF1033 domain-containing protein	NA	NA	NA	NA
AVG09468.1\|1459487_1459757_+	acylphosphatase	NA	NA	NA	NA
AVG09469.1\|1459796_1460423_+	5-bromo-4-chloroindolyl phosphate hydrolase	NA	NA	NA	NA
AVG09470.1\|1460445_1461576_+	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	2.5e-29	25.8

DBSCAN-SWA_117

1465083 : 1465875

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09473.1\|1465083_1465875_-	MoxR family ATPase	R4TG24	Halovirus	1.4e-10	28.5

DBSCAN-SWA_118

1473489 : 1474149

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09481.1\|1473489_1474149_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-34	34.0

DBSCAN-SWA_119

1481228 : 1496060

Staphylococcus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09488.1\|1481228_1482320_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-20	32.6
AVG09489.1\|1482670_1483285_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AVG09490.1\|1483297_1484371_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
AVG09491.1\|1484388_1484892_-	N-acetyltransferase	NA	NA	NA	NA
AVG09492.1\|1484927_1485080_+	hypothetical protein	NA	NA	NA	NA
AVG09493.1\|1485226_1486702_-	PDZ domain-containing protein	A0A0R6PIZ1	Moraxella_phage	1.4e-24	29.6
AVG09494.1\|1487046_1487271_-	YozE family protein	NA	NA	NA	NA
AVG09495.1\|1487270_1487771_-	glucose-specific phosphotransferase enzyme IIA component	NA	NA	NA	NA
AVG09496.1\|1487783_1488212_-	peptide-methionine (R)-S-oxide reductase	NA	NA	NA	NA
AVG09497.1\|1488208_1488733_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AVG09498.1\|1488835_1489684_-	fatty acid-binding protein DegV	A0A0N9SI50	Staphylococcus_phage	1.5e-63	98.4
AVG09499.1\|1489693_1490179_-	trimethoprim-resistant dihydrofolate reductase DfrC	A0A0N9S8H6	Staphylococcus_phage	9.1e-90	98.1
AVG09500.1\|1490220_1491177_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.1e-190	100.0
AVG09501.1\|1491490_1492153_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-28	37.0
AVG09502.1\|1492168_1493218_-	ABC transporter permease	NA	NA	NA	NA
AVG09503.1\|1493429_1493867_-	BrxA/BrxB family bacilliredoxin	NA	NA	NA	NA
AVG09504.1\|1493918_1494179_-	scaffolding protein	NA	NA	NA	NA
AVG09505.1\|1494190_1494385_-	zinc-finger domain-containing protein	NA	NA	NA	NA
AVG09506.1\|1494635_1495340_+	hypothetical protein	A0A2H4J2N7	uncultured_Caudovirales_phage	8.4e-12	26.0
AVG09507.1\|1495664_1496060_+	ribonuclease H	A0A076FI68	Aureococcus_anophage	7.3e-05	26.7

DBSCAN-SWA_120

1534672 : 1536553

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09513.1\|1534672_1535239_-	DUF1273 domain-containing protein	U5J9F7	Bacillus_phage	1.6e-05	22.5
AVG09514.1\|1535250_1535583_-	DUF1798 domain-containing protein	NA	NA	NA	NA
AVG09515.1\|1535926_1536553_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	5.0e-24	34.3

DBSCAN-SWA_121

1539959 : 1547045

Temperate_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09519.1\|1539959_1540646_-	DNA replication protein DnaD	Q938N2	Temperate_phage	1.5e-08	36.5
AVG09520.1\|1540738_1542031_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	3.5e-56	30.3
AVG09521.1\|1542151_1544860_-	ATP-dependent helicase DinG	A0A1X9I5C8	Streptococcus_phage	1.1e-43	31.5
AVG09522.1\|1544884_1545856_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AVG09523.1\|1545842_1547045_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	2.7e-34	40.3

DBSCAN-SWA_122

1555916 : 1559505

Anguillid_herpesvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09533.1\|1555916_1556396_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	4.0e-29	42.1
AVG09534.1\|1556505_1557525_-	heptaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	3.2e-12	26.4
AVG09535.1\|1557466_1558192_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
AVG09536.1\|1558184_1558763_-	heptaprenyl pyrophosphate synthase subunit A	NA	NA	NA	NA
AVG09537.1\|1559232_1559505_-	DNA-binding protein HU	A7KV42	Bacillus_phage	4.2e-28	73.3

DBSCAN-SWA_123

1568446 : 1580965

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09545.1\|1568446_1569826_-	ATP-dependent DNA helicase RecQ	M1PGQ0	Moumouvirus	2.9e-56	33.5
AVG09546.1\|1569812_1570775_-	hypothetical protein	NA	NA	NA	NA
AVG09547.1\|1570883_1571132_+	ferredoxin	A0A127AYY7	Bacillus_phage	6.8e-17	52.0
AVG09548.1\|1571223_1571328_-	hypothetical protein	NA	NA	NA	NA
AVG09549.1\|1571536_1572076_-	ECF transporter S component	NA	NA	NA	NA
AVG09550.1\|1572667_1574434_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-33	33.7
AVG09551.1\|1574417_1575143_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.3e-47	42.2
AVG09552.1\|1575276_1576014_-	rRNA pseudouridine synthase	NA	NA	NA	NA
AVG09553.1\|1576006_1576549_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.3e-09	32.5
AVG09554.1\|1576541_1577342_-	segregation/condensation protein A	NA	NA	NA	NA
AVG09555.1\|1577370_1577895_+	DUF309 domain-containing protein	NA	NA	NA	NA
AVG09556.1\|1577947_1578835_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	3.9e-38	31.4
AVG09557.1\|1578877_1579327_-	transcriptional repressor	NA	NA	NA	NA
AVG09558.1\|1579431_1579974_-	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AVG09559.1\|1580056_1580965_+	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	2.6e-05	33.9

