CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	1 crisprs	csa3	1	2
CP026852	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed2, complete sequence	0 crisprs	RT	0	1
CP026850	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 chromosome, complete genome	0 crisprs	DinG,DEDDh,csa3,cas3,WYL,cas1,cas3f,cas8f,cas5f,cas7f,cas6f	0	352

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026851_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026851_1

65536-65670

Orphan

Consensus_repeat	Method
GTGGGACCATGGTCCCAGTTAAATCCGGCGTGTGGAATCGATATTCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026851_1

>merge|CP026851|1|65536-65670|CRISPRCasFinder
GTGGGACCATGGTCCCAGTTAAATCCGGCGTGTGGAATCGATATTCCAGGCGGGGTTGAAGGATGAGTTCTGACACGCAAGTAGGAGGTGGGACCGTGGTCCCAGTTAAATCCGGCGTGTGGAATCGATATTCCA

>CP026851|1|1|65536-65670|CRISPRCasFinder
GTGGGACCATGGTCCCAGTTAAATCCGGCGTGTGGAATCGATATTCCA	GGCGGGGTTGAAGGATGAGTTCTGACACGCAAGTAGGAG
GTGGGACCGTGGTCCCAGTTAAATCCGGCGTGTGGAATCGATATTCCA

Protein	Signature genes	Signature genes Name	Protein_function
CP026851.1\|AVF19464.1\|61071_61272_+\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19472.1\|66973_68140_-\|plasmid-partitioning-protein-SopA	unknown	unknown	gnl\|CDD\|184261
CP026851.1\|AVF19465.1\|61289_61493_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19462.1\|59231_59924_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|184255
CP026851.1\|AVF19476.1\|72049_72340_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19477.1\|72846_73821_-\|sensor-domain-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
CP026851.1\|AVF19461.1\|59013_59235_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19551.1\|75682_76591_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|225724
CP026851.1\|AVF19469.1\|63656_64088_+\|peptidase	unknown	unknown	gnl\|CDD\|182350
CP026851.1\|AVF19466.1\|61521_61785_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19468.1\|62453_63425_-\|StbA-family-protein	unknown	unknown	gnl\|CDD\|310773
CP026851.1\|AVF19471.1\|66008_66974_-\|plasmid-partitioning-protein-RepB	unknown	unknown	gnl\|CDD\|184254
CP026851.1\|AVF19479.1\|76976_77327_-\|DUF305-domain-containing-protein	unknown	unknown	gnl\|CDD\|226074
CP026851.1\|AVF19475.1\|71388_71919_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19463.1\|60447_60915_-\|hypothetical-protein	unknown	unknown	unknown
CP026851.1\|AVF19474.1\|70593_71370_-\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
CP026851.1\|AVF19478.1\|74078_75199_-\|IS3-like-element-ISSen4-family-transposase	unknown	unknown	gnl\|CDD\|372671
CP026851.1\|AVF19470.1\|64087_65359_+\|translesion-error-prone-DNA-polymerase-V-subunit-UmuC	unknown	unknown	gnl\|CDD\|179607
CP026851.1\|AVF19467.1\|61788_62451_-\|Mediator-of-plasmid-stability	unknown	unknown	gnl\|CDD\|119304
CP026851.1\|AVF19473.1\|68880_69891_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444

Protein	Function_ID	Function_description	E-value
CP026851.1\|AVF19477.1\|72846_73821_-\|sensor-domain-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.2413e-38
CP026851.1\|AVF19472.1\|66973_68140_-\|plasmid-partitioning-protein-SopA	gnl\|CDD\|184261	PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional.	0
CP026851.1\|AVF19462.1\|59231_59924_-\|DNA-methylase	gnl\|CDD\|184255	PRK13699, PRK13699, putative methylase; Provisional.	9.7575e-160
CP026851.1\|AVF19551.1\|75682_76591_+\|HNH-endonuclease	gnl\|CDD\|225724	COG3183, COG3183, Predicted restriction endonuclease [Defense mechanisms].	5.54036e-08
CP026851.1\|AVF19469.1\|63656_64088_+\|peptidase	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	1.2172e-56
CP026851.1\|AVF19468.1\|62453_63425_-\|StbA-family-protein	gnl\|CDD\|310773	pfam06406, StbA, StbA protein. This family consists of several bacterial StbA plasmid stability proteins.	6.20247e-125
CP026851.1\|AVF19471.1\|66008_66974_-\|plasmid-partitioning-protein-RepB	gnl\|CDD\|184254	PRK13698, PRK13698, ParB/RepB/Spo0J family plasmid partition protein.	0
CP026851.1\|AVF19479.1\|76976_77327_-\|DUF305-domain-containing-protein	gnl\|CDD\|226074	COG3544, COG3544, Uncharacterized protein conserved in bacteria [Function unknown].	2.67673e-22
CP026851.1\|AVF19470.1\|64087_65359_+\|translesion-error-prone-DNA-polymerase-V-subunit-UmuC	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	0
CP026851.1\|AVF19467.1\|61788_62451_-\|Mediator-of-plasmid-stability	gnl\|CDD\|119304	pfam10784, Plasmid_stab_B, Plasmid stability protein. This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterized.	4.71088e-22
CP026851.1\|AVF19478.1\|74078_75199_-\|IS3-like-element-ISSen4-family-transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	1.1889e-34
CP026851.1\|AVF19474.1\|70593_71370_-\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	9.41107e-39
CP026851.1\|AVF19473.1\|68880_69891_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	0.000207968

>CP026851.1|AVF19470.1|64087_65359_+|translesion-error-prone-DNA-polymerase-V-subunit-UmuC
MFALADVNSFYASCERVFRPDLKGKPVVVLSNNDGCVIARSAEAKPWIKMGTPWFQMKNETYPEKIYAFSSNYELYASMSARVMSCLEELAPRVEQYSIDEMFLDLTGVEHCMDLEDFGRQLRQHVYDCTRLTIGVGAGPTKTLAKSAQWASKEWKQFRGVLALTRGNPQRTRKLLSLQPVEEIWGVGNRIARKLNVLGIRTALDLALTNPAFIRKNFSVVLERTVRELNGESCMSLEEAPPTKQQIVCSRSFGEKITEYDSLRQAVCQYAERASEKLRKERQYCRHISVFIKTSPFAVKEPYYGNVATEKLLTPTQDTRDIIAAATTALERIWKDGHLYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSSELMKVLDGINHSGLGQIWFAGRGIAPSWQMKRDMLSPAYTTRWKDIPVARIR
>CP026851.1|AVF19469.1|63656_64088_+|peptidase
MKLQLFSTGKALPPQAHPLFADLASCGFPSPAADYVESDLDLHDYCIRHPSATYYLRASGDSMSDGSLYNGDLLVVDSAEKPRHGDIVVASVQGEFTVKRLLLTPRLTLQPMNAAWPPIYPDPDDLDIFGVVTHIIHRPREMY
>CP026851.1|AVF19468.1|62453_63425_-|StbA-family-protein
MNIYCDDGSTNVKLAWFEGNELQTRVSANSFRHGWKVAEFSAATFNYQVGTLKYTWDSVSRDAIPTTNVEYQYGDLNLLAVHHALLNSGLEPQPVSLTVTLPLSEYYDGDCQRNEENIRRKRENLMRELVLNKGRAFTVTDVKVMPESLPAAFSRLAELKPGPAETTLIIDLGGTTLDAGVIVGQFDDISAVHGNPSVGVSQVTRAAAGALRAADSETSALIADTVIRNRNDRQYLQRVINDAGKIDDVLNKITEAITSLGARVTSELTVFRSVNRVFLVGGGASLIEEAIRQAWPLAPDRIEVIGDPQLALAREIALYNKED
>CP026851.1|AVF19467.1|61788_62451_-|Mediator-of-plasmid-stability
MPDGQYSFYLHSDDRTDITAMATISTISQPLRGDFIRTAATAGAVMYQTDARLPALIPVFFDGHLSAIRLCAVMALVSGTWSSLSGLPDEPDGGVAALAMSPETEYQRRRYTLTLQDDRSSERVERVLTGVSSRLRGELLRNLIITGLALHTTAPELPRLLASMPVPPGTVSELQVLVQQMAGTADVSMAAVPEKPAEPAAPVSAEATSIKKNMRRAFGD
>CP026851.1|AVF19466.1|61521_61785_-|hypothetical-protein
MSVIKQKAVQCIHNFLRARNVPESQWPERVKKTGRGMILAGVAVVVPGVLVDNISLPVTIAMQVCYASLIGLGVLLAFDKKKPEGRG
>CP026851.1|AVF19465.1|61289_61493_-|hypothetical-protein
MLLEELTGDERTLVVVALQALFRERLSASNAVFTVCSLSGKEQPPEDIFGLREVEDALRRIGAAPAR
>CP026851.1|AVF19464.1|61071_61272_+|hypothetical-protein
MNPCDRSGRVSVKARRVIFYGRCKAEEKFHIKLKCDLHHKTIHYNRRKIKRLVLTAGMRCHPAVFF
>CP026851.1|AVF19463.1|60447_60915_-|hypothetical-protein
MFRLTCIELDNGEFAVYINHHYLGSEDASGERLSLGEVLEQLSLLPGVELQTLLEPVPECDDWCWNDIADRVLPSRPACRDDVTVAGLIARLKQYPPDALCMGTFWLEDDFLSLDGSLSEEEIAEAMRICDHSHDAGIGFNWDTLQFAIDHVKGR
>CP026851.1|AVF19462.1|59231_59924_-|DNA-methylase
MSRFILGDCVQVMSRFPARAVDFILTDPPYLVGYKDRTGRTLAGDNSSEWLQPACHEMYRVLKNDSLMVSFYAWNRADLFLNAWKTAGFRVVGHIVFAKSYASKSTFVGYTHESAYLLAKGRPQTPDRPIPDVIPWKYTGNRHHPTEKPVQSLRPLIESLTRPGAIVLDPFAGSGSTCVAAAEASRRYIGIEMLEQYHAAGVRRLAQVERARRMPAANDGAFYPDYPEAA
>CP026851.1|AVF19461.1|59013_59235_-|hypothetical-protein
MNYPGLENLRADVAALSNAMCDVRMLLNRLESQHRHDAATLTERMAAQTLRRINTLLLEAYREALVLDETFQD
>CP026851.1|AVF19471.1|66008_66974_-|plasmid-partitioning-protein-RepB
MKRAPVIPKHTVKDIRPETEPSAAPAAPMVDSLIARVGAMARGNTILLPVCGREVKFILEAIPGESVETASRVWSGNERDQELLTEDALDDLIPSFMLSGQQTPAFGRRVEGVIEIADGSRRRKAAILTSSDYRVLVGDLDDEQMMALSRLGNDYRPVSAYERGNRYAQRLENDFNGNISALAEAENISRKIITRCINTAHLPKSVVALFTHPGELSARSGETLYKAFSGKEALLLQRTQQLHEQKKAGVIFESEEVIGLLTDVLKEPSGKKVNLNTRHQFVPGATALYKGDKVIFNLDKSRLPAECIEKIESILRDLQKV
>CP026851.1|AVF19472.1|66973_68140_-|plasmid-partitioning-protein-SopA
MGLMETLDQCITAGHEMTKAIAIAQFNDDSPEARKITRRWRVGEAADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPDDSVPPVIAVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAEDTLLPFYLGERDDAAYAVKATCWPGLDIIPSCLALHRIETELMGRFDNGKLPTEPHMMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR
>CP026851.1|AVF19473.1|68880_69891_+|replication-initiation-protein
MAMENNELPLNLQEVNKTTGEVVKLDVNSASTVQPVALMRLGLFVPTLKSTSRSKTNRKNVTDATEELVQLSIARSEGYTDVRITGSRLDMDTDFKVWLGIIRSMYDFGVKDDTLKLSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWTTHLVQSAYYDITADVVEIRAEPKLFELYQMDRRVLLRLKAIDALQRKESAQALYTYIESLPQNPAPISMKRMRDRLNLTSNLYTQNHTVRKAMAQLKDIGYLDYTEFKRGRATYFSVHYRNPKLISSKVVVPREPEEEVPEQNYDEVIKALKAAGIDPQKLAKALASVKPGND
>CP026851.1|AVF19474.1|70593_71370_-|phage-integrase-family-protein
MMPALPGHSGAFSSAQLPVAIDYPAALALRQMALVQDELPKYLLAPEVSALLHYVPDLHRKMLLTTLWNTGARINEALALTRSDFSLAPPYPFVQLATLKQRVEKAARTAGRAPAGSQPHRNVPLSDPQYARQLEMMVATLKIPLERRNKRTGRTEKVRIWEITDRTVRTWLGEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFSMAEADAVAMLKKR
>CP026851.1|AVF19475.1|71388_71919_-|hypothetical-protein
MCKLTGFIMGLTILLGVTARDAGAATLSEMRMVNASQKPGMVIICSRTSEIPQKGESPVRIESLLRGVVLQNDGDRMMFDVTYTQRNAEESIPFRTEKYRLTTELEATRQKMAIDPETIELSLPRARGLEETFLAGMKASPVSFEDYTNYRVKSATEYLILPGPASPDAPVMHCTL
>CP026851.1|AVF19476.1|72049_72340_-|hypothetical-protein
MNMKITLSVLFEALIILGHDRVWMEESEFEHIYGYGCYREIHTWDDRTVAWWDDADDTWYLSTEVDVITPFLGPLPKKEGELSEEKCFQLMTLGRY
>CP026851.1|AVF19477.1|72846_73821_-|sensor-domain-containing-diguanylate-cyclase
MQAPGIPENEEQRLKSLYITGLLDTRDDERFERLTRLARKAFQVPVALISLLDRERQWLFACQGVGVRETPRDISFCGHAILQEGPFIIHDAAADARFHDNPLVTGEPHIRFYAGQPVSLPDGTVAGTLCLIHTVPRAFTDEDIASLRDLACIVEDEFEAINMAMTDSLTGIPNRRGFYRAGDKLFRAMNRQDASFSLIYFDLDRFKPVNDLWGHAEGDEVLKIFAGFLHQHLEPGEIAGRLGGDEFAALIRRNGNTGSYLHALSASLDHYNDTSGKPYNINYSFGELINNADQYTTLAEMIGKCDEVMYLKKKRKTLSRKTEP
>CP026851.1|AVF19478.1|74078_75199_-|IS3-like-element-ISSen4-family-transposase
MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKYGGMEVPEVKRLKSLEEENTRLKKLLAEAMLDKEALQVALGRKLLTTDQKREAVMLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN
>CP026851.1|AVF19551.1|75682_76591_+|HNH-endonuclease
MIEKICEVIDGEYVCDIDISVEEWKILLRDKKVFDDKSIAALKKWFIEPDHSCTCFDIGKKYDLHSMSANGVINGLGGRVQKQLGRFEVKGVGKIASGTKFITVMKSREIKGNPKRNLWTIREELVQAIKELDFFSTNESSSIDFYSDNDLITALEESNHFDVTQTFEYSEKAKPKKAAIEVKNGLSYPRSKSVSKNALNKADYKCEINCDHPTFRRRNSPLNYTEPHHIVPMSKQDYFENSLDVEENIISLCCNCHKQIHLGKGFEDMLRRIYAERKDVLKKAGIEILLEDLILFYKMEGN
>CP026851.1|AVF19479.1|76976_77327_-|DUF305-domain-containing-protein
MKIKNTLFVILMLSLPAISAEHSEMKMSDMHSSASSQEYMAGMKNMHEKMMAAVNESNPDKAFAKGMIAHHEGAIAMAETELKYGKDPEMRKLAQDIIKAQKGEIEQMNKWLDSHK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	100226-100264	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1315-1353	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1402-1440	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	7815-7853	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	27572-27610	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP019840	Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence	70340-70378	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	50338-50376	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	14593-14631	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	83191-83229	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	65584-65622	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	52487-52525	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP029719	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence	1341-1379	0	1.0
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	20127-20165	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	48095-48133	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	40032-40070	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	40032-40070	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	40032-40070	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP031723	Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence	50311-50349	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP042567	Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence	40032-40070	1	0.974
CP026851_1	1.1\|65584\|39\|CP026851\|CRISPRCasFinder	65584-65622	39	NZ_CP039454	Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence	72766-72804	2	0.949

1. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

2. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

3. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

4. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

5. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

6. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP019840 (Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

7. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

8. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

9. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

10. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

11. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

12. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP029719 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
***************************************

13. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

14. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

15. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

16. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

17. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

18. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP031723 (Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

19. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP042567 (Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence) position: , mismatch: 1, identity: 0.974

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
gacggggttgaaggatgagttctgacacgcaagtaggag	Protospacer
*.*************************************