DBSCAN-SWA_124

1584315 : 1585800

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09563.1\|1584315_1585800_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	6.9e-80	37.4

DBSCAN-SWA_125

1588969 : 1590376

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09566.1\|1588969_1590376_-	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	A0A222YX62	Synechococcus_phage	2.2e-27	29.8

DBSCAN-SWA_126

1596910 : 1603470

Erysipelothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09573.1\|1596910_1598332_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	6.0e-41	27.4
AVG09574.1\|1598591_1600268_-	DNA repair protein RecN	NA	NA	NA	NA
AVG09575.1\|1600283_1600736_-	arginine repressor	NA	NA	NA	NA
AVG09576.1\|1601050_1601932_-	polyprenyl synthetase family protein	A0A1V0SE37	Indivirus	4.4e-10	27.2
AVG09577.1\|1601909_1602140_-	exodeoxyribonuclease 7 small subunit	NA	NA	NA	NA
AVG09578.1\|1602132_1603470_-	exodeoxyribonuclease VII large subunit	A0A1V0SIT1	Klosneuvirus	1.3e-42	35.7

DBSCAN-SWA_127

1615537 : 1618385

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09592.1\|1615537_1617046_-	glycine dehydrogenase subunit 2	E3ST28	Prochlorococcus_phage	6.3e-81	42.0
AVG09593.1\|1617038_1618385_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-62	37.6

DBSCAN-SWA_128

1623917 : 1624541

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09602.1\|1623917_1624541_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	7.7e-33	39.3

DBSCAN-SWA_129

1630976 : 1645035

Bacillus_thuringiensis_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09611.1\|1630976_1631576_-	superoxide dismutase [Mn/Fe]	Q56AR7	Bacillus_thuringiensis_phage	2.4e-60	55.2
AVG09612.1\|1631988_1632408_-	transcriptional repressor	NA	NA	NA	NA
AVG09613.1\|1632410_1633259_-	metal ABC transporter permease	NA	NA	NA	NA
AVG09614.1\|1633292_1634084_-	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-22	29.8
AVG09615.1\|1634292_1635183_-	endonuclease	A0A2H4UU70	Bodo_saltans_virus	2.3e-22	33.2
AVG09616.1\|1635192_1636539_-	ATP-dependent helicase	A0A1V0SBR7	Catovirus	2.9e-53	33.7
AVG09617.1\|1636573_1637674_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AVG09618.1\|1637663_1638353_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
AVG09619.1\|1638507_1639614_-	RNA polymerase sigma factor SigA	F4YCU2	Synechococcus_phage	1.1e-37	37.6
AVG09620.1\|1639884_1641681_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.9e-53	35.8
AVG09621.1\|1641854_1642673_-	phosphoenolpyruvate synthase regulatory protein	NA	NA	NA	NA
AVG09622.1\|1642684_1643308_-	transcriptional regulator	NA	NA	NA	NA
AVG09623.1\|1643643_1645035_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	3.2e-47	29.0

DBSCAN-SWA_130

1648080 : 1649028

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09629.1\|1648080_1649028_-	PhoH family protein	W8D063	Erwinia_phage	8.9e-49	49.0

DBSCAN-SWA_131

1655922 : 1659018

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09637.1\|1655922_1657044_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.4e-29	27.2
AVG09638.1\|1657188_1659018_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.6e-139	47.7

DBSCAN-SWA_132

1662054 : 1668240

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09642.1\|1662054_1663878_-	elongation factor 4	A0A1S5SF82	Streptococcus_phage	2.6e-20	23.5
AVG09643.1\|1664170_1664422_+	30S ribosomal protein S20	NA	NA	NA	NA
AVG09644.1\|1664539_1665514_-	DNA polymerase III subunit delta	NA	NA	NA	NA
AVG09645.1\|1665558_1667775_-	DNA internalization-related competence protein ComEC/Rec2	Q332C0	Clostridium_botulinum_C_phage	9.1e-28	30.4
AVG09646.1\|1667778_1668240_-	ComE operon protein 2	A7KUY9	Bacillus_phage	7.9e-35	57.1