20. spacer 1.1|65584|39|CP026851|CRISPRCasFinder matches to NZ_CP039454 (Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence) position: , mismatch: 2, identity: 0.949

ggcggggttgaaggatgagttctgacacgcaagtaggag	CRISPR spacer
ggcggggttgacggatgagttctgaaacgcaagtaggag	Protospacer
*********** ************* *************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7075 : 45804

Salmonella_phage(25.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19411.1\|7075_7780_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	4.9e-137	99.1
AVF19412.1\|7872_9102_+	biofilm formation regulator HmsP	NA	NA	NA	NA
AVF19413.1\|9999_10455_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AVF19414.1\|10526_10922_+	mercuric ion transporter MerT	NA	NA	NA	NA
AVF19415.1\|10937_11213_+	mercuric transporter periplasmic component	NA	NA	NA	NA
AVF19416.1\|11240_11666_+	mercury transport protein MerC	NA	NA	NA	NA
AVF19417.1\|11704_13390_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
AVF19418.1\|13407_13773_+	transcriptional regulator	NA	NA	NA	NA
AVF19419.1\|13769_14006_+	mercury resistance protein	NA	NA	NA	NA
AVF19548.1\|13989_14109_-	mercury resistance protein	NA	NA	NA	NA
AVF19420.1\|14071_14284_+	DUF3330 domain-containing protein	NA	NA	NA	NA
AVF19421.1\|14413_14971_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
AVF19422.1\|14973_17946_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
AVF19423.1\|18024_19029_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AVF19424.1\|20505_21294_-	DsbA family protein	NA	NA	NA	NA
AVF19425.1\|21322_26737_-	conjugative transfer relaxase/helicase TraI	NA	NA	NA	NA
AVF19426.1\|26733_29325_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
AVF19427.1\|29442_29754_-	hypothetical protein	NA	NA	NA	NA
AVF19428.1\|29734_29950_-	hypothetical protein	NA	NA	NA	NA
AVF19429.1\|29962_31082_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF19430.1\|31605_32946_-\|transposase	transposase	NA	NA	NA	NA
AVF19431.1\|33093_33381_-	mRNA interferase RelE	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-29	66.0
AVF19432.1\|33380_33620_-	type II toxin-antitoxin system antitoxin, RelB/DinJ family	A0A2H4JBG1	uncultured_Caudovirales_phage	9.1e-19	54.4
AVF19433.1\|33870_34236_+	hypothetical protein	NA	NA	NA	NA
AVF19434.1\|34279_35017_+	hypothetical protein	NA	NA	NA	NA
AVF19435.1\|35030_35720_+	transmembrane anchor protein	NA	NA	NA	NA
AVF19436.1\|35750_37130_-	chromate transporter	A0A219VHC2	Ochrobactrum_phage	1.6e-27	64.6
AVF19437.1\|37083_38007_-	chromate resistance protein	NA	NA	NA	NA
AVF19438.1\|38407_38779_+	hypothetical protein	NA	NA	NA	NA
AVF19439.1\|38841_39762_+	hypothetical protein	NA	NA	NA	NA
AVF19440.1\|39815_40574_+	Tat pathway signal sequence	NA	NA	NA	NA
AVF19441.1\|40807_42106_+	MFS transporter	NA	NA	NA	NA
AVF19442.1\|42211_42481_+	metal resistance protein	NA	NA	NA	NA
AVF19443.1\|43797_44208_+	hypothetical protein	NA	NA	NA	NA
AVF19444.1\|44296_44419_-	plasmid mobilization protein	NA	NA	NA	NA
AVF19445.1\|44463_45804_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

62453 : 127307

Bacillus_phage(19.05%)

transposase,integrase,protease

attL 66228:66243|attR 90764:90779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19468.1\|62453_63425_-	StbA family protein	A0A222YXF2	Escherichia_phage	1.1e-73	47.4
AVF19469.1\|63656_64088_+	peptidase	A0A1W6JNS2	Morganella_phage	1.0e-28	53.3
AVF19470.1\|64087_65359_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	2.3e-153	62.7
AVF19471.1\|66008_66974_-	plasmid partitioning protein RepB	I3WF22	Macacine_betaherpesvirus	9.8e-136	76.9
66228:66243	attL	NA	NA	NA	NA
AVF19472.1\|66973_68140_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	5.5e-218	94.3
AVF19473.1\|68880_69891_+	replication initiation protein	J9Q7H0	Salmonella_phage	6.3e-85	55.2
AVF19474.1\|70593_71370_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.0e-52	91.2
AVF19475.1\|71388_71919_-	hypothetical protein	NA	NA	NA	NA
AVF19476.1\|72049_72340_-	hypothetical protein	NA	NA	NA	NA
AVF19477.1\|72846_73821_-	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
AVF19478.1\|74078_75199_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF19551.1\|75682_76591_+	HNH endonuclease	NA	NA	NA	NA
AVF19479.1\|76976_77327_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	1.9e-20	54.3
AVF19480.1\|77470_77902_-	silver-binding protein SilE	NA	NA	NA	NA
AVF19481.1\|78152_79628_-	two-component system sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	2.1e-28	30.5
AVF19482.1\|79620_80301_-	two-component system response regulator BasR	W8CYM9	Bacillus_phage	2.1e-31	35.6
AVF19483.1\|80490_81876_+	hypothetical protein	NA	NA	NA	NA
AVF19484.1\|81904_82258_+	copper ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF19485.1\|82371_83664_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AVF19486.1\|83674_86821_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	8.0e-62	22.6
AVF19487.1\|86907_87348_+	hypothetical protein	NA	NA	NA	NA
AVF19488.1\|87474_89922_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.4e-84	35.8
AVF19489.1\|89962_90160_+	DUF2933 domain-containing protein	NA	NA	NA	NA
AVF19490.1\|90193_90931_-	peptidase M23	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
90764:90779	attR	NA	NA	NA	NA
AVF19491.1\|91219_91669_-	copper resistance protein	NA	NA	NA	NA
AVF19492.1\|91903_93721_+	multicopper oxidase PcoA	NA	NA	NA	NA
AVF19493.1\|93720_94617_+	copper resistance protein B	NA	NA	NA	NA
AVF19494.1\|94656_95037_+	copper resistance system chaperone PcoC	NA	NA	NA	NA
AVF19495.1\|95041_95971_+	copper resistance protein D	NA	NA	NA	NA
AVF19496.1\|96025_96706_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AVF19497.1\|96702_98103_+	two-component system sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	2.4e-18	26.6
AVF19498.1\|98318_98753_+	copper-binding protein	NA	NA	NA	NA
AVF19499.1\|98976_99273_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AVF19500.1\|99259_99520_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
AVF19501.1\|99661_100186_+	hypothetical protein	NA	NA	NA	NA
AVF19502.1\|100553_101324_+	conjugal transfer protein TraX	NA	NA	NA	NA
AVF19503.1\|101338_101662_+	hypothetical protein	NA	NA	NA	NA
AVF19504.1\|101639_102443_-	DUF4225 domain-containing protein	NA	NA	NA	NA
AVF19505.1\|103332_104346_-	replication initiation protein	NA	NA	NA	NA
AVF19506.1\|104381_104639_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	NA	NA	NA	NA
AVF19507.1\|104998_105265_+	DUF1778 domain-containing protein	NA	NA	NA	NA
AVF19508.1\|105252_105738_+	N-acetyltransferase	NA	NA	NA	NA
AVF19509.1\|109184_110353_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	4.8e-177	95.1
AVF19510.1\|110665_110920_+	hypothetical protein	NA	NA	NA	NA
AVF19511.1\|110919_111183_+	hypothetical protein	NA	NA	NA	NA
AVF19552.1\|111404_111686_+	DNA-binding protein	NA	NA	NA	NA
AVF19512.1\|111720_112290_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AVF19513.1\|112395_115245_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	2.6e-128	41.1
AVF19514.1\|115244_115436_+	hypothetical protein	NA	NA	NA	NA
AVF19553.1\|116183_116324_+	hypothetical protein	NA	NA	NA	NA
AVF19515.1\|116411_116870_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AVF19516.1\|116892_117807_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AVF19517.1\|117909_118797_+	hypothetical protein	NA	NA	NA	NA
AVF19518.1\|118886_119498_+	HdeD family acid-resistance protein	NA	NA	NA	NA
AVF19519.1\|119577_120723_+	hypothetical protein	NA	NA	NA	NA
AVF19520.1\|120712_121153_+	thioredoxin TrxC	A0A023NHA9	Dinoroseobacter_phage	5.8e-11	34.7
AVF19521.1\|121156_122866_+	sodium:proton exchanger	NA	NA	NA	NA
AVF19522.1\|122868_123366_+	phosphate-starvation-inducible E family protein	NA	NA	NA	NA
AVF19523.1\|123343_124291_+\|protease	Zn-dependent protease	NA	NA	NA	NA
AVF19524.1\|124315_125467_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	7.5e-26	30.3
AVF19525.1\|126311_127307_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.8e-20	28.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP026852