DBSCAN-SWA_133

1680991 : 1717924

uncultured_Mediterranean_phage(23.53%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09662.1\|1680991_1681474_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	6.4e-19	35.4
AVG09663.1\|1681771_1682248_-	transcription elongation factor GreA	NA	NA	NA	NA
AVG09664.1\|1682278_1682902_-	uridine kinase	A0A1V0SAA3	Catovirus	8.2e-35	40.5
AVG09665.1\|1682901_1684170_-\|protease	collagenase-like protease	Q6DW11	Phage_TP	5.2e-36	31.9
AVG09666.1\|1684187_1685111_-\|protease	collagenase-like protease	NA	NA	NA	NA
AVG09667.1\|1685113_1685749_-	O-methyltransferase	A0A2P1JQT7	Mycobacterium_phage	7.4e-07	29.3
AVG09668.1\|1686177_1686486_-	DUF1292 domain-containing protein	NA	NA	NA	NA
AVG09669.1\|1686500_1686929_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
AVG09670.1\|1686930_1687191_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
AVG09671.1\|1687254_1689885_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.7e-62	34.2
AVG09672.1\|1690213_1692646_-	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	1.1e-47	26.6
AVG09673.1\|1692647_1693316_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AVG09674.1\|1693478_1694597_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AVG09675.1\|1694596_1695739_-	cysteine desulfurase	A0A141ZJV0	Faustovirus	1.5e-26	28.0
AVG09676.1\|1695981_1696977_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
AVG09677.1\|1697176_1697320_-	hypothetical protein	NA	NA	NA	NA
AVG09678.1\|1697505_1697928_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
AVG09679.1\|1698004_1699285_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	2.4e-105	51.1
AVG09680.1\|1699477_1700254_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AVG09681.1\|1700809_1702576_-\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	3.4e-17	22.4
AVG09682.1\|1702578_1703853_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AVG09683.1\|1704224_1705100_-	cell wall amidase	A0A0N9SGH1	Paenibacillus_phage	6.2e-12	32.4
AVG09684.1\|1705096_1705549_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
AVG09685.1\|1705562_1707752_-	GTP pyrophosphokinase	A0A1B1IUF0	uncultured_Mediterranean_phage	4.1e-12	38.0
AVG09686.1\|1708272_1708791_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.1e-28	46.5
AVG09687.1\|1708809_1711083_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.3e-66	29.6
AVG09688.1\|1711826_1714118_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	7.0e-31	36.6
AVG09689.1\|1714456_1714717_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	5.7e-06	44.3
AVG09690.1\|1714732_1715872_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-83	44.4
AVG09691.1\|1715892_1716957_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AVG09692.1\|1716919_1717924_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.7e-05	29.1

DBSCAN-SWA_134

1727239 : 1729870

Catovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09707.1\|1727239_1729870_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	7.5e-154	40.9

DBSCAN-SWA_135

1739310 : 1750803

Bacillus_virus(20.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09717.1\|1739310_1740573_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.7e-141	61.7
AVG09718.1\|1740859_1742161_-	trigger factor	NA	NA	NA	NA
AVG09719.1\|1742321_1743245_-	hypothetical protein	NA	NA	NA	NA
AVG09720.1\|1743261_1743873_-	NUDIX domain-containing protein	A0A060AB76	Staphylococcus_phage	8.1e-19	34.4
AVG09721.1\|1744290_1744647_-	50S ribosomal protein L20	NA	NA	NA	NA
AVG09722.1\|1744698_1744899_-	50S ribosomal protein L35	NA	NA	NA	NA
AVG09723.1\|1744926_1745454_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-11	33.8
AVG09724.1\|1745661_1747164_-	amino acid permease	NA	NA	NA	NA
AVG09725.1\|1747592_1749530_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.9e-115	36.7
AVG09726.1\|1749882_1750803_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	3.4e-29	31.2

DBSCAN-SWA_136

1755659 : 1763464

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09731.1\|1755659_1756532_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.2e-44	39.3
AVG09732.1\|1756547_1759259_-	DNA polymerase I	A8E2B3	Enterococcus_phage	1.1e-46	33.4
AVG09733.1\|1759472_1761170_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	6.1e-32	36.7
AVG09734.1\|1761169_1761880_-	DNA-binding response regulator	Q6XM27	Feldmannia_irregularis_virus	1.4e-06	29.5
AVG09735.1\|1762195_1763464_-	isocitrate dehydrogenase (NADP(+))	Q77Z09	Phage_21	9.2e-09	55.6

DBSCAN-SWA_137

1766714 : 1768472

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09738.1\|1766714_1768472_-	pyruvate kinase	A0A2H4PQU5	Staphylococcus_phage	2.7e-35	84.4

DBSCAN-SWA_138

1773074 : 1776272

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09743.1\|1773074_1776272_-	DNA polymerase III subunit alpha	A0A291AWR1	Streptomyces_phage	2.0e-129	31.0

DBSCAN-SWA_139

1793900 : 1798040

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09761.1\|1793900_1794647_-	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	3.4e-19	31.6
AVG09762.1\|1794724_1795165_+	SACOL1771 family peroxiredoxin	NA	NA	NA	NA
AVG09763.1\|1795291_1796455_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
AVG09764.1\|1796444_1798040_+	phosphoglycerate dehydrogenase	A0A2H4PQU8	Staphylococcus_phage	8.7e-73	63.6

DBSCAN-SWA_140

1801924 : 1804619

uncultured_Mediterranean_phage(50.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09768.1\|1801924_1803163_+\|protease	serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	1.8e-09	27.9
AVG09769.1\|1803353_1804619_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	9.6e-83	41.9