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22772 : 39489

Escherichia_phage(25.0%)

integrase,transposase

attL 17211:17225|attR 35158:35172

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
17211:17225	attL	NA	NA	NA	NA
AVF19583.1\|22772_23549_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.4e-52	92.0
AVF19584.1\|23606_23864_-	hypothetical protein	NA	NA	NA	NA
AVF19585.1\|24631_25498_+	replication initiation protein	A0A222YYK1	Escherichia_phage	2.6e-23	31.1
AVF19586.1\|26423_27629_+	ParA family protein	A0A077SL49	Escherichia_phage	1.2e-162	69.1
AVF19587.1\|27625_28603_+	chromosome partitioning protein ParB	Q38420	Escherichia_phage	1.1e-86	54.1
AVF19588.1\|28684_29956_-	DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	5.4e-150	63.0
AVF19589.1\|29955_30387_-	peptidase	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
AVF19590.1\|30544_30796_+	hypothetical protein	NA	NA	NA	NA
AVF19591.1\|30795_32280_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AVF19592.1\|32627_33596_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	2.1e-178	96.0
AVF19593.1\|33657_33993_-	C2H2-type zinc finger protein	NA	NA	NA	NA
AVF19594.1\|34165_34444_+	cytoplasmic protein	NA	NA	NA	NA
AVF19595.1\|34706_35657_-\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	3.6e-74	56.5
35158:35172	attR	NA	NA	NA	NA
AVF19596.1\|35829_36450_-	serine recombinase	A0A219Y912	Aeromonas_phage	7.7e-09	31.5
AVF19597.1\|36888_38035_+	DDE domain-containing protein	U5P429	Shigella_phage	5.0e-147	92.6
AVF19598.1\|38520_39489_+\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-172	92.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP026850

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2388

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15097.1\|702_930_-	hypothetical protein	NA	NA	NA	NA
AVF15098.1\|1356_1581_-	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	4.5e-20	67.2
AVF15099.1\|1968_2388_-	anti-adapter protein IraM	Q20GJ2	Phage_258-320	3.7e-15	38.9

DBSCAN-SWA_2

13975 : 14491

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15110.1\|13975_14491_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-24	56.9

DBSCAN-SWA_3

20854 : 29659

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15116.1\|20854_22516_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-10	61.9
AVF15117.1\|22661_23528_+	2,5-didehydrogluconate reductase DkgB	NA	NA	NA	NA
AVF15118.1\|23574_23775_-	hypothetical protein	NA	NA	NA	NA
AVF15119.1\|24100_24520_+	translesion error-prone DNA polymerase V subunit UmuD	A0A1W6JNS2	Morganella_phage	6.7e-33	54.3
AVF15120.1\|24866_27296_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
AVF15121.1\|27382_29659_-	pyrroloquinoline quinone biosynthesis protein PqqF	A0A2P1EIE5	Megavirus	2.9e-05	26.6

DBSCAN-SWA_4

34139 : 35405

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15127.1\|34139_35405_-	DNA polymerase IV	I6RSM4	Salmonella_phage	8.4e-204	81.0

DBSCAN-SWA_5

49248 : 50397

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15142.1\|49248_50397_-	osmoprotectant ABC transporter ATP-binding protein OsmV	G9BWD6	Planktothrix_phage	8.3e-25	32.6

DBSCAN-SWA_6

57281 : 80463

Escherichia_phage(30.77%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15150.1\|57281_57959_+	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	3.6e-76	62.1
AVF15151.1\|57997_58312_+	nucleoside-triphosphate diphosphatase	NA	NA	NA	NA
AVF15152.1\|58426_58738_-	DNA damage-inducible SOS regulon protein	NA	NA	NA	NA
AVF15153.1\|58847_59462_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	1.1e-28	34.7
AVF15154.1\|59506_60361_-	dimethylsulfoxide reductase	A0A077SK59	Escherichia_phage	9.9e-23	34.6
AVF15155.1\|60362_60980_-	dimethylsulfoxide reductase, chain B	A0A077SL61	Escherichia_phage	1.0e-74	59.1
AVF15156.1\|63560_63866_-	DUF1161 domain-containing protein	NA	NA	NA	NA
AVF15157.1\|63968_64823_-	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2
AVF15158.1\|65014_65725_+	YnfC family lipoprotein	NA	NA	NA	NA
AVF15159.1\|65742_66303_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AVF15160.1\|66302_66641_-	hypothetical protein	NA	NA	NA	NA
AVF15161.1\|66791_67118_+	YnfA family protein	A0A218MNG8	uncultured_virus	5.4e-22	55.6
AVF15162.1\|67229_68444_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.3e-47	29.7
AVF15163.1\|68458_69478_+	Zn-dependent oxidoreductase	NA	NA	NA	NA
AVF15164.1\|69551_70931_+	proline/glycine betaine transporter ProP	NA	NA	NA	NA
AVF15165.1\|71154_72618_+	mannitol-1-phosphate 5-dehydrogenase	H8ZJP8	Ostreococcus_tauri_virus	2.2e-46	30.7
AVF15166.1\|72662_72866_-	selenoprotein YdfZ	J9Q802	Salmonella_phage	4.4e-14	56.7
AVF15167.1\|73153_73585_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	2.0e-16	35.2
AVF15168.1\|73620_74307_-	transcriptional regulator GlcC	NA	NA	NA	NA
AVF15169.1\|74397_75144_-	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
AVF15170.1\|75287_77321_+	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	7.6e-21	20.5
AVF15171.1\|77613_78105_+	DUF523 domain-containing protein	NA	NA	NA	NA
AVF15172.1\|78565_79685_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF15173.1\|80223_80463_-	DinI family protein	K7PKM2	Enterobacterial_phage	5.0e-33	91.1

DBSCAN-SWA_7

87762 : 88752

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15180.1\|87762_88752_-	phosphoglycerate dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	2.8e-69	45.1

DBSCAN-SWA_8

95947 : 97921

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15186.1\|95947_97921_-	ribonuclease Z	A0A2P0VMX1	Tetraselmis_virus	3.6e-161	46.0

DBSCAN-SWA_9

116410 : 118387

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15205.1\|116410_118387_+	hypothetical protein	A0A2P0VMX1	Tetraselmis_virus	1.9e-157	45.4

DBSCAN-SWA_10

122781 : 124002

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15212.1\|122781_124002_+	cyclopropane-fatty-acyl-phospholipid synthase	A0A2I2L5L3	Orpheovirus	2.4e-38	31.6

DBSCAN-SWA_11

130207 : 135696

Bodo_saltans_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15220.1\|130207_130894_-\|tRNA	bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA	A0A2H4UV25	Bodo_saltans_virus	1.5e-08	31.1
AVF15221.1\|130984_131590_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AVF15222.1\|131793_135696_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	5.0e-53	29.4

DBSCAN-SWA_12

143099 : 145497

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15227.1\|143099_143630_+	cytochrome B	A0A0U2QLA7	Escherichia_phage	3.5e-18	43.0
AVF15228.1\|143672_144740_-	oxidoreductase	NA	NA	NA	NA
AVF15229.1\|144753_145497_-	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	4.6e-16	29.4

DBSCAN-SWA_13

165772 : 167938

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15231.1\|165772_167938_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.9e-31	27.4

DBSCAN-SWA_14

176427 : 179397

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15241.1\|176427_177546_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	3.6e-33	29.1
AVF15242.1\|177705_179397_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-07	32.2

DBSCAN-SWA_15

191547 : 192777

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15253.1\|191547_192777_-	peptidase T	A0A0K2CPK3	Brevibacillus_phage	2.1e-05	39.1

DBSCAN-SWA_16

199117 : 204809

Phage_TP(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15260.1\|199117_201082_+	U32 family peptidase	Q6DW11	Phage_TP	1.6e-23	28.6
AVF15261.1\|201078_201312_-	DUF2554 domain-containing protein	NA	NA	NA	NA
AVF15262.1\|201555_201918_+	hypothetical protein	NA	NA	NA	NA
AVF15263.1\|202066_203065_-	transcriptional regulator FtrA	NA	NA	NA	NA
AVF15264.1\|203138_203549_+	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
AVF15265.1\|203705_204809_+	methionine synthase	A0A218MNE0	uncultured_virus	1.2e-102	48.4

DBSCAN-SWA_17

208951 : 210457

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15269.1\|208951_209749_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.2e-11	26.8
AVF15270.1\|209758_210457_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	6.8e-14	25.6

DBSCAN-SWA_18

213791 : 214178

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15275.1\|213791_214178_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	1.6e-09	34.3

DBSCAN-SWA_19

221123 : 225088

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15282.1\|221123_222713_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-13	23.6
AVF15283.1\|222775_223702_+	glutaminase	NA	NA	NA	NA
AVF15284.1\|223701_224064_+	DUF4186 domain-containing protein	NA	NA	NA	NA
AVF15285.1\|224122_225088_+	PleD family two-component system response regulator	A0A127AWB9	Bacillus_phage	2.6e-11	30.3

DBSCAN-SWA_20

231144 : 233177

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15293.1\|231144_231885_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-30	35.5
AVF15294.1\|231881_233177_+	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	1.2e-14	23.9

DBSCAN-SWA_21

252222 : 253107

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15311.1\|252222_253107_+	KR domain-containing protein	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.7e-82	56.5

DBSCAN-SWA_22

263338 : 268670

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15322.1\|263338_264458_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF15323.1\|266218_267235_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
AVF15324.1\|267263_268670_-	glycosyl hydrolase family 32	F8WPR5	Bacillus_phage	5.2e-13	23.6

DBSCAN-SWA_23

280741 : 282647

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15334.1\|280741_281728_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	31.6
AVF15335.1\|281720_282647_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	5.3e-14	29.1

DBSCAN-SWA_24

288454 : 291371

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15342.1\|288454_290164_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.3e-37	25.3
AVF15343.1\|290360_291371_+	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	2.3e-26	25.8

DBSCAN-SWA_25

301825 : 304435

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15352.1\|301825_302899_+	porin OmpD	Q1MVN1	Enterobacteria_phage	1.7e-149	70.9
AVF15353.1\|302944_304435_-	methyl viologen resistance protein SmvA	A0A0M3UL24	Mycobacterium_phage	3.4e-34	30.2

DBSCAN-SWA_26

310527 : 312072

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15357.1\|310527_312072_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_27

315648 : 322719

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15363.1\|315648_317748_-	elongation factor G	E4ZFJ7	Streptococcus_phage	3.7e-63	27.3
AVF15364.1\|317909_318209_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AVF15365.1\|318201_318843_-	DNA-binding protein	NA	NA	NA	NA
AVF15366.1\|318933_319935_-	phosphatidylinositol mannoside acyltransferase	A0A1W6JP29	Morganella_phage	3.9e-55	40.9
AVF15367.1\|320121_320352_-	Tautomerase PptA	NA	NA	NA	NA
AVF15368.1\|320389_321007_-	glutathione transferase GstA	NA	NA	NA	NA
AVF15369.1\|321048_321936_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
AVF15370.1\|321945_322719_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	8.4e-21	31.9

DBSCAN-SWA_28

328666 : 329206

Leuconostoc_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15377.1\|328666_329206_-	adenylate kinase	A0A097BYE2	Leuconostoc_phage	1.5e-13	34.7

DBSCAN-SWA_29

333901 : 336019

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15382.1\|333901_336019_+	TonB-dependent siderophore receptor	A0A1B0VCF0	Salmonella_phage	3.0e-137	67.4

DBSCAN-SWA_30

348606 : 349365

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15393.1\|348606_349365_-	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	A0A1D8EUH4	Mycobacterium_phage	3.0e-07	34.0

DBSCAN-SWA_31

362000 : 369485

Escherichia_phage(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15406.1\|362000_363116_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	6.7e-120	60.9
AVF15407.1\|363150_363573_-	GFA family protein	NA	NA	NA	NA
AVF15408.1\|363576_363774_-	hypothetical protein	NA	NA	NA	NA
AVF15409.1\|364193_364394_+	hypothetical protein	A0A0U2JGI6	Escherichia_phage	1.1e-20	71.7
AVF15410.1\|364443_365379_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.2e-140	94.9
AVF15411.1\|365422_366796_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.1e-50	32.0
AVF15412.1\|367144_367342_+	hypothetical protein	NA	NA	NA	NA
AVF15413.1\|367280_368264_-	zinc transporter ZntB	NA	NA	NA	NA
AVF15414.1\|368354_369485_-	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	28.6

DBSCAN-SWA_32

386164 : 387454

Lysinibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15428.1\|386164_387454_+\|transposase	ISL3-like element ISPpu12 family transposase	A0A2D1GQC1	Lysinibacillus_phage	9.5e-86	40.4

DBSCAN-SWA_33

392660 : 395300

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15433.1\|392660_395300_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.4e-96	32.1

DBSCAN-SWA_34

412762 : 413845

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15448.1\|412762_413845_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-21	32.8

DBSCAN-SWA_35

430924 : 440408

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15465.1\|430924_431917_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	2.3e-07	26.1
AVF15466.1\|431918_432725_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.8e-13	26.8
AVF15467.1\|432721_433312_-	DNA-binding transcriptional repressor AcrR	NA	NA	NA	NA
AVF15468.1\|433444_433846_+	RidA family protein	NA	NA	NA	NA
AVF15469.1\|433893_434715_+	MDR efflux pump AcrAB transcriptional activator RobA	NA	NA	NA	NA
AVF15470.1\|434717_436064_-	cellulose biosynthesis regulator YedQ	G3MA91	Bacillus_virus	4.0e-18	30.5
AVF15471.1\|436457_437246_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
AVF15472.1\|437398_438385_+	oxidoreductase	NA	NA	NA	NA
AVF15473.1\|438473_440408_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	3.2e-05	23.6

DBSCAN-SWA_36

449071 : 449662

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15482.1\|449071_449662_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-42	48.4

DBSCAN-SWA_37

454585 : 458915

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15486.1\|454585_457183_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	4.6e-87	34.0
AVF15487.1\|457581_457833_+	hypothetical protein	NA	NA	NA	NA
AVF15488.1\|457868_458915_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	3.6e-19	28.7

DBSCAN-SWA_38

464864 : 467822

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15495.1\|464864_466460_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.9e-51	37.6
AVF15496.1\|466463_467822_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.0e-37	41.0

DBSCAN-SWA_39

482098 : 484995

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15513.1\|482098_482935_-	transporter	A0A1B0Y2S3	Lactobacillus_phage	6.1e-09	39.8
AVF15514.1\|482980_483985_-	oligopeptide ABC transporter ATP-binding protein OppF	G3M9Y6	Bacillus_virus	8.9e-15	30.7
AVF15515.1\|483981_484995_-	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	1.8e-15	29.4

DBSCAN-SWA_40

493210 : 503070

Citrobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19265.1\|493210_493825_-	thymidine kinase	A0A0A0YP64	Citrobacter_phage	1.7e-56	54.7
AVF15522.1\|494375_494789_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
AVF15523.1\|494991_495897_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	2.6e-58	47.2
AVF15524.1\|496096_497110_-	two-component system response regulator RssB	NA	NA	NA	NA
AVF15525.1\|497199_498102_-	patatin family protein	NA	NA	NA	NA
AVF15526.1\|498191_498680_+	hypothetical protein	NA	NA	NA	NA
AVF15527.1\|498721_499564_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.7e-12	49.3
AVF15528.1\|500150_500828_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
AVF15529.1\|500827_501538_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
AVF15530.1\|501534_503070_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	8.3e-20	47.3

DBSCAN-SWA_41

519402 : 520191

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15538.1\|519402_520191_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	1.3e-29	36.9

DBSCAN-SWA_42

524262 : 533105

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15542.1\|524262_526047_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-14	34.6
AVF15543.1\|526241_526481_+	hypothetical protein	NA	NA	NA	NA
AVF15544.1\|526511_527207_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AVF15545.1\|527384_527615_-	cation transport regulator	A0A1S5YE01	Mythimna_unipuncta_granulovirus	1.3e-06	45.3
AVF15546.1\|527883_528984_+	sodium-potassium/proton antiporter ChaA	NA	NA	NA	NA
AVF15547.1\|529099_529954_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	3.4e-47	39.5
AVF15548.1\|529990_530800_-	hypothetical protein	NA	NA	NA	NA
AVF15549.1\|530803_531196_-	siroheme synthase	NA	NA	NA	NA
AVF15550.1\|531192_532023_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
AVF15551.1\|532022_533105_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.5e-07	41.6