DBSCAN-SWA_141

1814076 : 1819080

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09777.1\|1814076_1817586_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.0e-81	46.4
AVG09778.1\|1817606_1818203_-	DUF4479 domain-containing protein	NA	NA	NA	NA
AVG09779.1\|1818225_1819080_-	DUF1444 domain-containing protein	A0A2H4PQY3	Staphylococcus_phage	2.8e-62	85.4

DBSCAN-SWA_142

1828658 : 1878307

Staphylococcus_phage(81.82%)

integrase,tRNA,transposase

attL 1821525:1821541|attR 1881116:1881132

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1821525:1821541	attL	NA	NA	NA	NA
AVG09790.1\|1828658_1829921_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	1.8e-41	76.0
AVG09791.1\|1830292_1841371_-	YSIRK signal domain/LPXTG anchor domain surface protein	A0A2H4PQU6	Staphylococcus_phage	5.4e-28	25.6
AVG09792.1\|1841775_1842087_-	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	4.1e-35	71.8
AVG09793.1\|1842112_1844557_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	87.4
AVG09794.1\|1844818_1846033_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	4.6e-183	83.7
AVG09795.1\|1846139_1847093_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-67	84.7
AVG09796.1\|1847089_1847653_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	1.9e-67	66.5
AVG09797.1\|1847824_1849024_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG09798.1\|1849448_1849850_-	transcriptional regulator	NA	NA	NA	NA
AVG09799.1\|1850339_1851167_-	alpha/beta hydrolase	NA	NA	NA	NA
AVG09800.1\|1851409_1852411_+	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.5e-131	70.0
AVG09801.1\|1852458_1852920_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-59	84.2
AVG09802.1\|1852932_1854114_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.8e-176	75.3
AVG09803.1\|1854126_1854759_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.5e-87	77.1
AVG09804.1\|1854765_1855809_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.4e-134	66.5
AVG09805.1\|1856245_1857739_-	pyridine nucleotide-disulfide oxidoreductase	A0A2H4PQX2	Staphylococcus_phage	2.5e-13	65.6
AVG09806.1\|1858077_1858929_-	autolysin	A0A1J0MFB0	Staphylococcus_phage	1.0e-32	35.6
AVG09807.1\|1859306_1859522_-	hypothetical protein	NA	NA	NA	NA
AVG09808.1\|1859554_1859674_+	hypothetical protein	NA	NA	NA	NA
AVG09809.1\|1859729_1860209_+	sigma-70 family RNA polymerase sigma factor	A0A2H4PQT5	Staphylococcus_phage	2.7e-25	42.3
AVG09810.1\|1860214_1860658_+	competence protein ComK	NA	NA	NA	NA
AVG09811.1\|1860644_1861088_-	hypothetical protein	A0A2H4PQT8	Staphylococcus_phage	3.1e-20	42.9
AVG09812.1\|1861227_1861941_-	transaldolase	M1PR54	Cyanophage	4.1e-22	37.4
AVG09813.1\|1862217_1862526_+	hypothetical protein	NA	NA	NA	NA
AVG09814.1\|1862564_1862930_+	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	4.1e-34	57.0
AVG09815.1\|1862926_1863280_+	camphor resistance protein CrcB	A0A2H4PQQ7	Staphylococcus_phage	8.5e-05	32.5
AVG09816.1\|1864046_1864883_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.1e-110	68.6
AVG09817.1\|1865062_1865971_-	hypothetical protein	A0A2H4PQQ8	Staphylococcus_phage	1.8e-102	80.6
AVG09818.1\|1866073_1867273_-	S-adenosylmethionine synthase	A0A2H4PQS6	Staphylococcus_phage	4.1e-192	85.4
AVG09819.1\|1867642_1869235_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	2.7e-268	83.2
AVG09820.1\|1869465_1870251_-	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	2.0e-99	71.3
AVG09821.1\|1870237_1870714_-	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	1.5e-44	58.7
AVG09822.1\|1870772_1871024_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.9e-35	81.9
AVG09823.1\|1871020_1872022_-	o-succinylbenzoate synthase	A0A2H4PQM0	Staphylococcus_phage	6.9e-92	50.2
AVG09824.1\|1872011_1873436_-	2-succinylbenzoate-CoA ligase	A0A2H4PQM9	Staphylococcus_phage	6.6e-173	63.9
AVG09825.1\|1874445_1874592_+	hypothetical protein	NA	NA	NA	NA
AVG09826.1\|1874686_1875352_+	hypothetical protein	A0A2H4J5B8	uncultured_Caudovirales_phage	7.0e-08	41.8
AVG09827.1\|1875513_1875801_+	hypothetical protein	A0A2H4JGN1	uncultured_Caudovirales_phage	5.5e-18	50.0
AVG09828.1\|1876090_1876246_+	hypothetical protein	NA	NA	NA	NA
AVG09829.1\|1876327_1877062_+	hypothetical protein	NA	NA	NA	NA
AVG09830.1\|1877441_1877654_-	hypothetical protein	A0A2H4JCA1	uncultured_Caudovirales_phage	7.3e-20	72.9
AVG09831.1\|1877812_1878307_+\|integrase	site-specific integrase	B7T092	Staphylococcus_virus	3.8e-67	76.1
1881116:1881132	attR	NA	NA	NA	NA

DBSCAN-SWA_143

1887114 : 1887855

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09840.1\|1887114_1887855_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.0e-25	28.4