DBSCAN-SWA_43

536207 : 538960

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19267.1\|536207_537155_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.9e-44	37.8
AVF15555.1\|537280_538960_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	6.7e-23	24.0

DBSCAN-SWA_44

543029 : 559869

Streptomyces_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15561.1\|543029_543818_-	Appr-1-p processing protein	A0A2L1IVW3	Streptomyces_phage	2.0e-17	35.2
AVF15562.1\|545814_546297_-	SMI1 / KNR4 family protein	NA	NA	NA	NA
AVF15563.1\|546308_550679_-	type IV secretion protein Rhs	A0A2H4JHK7	uncultured_Caudovirales_phage	7.3e-29	51.2
AVF15564.1\|550682_551123_-	DUF1795 domain-containing protein	NA	NA	NA	NA
AVF15565.1\|551204_551903_-	hypothetical protein	NA	NA	NA	NA
AVF15566.1\|551902_554464_-	flagellar basal body L-ring protein FlgH	A0A077K8Q4	Ralstonia_phage	5.0e-46	28.0
AVF15567.1\|554535_554988_-	hypothetical protein	NA	NA	NA	NA
AVF15568.1\|554971_555775_-	hypothetical protein	NA	NA	NA	NA
AVF15569.1\|555795_557229_-	3-deoxy-D-manno-octulosonic acid kinase	M1HKB5	Acanthocystis_turfacea_Chlorella_virus	6.1e-09	27.0
AVF15570.1\|557253_559869_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	8.4e-81	31.4

DBSCAN-SWA_45

568272 : 569262

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15579.1\|568272_569262_-	type III secretion system translocon protein SseD	A0A2H4J6N0	uncultured_Caudovirales_phage	8.7e-31	29.4

DBSCAN-SWA_46

608093 : 615336

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15613.1\|608093_609812_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	26.0
AVF15614.1\|609982_610564_-	hypothetical protein	NA	NA	NA	NA
AVF15615.1\|610601_611297_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AVF15616.1\|611363_613274_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	6.1e-89	32.0
AVF15617.1\|613407_613752_+	RidA family protein	NA	NA	NA	NA
AVF15618.1\|613757_613940_-	YoaH family protein	NA	NA	NA	NA
AVF15619.1\|614001_615336_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	2.2e-45	42.3

DBSCAN-SWA_47

619194 : 620754

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15623.1\|619194_620754_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	6.0e-42	45.4

DBSCAN-SWA_48

628189 : 628399

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15631.1\|628189_628399_-	cold-shock protein CspC	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_49

632589 : 717978

Enterobacteria_phage(32.2%)

tail,tRNA,portal,holin,capsid,integrase,protease,head,terminase

attL 645192:645208|attR 721357:721373

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15638.1\|632589_633471_-\|protease	protease HtpX	NA	NA	NA	NA
AVF15639.1\|633664_635713_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.8e-82	32.6
AVF15640.1\|635732_636419_-	RNA chaperone ProQ	NA	NA	NA	NA
AVF15641.1\|636515_637013_-	GAF domain-containing protein	NA	NA	NA	NA
AVF19270.1\|637145_638429_+	paraquat-inducible protein A	NA	NA	NA	NA
AVF15642.1\|638397_641031_+	intermembrane transport protein PqiB	NA	NA	NA	NA
AVF15643.1\|641087_642551_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
AVF19271.1\|642657_642897_+	DUF1480 domain-containing protein	NA	NA	NA	NA
AVF15644.1\|642931_643576_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	1.9e-55	49.3
AVF15645.1\|643743_644724_+	DUF535 domain-containing protein	NA	NA	NA	NA
AVF15646.1\|644769_644967_+	hypothetical protein	NA	NA	NA	NA
AVF15647.1\|645091_645430_-	DUF2511 domain-containing protein	NA	NA	NA	NA
645192:645208	attL	NA	NA	NA	NA
AVF15648.1\|646294_646666_-	CopC domain-containing protein YobA	NA	NA	NA	NA
AVF15649.1\|646803_647034_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	7.0e-16	61.8
AVF15650.1\|647145_647796_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AVF15651.1\|647820_648483_+	exodeoxyribonuclease X	NA	NA	NA	NA
AVF15652.1\|648464_650540_-	oligopeptidase B	NA	NA	NA	NA
AVF15653.1\|650615_651266_-	DUF533 domain-containing protein	NA	NA	NA	NA
AVF15654.1\|651437_652616_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
AVF15655.1\|652690_653332_-	keto-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
AVF15656.1\|653371_655183_-	phosphogluconate dehydratase	NA	NA	NA	NA
AVF15657.1\|655416_656892_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	4.6e-76	36.2
AVF15658.1\|657248_658118_+	transcriptional regulator HexR	NA	NA	NA	NA
AVF15659.1\|658232_659675_+	pyruvate kinase	NA	NA	NA	NA
AVF15660.1\|659718_660690_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
AVF15661.1\|660807_662127_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	40.9
AVF19272.1\|662142_663102_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF15662.1\|663164_663920_+	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	3.0e-15	30.2
AVF15663.1\|663916_664702_+	zinc ABC transporter permease	NA	NA	NA	NA
AVF15664.1\|664761_665772_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	2.4e-07	29.9
AVF15665.1\|665780_666395_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AVF15666.1\|666475_666997_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
AVF15667.1\|667031_667772_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AVF15668.1\|667799_668243_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
AVF15669.1\|668244_670017_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AVF15670.1\|670280_670847_+	hydrolase	NA	NA	NA	NA
AVF15671.1\|671211_671451_+	DinI family protein	K7P797	Enterobacteria_phage	8.5e-33	88.6
AVF15672.1\|671537_671960_-	hypothetical protein	K7P834	Enterobacteria_phage	1.8e-25	47.2
AVF19273.1\|672293_672869_-	DNA-invertase	A0A1S6L009	Salmonella_phage	1.9e-78	80.3
AVF19274.1\|673967_674492_+	hypothetical protein	K7PKG5	Enterobacteria_phage	5.8e-74	77.5
AVF15673.1\|674488_675805_-	hypothetical protein	K7P6I4	Enterobacteria_phage	4.4e-46	43.9
AVF15674.1\|675863_676097_-	cor protein	E4WL42	Enterobacteria_phage	3.9e-30	78.9
AVF15675.1\|676204_676876_-	hypothetical protein	A0A2P0WA07	Enterobacter_phage	2.0e-87	73.1
AVF15676.1\|676876_677191_-	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
AVF15677.1\|677234_681083_-	DUF1983 domain-containing protein	Q9MCU0	Escherichia_phage	0.0e+00	61.7
AVF15678.1\|681135_681723_-\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	6.1e-48	47.4
AVF15679.1\|681722_682433_-	peptidase P60	F1C573	Cronobacter_phage	1.5e-96	69.8
AVF15680.1\|682435_683194_-\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	2.3e-95	63.6
AVF15681.1\|683190_683529_-\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	7.3e-38	59.8
AVF19275.1\|683531_686834_-\|tail	phage tail tape measure protein	K7P7L6	Enterobacteria_phage	0.0e+00	85.3
AVF15682.1\|686891_687233_-	hypothetical protein	NA	NA	NA	NA
AVF15683.1\|687288_687567_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.8e-42	95.7
AVF15684.1\|687575_687959_-\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	4.4e-63	93.7
AVF15685.1\|687967_688411_-	hypothetical protein	K7PHL2	Enterobacterial_phage	4.6e-72	93.8
AVF15686.1\|688470_688818_-	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	1.5e-57	98.3
AVF15687.1\|688814_689264_-	hypothetical protein	K7P6X4	Enterobacteria_phage	2.9e-74	98.7
AVF15688.1\|689260_689599_-\|head,tail	head-tail adaptor protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.0e-39	73.2
AVF15689.1\|689607_689934_-\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	1.3e-47	81.5
AVF15690.1\|689977_691189_-\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	9.5e-197	87.9
AVF15691.1\|691198_692047_-\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	9.2e-138	91.8
AVF15692.1\|692060_693365_-\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	4.7e-234	93.3
AVF15693.1\|693364_695101_-	thymidine kinase	K7PKT2	Enterobacteria_phage	0.0e+00	99.8
AVF15694.1\|695100_695574_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.9e-85	98.1
AVF15695.1\|695731_696082_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	9.2e-52	81.9
AVF15696.1\|696081_696672_-	hypothetical protein	K7PGW6	Enterobacterial_phage	1.9e-94	80.6
AVF15697.1\|696837_697122_+	hypothetical protein	NA	NA	NA	NA
AVF15698.1\|697137_697368_-	hypothetical protein	NA	NA	NA	NA
AVF15699.1\|697386_698847_-	glycosyltransferase family 2 protein	A0A220NRM5	Escherichia_phage	9.9e-265	88.5
AVF15700.1\|698846_699407_-	HNH endonuclease	A0A220NRM6	Escherichia_phage	3.6e-98	90.3
AVF15701.1\|699547_699742_-	hypothetical protein	K7PM01	Enterobacterial_phage	2.4e-17	81.6
AVF19276.1\|699698_699968_-	hypothetical protein	G8C7W1	Escherichia_phage	3.1e-31	83.1
AVF15702.1\|699975_700605_-	flagellar hook assembly protein FlgD	G8C7W0	Escherichia_phage	2.1e-102	87.6
AVF15703.1\|700604_700883_-\|holin	phage holin family protein	G8C7V9	Escherichia_phage	1.1e-36	83.7
AVF15704.1\|700872_701262_-	hypothetical protein	G8C7V8	Escherichia_phage	1.1e-58	92.2
AVF15705.1\|701372_701597_-	hypothetical protein	NA	NA	NA	NA
AVF15706.1\|701770_702586_-	molecular chaperone DnaJ	A0A1B5FPA5	Escherichia_phage	5.8e-113	77.9
AVF15707.1\|702589_704461_-	DNA primase	Q5G8S8	Enterobacteria_phage	5.4e-223	59.4
AVF15708.1\|704568_705501_-	hypothetical protein	C5IHL2	Burkholderia_virus	2.9e-36	37.0
AVF15709.1\|705497_705695_-	DUF4222 domain-containing protein	NA	NA	NA	NA
AVF19277.1\|705696_705921_-	uroporphyrinogen-III synthase	G8C7U2	Escherichia_phage	3.3e-18	58.3
AVF15710.1\|706033_706732_+	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	3.0e-78	62.5
AVF15711.1\|706933_707365_+	transcriptional regulator	NA	NA	NA	NA
AVF15712.1\|707431_707818_+	peptidase S24	F1C5A0	Cronobacter_phage	2.0e-39	61.6
AVF15713.1\|707924_708149_+	hypothetical protein	NA	NA	NA	NA
AVF15714.1\|708141_708549_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	A0A286S1Q6	Klebsiella_phage	6.1e-47	81.1
AVF15715.1\|708502_709114_+	HNH endonuclease	A0A2I7S010	Vibrio_phage	5.9e-38	47.5
AVF15716.1\|709103_709517_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	6.2e-47	67.2
AVF15717.1\|709517_709742_+	hypothetical protein	A0A1B5FPG2	Escherichia_phage	3.7e-14	58.3
AVF15718.1\|709738_709885_+	hypothetical protein	A0A1B5FPC2	Escherichia_phage	5.6e-19	81.2
AVF19278.1\|709892_710129_+	excisionase	Q8W657	Enterobacteria_phage	4.8e-36	85.9
AVF15719.1\|710184_711498_+\|integrase	integrase/recombinase	Q8W658	Enterobacteria_phage	1.9e-222	86.0
AVF15720.1\|711476_712250_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.0e-58	81.9
AVF15721.1\|712301_712697_+	hypothetical protein	NA	NA	NA	NA
AVF15722.1\|712737_713481_+\|tRNA	tRNA (cmo5U34)-methyltransferase	A0A1S6L2V9	Erwinia_phage	8.0e-29	30.2
AVF15723.1\|713477_714449_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AVF15724.1\|714403_714643_-	hypothetical protein	NA	NA	NA	NA
AVF15725.1\|714623_715367_-	copper homeostasis protein CutC	NA	NA	NA	NA
AVF15726.1\|715445_716006_-	VOC family protein	NA	NA	NA	NA
AVF15727.1\|716244_717978_+\|tRNA	arginine--tRNA ligase	A0A1V0SIS8	Klosneuvirus	2.6e-86	36.8
721357:721373	attR	NA	NA	NA	NA

DBSCAN-SWA_50

727708 : 733361

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15733.1\|727708_728098_-	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3
AVF15734.1\|728115_729165_-	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	2.3e-05	32.0
AVF15735.1\|729161_730028_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
AVF15736.1\|730047_731649_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-07	77.3
AVF15737.1\|731693_733361_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-11	34.7

DBSCAN-SWA_51

750453 : 751968

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15754.1\|750453_751968_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	9.6e-13	27.5

DBSCAN-SWA_52

767033 : 768622

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15769.1\|767033_767909_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	4.0e-11	25.3
AVF15770.1\|767905_768622_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	7.8e-13	28.5

DBSCAN-SWA_53

775687 : 776440

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15778.1\|775687_776440_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	2.2e-26	35.4

DBSCAN-SWA_54

800268 : 808388

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15808.1\|800268_801969_-	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	2.8e-16	32.8
AVF15809.1\|802053_802236_-	DUF2158 domain-containing protein	NA	NA	NA	NA
AVF15810.1\|802313_803225_-	DUF808 domain-containing protein	NA	NA	NA	NA
AVF15811.1\|803403_804318_+	drug/metabolite exporter YedA	NA	NA	NA	NA
AVF15812.1\|804761_806195_-	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	9.5e-103	55.9
AVF15813.1\|806238_806940_-	phosphohydrolase	S4W232	Pandoravirus	2.4e-06	28.2
AVF15814.1\|807224_808388_+	porin OmpC	Q1MVN1	Enterobacteria_phage	2.0e-114	57.8

DBSCAN-SWA_55

812793 : 815574

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15819.1\|812793_815574_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.4e-65	29.1

DBSCAN-SWA_56

821938 : 823240

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15824.1\|821938_823240_+	proline/glycine betaine transporter ProP	Q6JIH2	Burkholderia_virus	3.3e-62	36.5

DBSCAN-SWA_57

839859 : 847641

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15839.1\|839859_842553_-	zinc/cadmium/mercury/lead-transporting ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.4e-70	27.6
AVF15840.1\|842600_843032_-	universal stress protein UspG	NA	NA	NA	NA
AVF19283.1\|843595_844591_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AVF15841.1\|844590_847641_+	multidrug transporter subunit MdtC	S5VL66	Leptospira_phage	8.4e-24	20.4

DBSCAN-SWA_58

856682 : 857849

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15850.1\|856682_857849_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	8.3e-198	86.3

DBSCAN-SWA_59

863397 : 864297

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15855.1\|863397_864297_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_60

869807 : 878694

Tupanvirus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15862.1\|869807_870419_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	5.4e-15	29.8
AVF15863.1\|870457_871438_-	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
AVF15864.1\|871630_872635_+	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L0I7	Tupanvirus	1.9e-33	29.0
AVF15865.1\|872684_873851_-	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	4.1e-112	54.0
AVF15866.1\|874090_874972_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.0e-104	62.7
AVF15867.1\|874972_876058_-	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	1.1e-98	52.3
AVF15868.1\|876147_877554_-	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	M4QQM4	Ostreococcus_lucimarinus_virus	4.0e-37	28.3
AVF15869.1\|877680_878694_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	3.0e-87	48.3

DBSCAN-SWA_61

885908 : 889596

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15877.1\|885908_886805_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.1e-43	42.6
AVF15878.1\|887020_888016_-	short chain dehydrogenase	A0A0K1L6Z1	Scale_drop_disease_virus	1.5e-09	27.1
AVF15879.1\|888198_889596_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	1.3e-19	32.8

DBSCAN-SWA_62

895042 : 901754

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15884.1\|895042_896413_-	phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	2.0e-33	27.5
AVF15885.1\|896522_897959_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	7.2e-50	30.5
AVF15886.1\|897962_899186_-	colanic acid biosynthesis glycosyltransferase WcaI	NA	NA	NA	NA
AVF19286.1\|899182_899662_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
AVF15887.1\|899664_900630_-	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	1.4e-86	50.6
AVF15888.1\|900632_901754_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	66.3

DBSCAN-SWA_63

906962 : 916292

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15895.1\|906962_909125_-	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	3.2e-17	29.8
AVF15896.1\|909127_909571_-	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
AVF15897.1\|909577_910714_-	polysaccharide export protein Wza	NA	NA	NA	NA
AVF15898.1\|911407_912991_+	magnesium/cobalt transporter CorC	A0A0R6PEZ3	Moraxella_phage	8.2e-39	44.9
AVF15899.1\|913103_914954_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
AVF15900.1\|914977_915559_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	1.9e-33	43.2
AVF15901.1\|915650_916292_-	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	38.3