DBSCAN-SWA_144

1896523 : 1899611

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09849.1\|1896523_1896868_-	YlbF/YmcA family competence regulator	A0A1X9I5Y8	Streptococcus_phage	5.8e-06	30.6
AVG09850.1\|1896940_1898071_-	DUF445 domain-containing protein	NA	NA	NA	NA
AVG09851.1\|1898252_1898717_-	transcriptional regulator	NA	NA	NA	NA
AVG09852.1\|1898987_1899611_-	DNA-binding response regulator	A0A1V0SGR9	Hokovirus	5.2e-05	28.2

DBSCAN-SWA_145

1907629 : 1912173

Planktothrix_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09861.1\|1907629_1908358_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-34	41.5
AVG09862.1\|1908344_1909802_-	glutamate ABC transporter permease	NA	NA	NA	NA
AVG09863.1\|1910040_1911099_-	PTS transporter subunit IIC	NA	NA	NA	NA
AVG09864.1\|1911324_1912173_-\|protease	serine protease	A0A2H4PQN3	Staphylococcus_phage	3.5e-20	31.9

DBSCAN-SWA_146

1925568 : 1929239

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09870.1\|1925568_1927305_-	multidrug ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-48	28.4
AVG09871.1\|1927546_1928089_-	DUF402 domain-containing protein	NA	NA	NA	NA
AVG09872.1\|1928195_1929239_-	A/G-specific adenine glycosylase	G3CB03	Aeropyrum_pernix_spindle-shaped_virus	2.1e-22	28.9

DBSCAN-SWA_147

1942551 : 1943181

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09888.1\|1942551_1943181_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-05	27.4

DBSCAN-SWA_148

1951467 : 1956519

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09898.1\|1951467_1952022_+	DNA polymerase III subunit epsilon	B5WZL1	Staphylococcus_phage	2.3e-33	42.0
AVG09899.1\|1952052_1953123_-	DNA polymerase IV	NA	NA	NA	NA
AVG09900.1\|1953432_1953981_-	DUF3267 domain-containing protein	NA	NA	NA	NA
AVG09901.1\|1954118_1955537_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A1X9I6F4	Streptococcus_phage	1.2e-102	41.8
AVG09902.1\|1955568_1956519_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.8e-17	27.1

DBSCAN-SWA_149

1963413 : 1973903

Bacillus_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09908.1\|1963413_1965411_-	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	1.2e-111	37.3
AVG09909.1\|1965414_1967604_-	DNA helicase PcrA	A7KV33	Bacillus_phage	1.0e-132	41.1
AVG09910.1\|1967600_1968293_-	geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase	NA	NA	NA	NA
AVG09911.1\|1968616_1968919_-	hypothetical protein	NA	NA	NA	NA
AVG09912.1\|1969043_1970339_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.1e-16	32.6
AVG09913.1\|1970750_1970942_-	NETI motif-containing protein	NA	NA	NA	NA
AVG09914.1\|1970913_1971540_-	DUF2179 domain-containing protein	NA	NA	NA	NA
AVG09915.1\|1971613_1972441_-	NAD(+) synthetase	G3MA24	Bacillus_virus	7.2e-63	51.2
AVG09916.1\|1972433_1973903_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	4.1e-109	46.2

DBSCAN-SWA_150

1984739 : 1986308

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09927.1\|1984739_1985585_+	penicillin-hydrolyzing class A beta-lactamase BlaZ	A0A1B0VBP7	Salmonella_phage	3.4e-31	34.3
AVG09928.1\|1985888_1986308_+	YolD-like family protein	U3PG23	Staphylococcus_phage	3.1e-30	53.5

DBSCAN-SWA_151

1990165 : 1991317

Streptococcus_pyogenes_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09931.1\|1990165_1991317_-\|transposase	transposase	P97010	Streptococcus_pyogenes_phage	1.8e-11	31.6

DBSCAN-SWA_152

1997073 : 1999521

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09938.1\|1997073_1997946_-	phenol-soluble modulin export ABC transporter ATP-binding protein PmtC	A0A2H4PQG7	Staphylococcus_phage	1.7e-25	34.3
AVG09939.1\|1997966_1998626_-	phenol-soluble modulin export ABC transporter permease subunit PmtB	NA	NA	NA	NA
AVG09940.1\|1998606_1999521_-	phenol-soluble modulin export ABC transporter ATP-binding protein PmtA	W6JKT0	Anomala_cuprea_entomopoxvirus	2.1e-18	30.7

DBSCAN-SWA_153

2004029 : 2005989

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09944.1\|2004029_2005649_-	molecular chaperone GroEL	A0A240F779	uncultured_virus	4.4e-157	54.0
AVG09945.1\|2005704_2005989_-	co-chaperone GroES	A0A221S386	uncultured_virus	1.5e-12	43.0

DBSCAN-SWA_154

2012263 : 2018085

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09952.1\|2012263_2012980_+	DNA-binding response regulator	A0A2H4J4Z6	uncultured_Caudovirales_phage	1.1e-27	33.9
AVG09953.1\|2013047_2014007_-	carbohydrate kinase	NA	NA	NA	NA
AVG09954.1\|2014013_2015486_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	2.1e-20	26.7
AVG09955.1\|2015651_2015744_-	hypothetical protein	NA	NA	NA	NA
AVG09956.1\|2015745_2016699_-	LacI family transcriptional regulator	NA	NA	NA	NA
AVG09957.1\|2016834_2018085_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	9.7e-35	29.7

DBSCAN-SWA_155

2021337 : 2026335

Bodo_saltans_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09962.1\|2021337_2023272_+	ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	3.4e-47	26.9
AVG09963.1\|2023613_2025230_+	DNA mismatch repair protein MutS	A0A1B1IS82	uncultured_Mediterranean_phage	2.5e-19	26.5
AVG09964.1\|2025312_2026335_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.9e-62	39.9

DBSCAN-SWA_156

2030044 : 2034709

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09969.1\|2030044_2031796_+	acetolactate synthase, large subunit, biosynthetic type	E5EQ70	Micromonas_sp._RCC1109_virus	3.0e-66	30.9
AVG09970.1\|2031795_2032029_+	acetolactate synthase	NA	NA	NA	NA
AVG09971.1\|2032146_2033151_+	ketol-acid reductoisomerase	NA	NA	NA	NA
AVG09972.1\|2033173_2034709_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.7e-12	29.2

DBSCAN-SWA_157

2048193 : 2051555

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09979.1\|2048193_2048964_-	RNA polymerase sigma factor SigB	A0A0A0RNH9	Bacillus_phage	4.1e-20	34.7
AVG09980.1\|2048938_2049418_-	anti-sigma B factor RsbW	NA	NA	NA	NA
AVG09981.1\|2049419_2049746_-	anti-anti-sigma factor	NA	NA	NA	NA
AVG09982.1\|2049845_2050847_-	serine/threonine protein phosphatase	NA	NA	NA	NA
AVG09983.1\|2051192_2051555_-	mRNA interferase MazF	Q332J9	Clostridium_botulinum_C_phage	6.5e-08	33.6

DBSCAN-SWA_158

2056145 : 2057675

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09990.1\|2056145_2057675_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.9e-58	34.2

DBSCAN-SWA_159

2064744 : 2065398

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG09998.1\|2064744_2065398_+	HD domain-containing protein	H2ED17	Moumouvirus	1.0e-11	30.6

DBSCAN-SWA_160

2070723 : 2071119

Listeria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10004.1\|2070723_2071119_-	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.1e-16	35.0

DBSCAN-SWA_161

2081302 : 2089148

Catovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10018.1\|2081302_2082451_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	2.6e-26	28.8
AVG10019.1\|2082472_2083102_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AVG10020.1\|2083130_2084369_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.8e-102	54.0
AVG10021.1\|2084393_2084918_-	TIGR01440 family protein	NA	NA	NA	NA
AVG10022.1\|2085027_2085447_-	protein-tyrosine-phosphatase	NA	NA	NA	NA
AVG10023.1\|2085443_2086487_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	7.3e-44	37.9
AVG10024.1\|2086462_2086600_-	hypothetical protein	NA	NA	NA	NA
AVG10025.1\|2086649_2087486_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
AVG10026.1\|2087472_2088549_-	peptide chain release factor 1	NA	NA	NA	NA
AVG10027.1\|2088548_2089148_-	thymidine kinase	G3MBK1	Bacillus_virus	4.3e-33	42.4

DBSCAN-SWA_162

2093166 : 2094366

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10031.1\|2093166_2094366_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4

DBSCAN-SWA_163

2098290 : 2099898

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10035.1\|2098290_2099898_-	CTP synthetase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.4e-149	50.4

DBSCAN-SWA_164

2108675 : 2112159

Geobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10045.1\|2108675_2109977_-	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.2e-133	58.6
AVG10046.1\|2110009_2110672_-	2-deoxyribose-5-phosphate aldolase	NA	NA	NA	NA
AVG10047.1\|2110878_2111589_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
AVG10048.1\|2111712_2112159_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.1e-28	44.5

DBSCAN-SWA_165

2117519 : 2118491

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10057.1\|2117519_2118491_+	cation transporter	A0A1V0SED0	Indivirus	3.5e-24	27.3

DBSCAN-SWA_166

2122423 : 2124229

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10061.1\|2122423_2124229_-	glutamine--fructose-6-phosphate aminotransferase	M1H1Z3	Paramecium_bursaria_Chlorella_virus	1.7e-101	40.3

DBSCAN-SWA_167

2144391 : 2145357

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10075.1\|2144391_2145357_-	iron-dicitrate transporter subunit FecD	A0A2H4IY97	uncultured_Caudovirales_phage	2.9e-15	29.3

DBSCAN-SWA_168

2168181 : 2173564

Orpheovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10097.1\|2168181_2168922_+	NAD-dependent protein deacetylase	A0A2I2L319	Orpheovirus	1.8e-17	30.8
AVG10098.1\|2169184_2169583_-	30S ribosomal protein S9	NA	NA	NA	NA
AVG10099.1\|2169596_2170034_-	50S ribosomal protein L13	NA	NA	NA	NA
AVG10100.1\|2170294_2171098_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AVG10101.1\|2171101_2171908_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AVG10102.1\|2171897_2172758_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	4.3e-10	22.1
AVG10103.1\|2172754_2173564_-	energy-coupling factor transporter ATPase	G3M9Y6	Bacillus_virus	4.2e-15	27.0