DBSCAN-SWA_64

931315 : 936039

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15909.1\|931315_932719_+	two-component system sensor histidine kinase BaeA	W8CYF6	Bacillus_phage	2.5e-31	27.9
AVF15910.1\|932715_933438_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	3.2e-30	32.4
AVF15911.1\|933587_934526_+	hypothetical protein	NA	NA	NA	NA
AVF15912.1\|934677_936039_+	U32 family peptidase	Q6DW11	Phage_TP	4.7e-200	91.0

DBSCAN-SWA_65

944852 : 948261

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15921.1\|944852_945944_+	hypothetical protein	S4TRP0	Salmonella_phage	1.3e-06	32.1
AVF15922.1\|946129_946570_+	hypothetical protein	NA	NA	NA	NA
AVF15923.1\|946884_948261_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-26	26.4

DBSCAN-SWA_66

956156 : 964004

Enterobacteria_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15930.1\|956156_958190_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	3.6e-55	28.2
AVF15931.1\|958294_958771_-	DUF1456 domain-containing protein	Q9EYF4	Enterobacteria_phage	5.8e-65	79.4
AVF15932.1\|958817_959537_-	two-component system response regulator YehT	NA	NA	NA	NA
AVF15933.1\|959530_961216_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.9e-270	88.2
AVF15934.1\|961434_962175_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.0e-92	82.4
AVF15935.1\|962244_962358_+	hypothetical protein	NA	NA	NA	NA
AVF15936.1\|962332_963070_-	ABC transporter permease	NA	NA	NA	NA
AVF15937.1\|963053_964004_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	F2Y1V5	Organic_Lake_phycodnavirus	5.9e-08	28.5

DBSCAN-SWA_67

970567 : 974436

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15942.1\|970567_971122_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	5.6e-19	37.2
AVF15943.1\|971218_972142_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
AVF15944.1\|972309_972897_-	YIP1 family protein	NA	NA	NA	NA
AVF15945.1\|973054_973627_+	DedA family protein	NA	NA	NA	NA
AVF15946.1\|973671_974436_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	5.2e-07	40.3

DBSCAN-SWA_68

983263 : 984784

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15956.1\|983263_984784_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	2.6e-10	33.0

DBSCAN-SWA_69

988511 : 993651

Cellulophaga_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15960.1\|988511_989180_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	3.1e-56	56.3
AVF15961.1\|989282_990431_-	MFS transporter	NA	NA	NA	NA
AVF15962.1\|990568_991396_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AVF15963.1\|991665_993651_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.2e-09	31.9

DBSCAN-SWA_70

997420 : 998278

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15967.1\|997420_998278_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	1.1e-24	32.7

DBSCAN-SWA_71

1006164 : 1010473

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15975.1\|1006164_1007631_+	mannitol-1-phosphate 5-dehydrogenase	E5EQS6	Micromonas_sp._RCC1109_virus	1.4e-37	29.9
AVF15976.1\|1007754_1008741_+	GTPase	NA	NA	NA	NA
AVF15977.1\|1008774_1009488_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
AVF15978.1\|1009903_1010473_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	1.8e-12	36.8

DBSCAN-SWA_72

1016165 : 1023683

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF15983.1\|1016165_1017755_+	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	1.2e-18	32.5
AVF15984.1\|1017758_1018103_-	hypothetical protein	NA	NA	NA	NA
AVF15985.1\|1018379_1019579_-	Bcr/CflA family drug resistance efflux transporter	S4TR35	Salmonella_phage	7.6e-21	23.0
AVF15986.1\|1019594_1020302_-	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
AVF15987.1\|1020453_1022214_+	type I restriction-modification system endonuclease	M4Q3N1	Vibrio_phage	1.1e-100	40.5
AVF15988.1\|1022339_1022624_+	50S ribosomal protein L25	NA	NA	NA	NA
AVF15989.1\|1022675_1023683_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	3.8e-82	48.3

DBSCAN-SWA_73

1029416 : 1038013

Tupanvirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19288.1\|1029416_1030712_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	5.4e-81	49.6
AVF15995.1\|1030674_1032111_-	magnesium transporter	NA	NA	NA	NA
AVF15996.1\|1032251_1033895_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-09	22.8
AVF15997.1\|1033971_1034622_-	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	3.7e-06	32.7
AVF15998.1\|1034621_1035680_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2K9L698	Tupanvirus	2.8e-19	48.0
AVF15999.1\|1035752_1036808_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
AVF16000.1\|1036921_1038013_-	porin OmpC	Q1MVN1	Enterobacteria_phage	2.1e-118	60.5

DBSCAN-SWA_74

1042180 : 1053938

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16003.1\|1042180_1045027_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	5.8e-43	26.3
AVF16004.1\|1045162_1047799_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	5.6e-93	31.0
AVF16005.1\|1047945_1048674_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AVF16006.1\|1049022_1051308_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	3.8e-287	64.3
AVF19290.1\|1051408_1052539_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	6.6e-176	78.9
AVF16007.1\|1052538_1052793_+	2Fe-2S ferredoxin	G9IAA2	Pseudomonas_phage	2.6e-27	66.7
AVF16008.1\|1052876_1053938_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	7.7e-09	50.9

DBSCAN-SWA_75

1075710 : 1076715

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16029.1\|1075710_1076715_+	PleD family two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	9.8e-30	26.5

DBSCAN-SWA_76

1095596 : 1098844

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16045.1\|1095596_1096196_+	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	1.5e-06	38.6
AVF16046.1\|1096276_1098109_-	SLC13 family permease	NA	NA	NA	NA
AVF16047.1\|1098184_1098844_-	sugar phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	7.7e-07	27.1

DBSCAN-SWA_77

1107987 : 1109007

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16057.1\|1107987_1109007_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.2e-20	26.8

DBSCAN-SWA_78

1113691 : 1114465

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19291.1\|1113691_1114465_-	histidine/lysine/arginine/ornithine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	28.2

DBSCAN-SWA_79

1118700 : 1120218

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16070.1\|1118700_1120218_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.4e-88	43.8

DBSCAN-SWA_80

1126650 : 1127787

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16078.1\|1126650_1127787_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	1.5e-18	26.9

DBSCAN-SWA_81

1136142 : 1137228

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16087.1\|1136142_1137228_-	chorismate synthase	A0A291AU41	Pandoravirus	7.2e-87	46.6

DBSCAN-SWA_82

1146397 : 1150056

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16096.1\|1146397_1147327_+	hypothetical protein	E7DYY8	Enterobacteria_phage	3.3e-141	84.3
AVF16097.1\|1147487_1148867_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-15	36.2
AVF19292.1\|1149135_1150056_+	lipid A biosynthesis palmitoleoyl acyltransferase	A0A1W6JP29	Morganella_phage	4.9e-76	54.7

DBSCAN-SWA_83

1153878 : 1154610

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16100.1\|1153878_1154610_+	two-component system response regulator YehT	A0A2R2ZGH8	Clostridioides_phage	2.9e-15	25.6

DBSCAN-SWA_84

1169356 : 1189164

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16113.1\|1169356_1170298_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	3.4e-08	24.9
AVF16114.1\|1170387_1171383_+	bile acid:sodium symporter	NA	NA	NA	NA
AVF16115.1\|1171379_1171595_-	hypothetical protein	NA	NA	NA	NA
AVF16116.1\|1171596_1173612_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	4.5e-151	43.1
AVF16117.1\|1173680_1174676_-	cell division protein ZipA	NA	NA	NA	NA
AVF16118.1\|1174905_1175667_+	sulfate transporter CysZ	NA	NA	NA	NA
AVF16119.1\|1175830_1176802_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	1.1e-75	51.3
AVF16120.1\|1176809_1176932_+	transcriptional regulator	NA	NA	NA	NA
AVF16121.1\|1176862_1177048_-	hypothetical protein	NA	NA	NA	NA
AVF16122.1\|1177119_1177377_+	phosphocarrier protein HPr	NA	NA	NA	NA
AVF16123.1\|1177422_1179150_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	3.3e-17	31.6
AVF16124.1\|1179190_1179700_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AVF16125.1\|1179744_1180581_-	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AVF16126.1\|1180586_1181498_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.2e-56	42.7
AVF16127.1\|1181616_1182711_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	1.6e-30	38.