DBSCAN-SWA_169

2188624 : 2189959

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10134.1\|2188624_2189959_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.7e-50	33.2

DBSCAN-SWA_170

2196254 : 2199410

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10141.1\|2196254_2199410_-	AcrB/AcrD/AcrF family protein	S5VTK5	Leptospira_phage	1.4e-66	22.8

DBSCAN-SWA_171

2204625 : 2205825

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10145.1\|2204625_2205825_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4

DBSCAN-SWA_172

2213172 : 2213793

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10156.1\|2213172_2213793_-	molybdenum ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-21	35.6

DBSCAN-SWA_173

2237731 : 2241109

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10184.1\|2237731_2238685_+	hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	1.2e-32	31.0
AVG10185.1\|2238825_2239950_-	hypothetical protein	NA	NA	NA	NA
AVG10186.1\|2240332_2241109_-	autolysin	H9A0W8	Staphylococcus_phage	8.4e-37	39.4

DBSCAN-SWA_174

2262540 : 2263422

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10208.1\|2262540_2263422_-	NAD(P)-dependent dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.8e-58	43.8

DBSCAN-SWA_175

2287054 : 2288266

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10233.1\|2287054_2288266_-	Bcr/CflA family drug resistance efflux transporter	S4TR35	Salmonella_phage	2.1e-34	28.2

DBSCAN-SWA_176

2291802 : 2294329

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10238.1\|2291802_2292471_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-37	40.4
AVG10239.1\|2292470_2293523_-	heme ABC transporter permease	NA	NA	NA	NA
AVG10240.1\|2293654_2294329_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.2e-54	47.9

DBSCAN-SWA_177

2303519 : 2305685

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10247.1\|2303519_2305685_-	CDP-glycerol:glycerophosphate glycerophosphotransferase	A0A1V0SAH6	Catovirus	4.3e-06	38.7

DBSCAN-SWA_178

2327623 : 2388658

Streptococcus_phage(22.22%)

protease,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10271.1\|2327623_2329177_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	4.4e-21	46.8
AVG10272.1\|2331454_2332654_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-63	37.4
AVG10273.1\|2332841_2334410_-	hypothetical protein	NA	NA	NA	NA
AVG10274.1\|2334589_2335525_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AVG10275.1\|2335515_2335830_-	nitrite reductase (NAD(P)H) small subunit	NA	NA	NA	NA
AVG10276.1\|2335832_2338238_-	nitrite reductase large subunit	NA	NA	NA	NA
AVG10277.1\|2339515_2340235_-	sirohydrochlorin chelatase	NA	NA	NA	NA
AVG10278.1\|2340224_2340332_-	hypothetical protein	NA	NA	NA	NA
AVG10279.1\|2340484_2341960_+	nickel ABC transporter substrate-binding protein	NA	NA	NA	NA
AVG10280.1\|2342177_2342714_-	N-acetyltransferase	NA	NA	NA	NA
AVG10281.1\|2343156_2343978_-	formate/nitrite transporter	NA	NA	NA	NA
AVG10282.1\|2344212_2344683_-	SRPBCC domain-containing protein	NA	NA	NA	NA
AVG10283.1\|2344964_2345561_-	glutaredoxin	NA	NA	NA	NA
AVG10284.1\|2345584_2345953_-	cystatin-like fold lipoprotein	NA	NA	NA	NA
AVG10285.1\|2346306_2347554_+	aminoacyltransferase	NA	NA	NA	NA
AVG10286.1\|2348239_2348971_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-29	39.2
AVG10287.1\|2348967_2349687_-	amino acid ABC transporter permease	NA	NA	NA	NA
AVG10288.1\|2349667_2350456_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AVG10289.1\|2350670_2350775_+	hypothetical protein	NA	NA	NA	NA
AVG10290.1\|2350960_2351647_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AVG10291.1\|2351922_2352810_-	cation transporter	NA	NA	NA	NA
AVG10292.1\|2353094_2353481_-	GtrA family protein	NA	NA	NA	NA
AVG10293.1\|2353501_2354974_-	hypothetical protein	NA	NA	NA	NA
AVG10294.1\|2355257_2356409_+	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-49	39.5
AVG10295.1\|2356439_2357141_+	hypothetical protein	NA	NA	NA	NA
AVG10296.1\|2357401_2358604_+	MFS transporter	NA	NA	NA	NA
AVG10297.1\|2358910_2359519_+	hypothetical protein	NA	NA	NA	NA
AVG10298.1\|2359581_2360391_-	phosphohydrolase	NA	NA	NA	NA
AVG10299.1\|2360708_2362085_+	amino acid permease	NA	NA	NA	NA
AVG10300.1\|2362232_2364062_-	APC family permease	NA	NA	NA	NA
AVG10301.1\|2364348_2365866_+	serine hydrolase FLP	A0A2P1K0A5	Mycobacterium_phage	6.1e-07	23.0
AVG10302.1\|2366026_2366863_+	lipoprotein	NA	NA	NA	NA
AVG10303.1\|2366985_2367918_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AVG10304.1\|2368341_2369742_-	MFS transporter	NA	NA	NA	NA
AVG10305.1\|2370165_2371941_+	sensor protein LytS	Q9EYF3	Enterobacteria_phage	2.6e-65	30.9
AVG10306.1\|2371921_2372680_+	DNA-binding response regulator	NA	NA	NA	NA
AVG10307.1\|2372814_2373273_+\|holin	antiholin-like protein LrgA	NA	NA	NA	NA
AVG10308.1\|2373276_2373978_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
AVG10309.1\|2374159_2374855_-	ABC transporter permease	NA	NA	NA	NA
AVG10456.1\|2374854_2375748_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
AVG10310.1\|2375815_2376451_-	ABC transporter permease	NA	NA	NA	NA
AVG10311.1\|2376453_2377710_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.7e-21	53.8
AVG10312.1\|2378199_2379252_+	butanediol dehydrogenase	A0A2K9L7I1	Tupanvirus	4.5e-09	20.9
AVG10313.1\|2379851_2381531_+	APC family permease	NA	NA	NA	NA
AVG10314.1\|2381835_2383203_+	carboxylesterase/lipase family protein	NA	NA	NA	NA
AVG10315.1\|2383285_2384464_-	MFS transporter	NA	NA	NA	NA
AVG10316.1\|2384602_2385379_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AVG10317.1\|2385371_2386043_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-18	36.0
AVG10318.1\|2386145_2386898_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVG10457.1\|2387040_2387307_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVG10319.1\|2387839_2388658_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_179

2392491 : 2393310

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10324.1\|2392491_2393310_-	SDR family NAD(P)-dependent oxidoreductase	L7RG25	Acanthamoeba_polyphaga_moumouvirus	2.2e-11	26.7

DBSCAN-SWA_180

2398895 : 2408654

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10328.1\|2398895_2399588_-	SDR family NAD(P)-dependent oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	9.2e-11	27.6
AVG10329.1\|2400357_2400549_-	hypothetical protein	NA	NA	NA	NA
AVG10330.1\|2400699_2403558_-	DUF3427 domain-containing protein	Q5YA94	Bacillus_phage	1.2e-24	26.3
AVG10331.1\|2403559_2403967_-	(deoxy)nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
AVG10332.1\|2404225_2405716_-	glycosyl transferase family 1	NA	NA	NA	NA
AVG10333.1\|2405933_2407574_+	phosphoglucomutase	A0A1X9I671	Streptococcus_phage	1.5e-96	38.3
AVG10334.1\|2407787_2408654_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.7e-78	51.9

DBSCAN-SWA_181

2441118 : 2442111

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10361.1\|2441118_2442111_+	D-lactate dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.3e-39	30.7

DBSCAN-SWA_182

2451922 : 2453122

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10371.1\|2451922_2453122_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-63	37.4

DBSCAN-SWA_183

2461221 : 2468124

Acanthamoeba_polyphaga_mimivirus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10381.1\|2461221_2462202_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	2.4e-12	23.7
AVG10382.1\|2462284_2463148_-	YitT family protein	NA	NA	NA	NA
AVG10383.1\|2463315_2463642_-	thioredoxin	NA	NA	NA	NA
AVG10384.1\|2463864_2464917_+	alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.9e-15	26.7
AVG10385.1\|2464981_2465749_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVG10386.1\|2465810_2466077_-	hypothetical protein	NA	NA	NA	NA
AVG10387.1\|2466096_2468124_-	PTS glucose transporter subunit IICBA	A0A2I7SAJ6	Vibrio_phage	2.1e-07	43.3

DBSCAN-SWA_184

2476536 : 2477055

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10396.1\|2476536_2477055_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.5e-21	38.5

DBSCAN-SWA_185

2482772 : 2483642

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG10402.1\|2482772_2483642_-	KR domain-containing protein	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.5e-50	41.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP014130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12857

Cyanophage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08159.1\|855_2316_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	2.3e-72	36.1
AVG08160.1\|2425_3100_-\|transposase	IS6 family transposase IS257-1	A0A0N9RU54	Staphylococcus_phage	3.8e-126	98.2
AVG08161.1\|3573_5040_+	ABC-F type ribosomal protection protein Msr(A)	A0A2I4R674	Erysipelothrix_phage	3.9e-67	37.9
AVG08162.1\|5138_6038_+	Mph(C) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
AVG08163.1\|6523_7132_+	transposon DNA-invertase	I1ZBD6	Salisaeta_icosahedral_phage	3.7e-16	31.1
AVG08164.1\|7341_7902_-	transcriptional regulator	NA	NA	NA	NA
AVG08165.1\|8085_9630_+	QacA/B family quaternary ammonium compound efflux MFS transporter	A0A0M3UL24	Mycobacterium_phage	2.8e-31	25.3
AVG08166.1\|9834_10395_+	hypothetical protein	NA	NA	NA	NA
AVG08167.1\|10470_10593_+	hypothetical protein	NA	NA	NA	NA
AVG08168.1\|10714_11482_-	DUF536 domain-containing protein	NA	NA	NA	NA
AVG08169.1\|11921_12857_+	replication protein	Q9MCM7	Streptococcus_virus	1.5e-19	47.1

DBSCAN-SWA_2

16645 : 17320

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVG08173.1\|16645_17320_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	1.1e-117	89.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP014131

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP014132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP014130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection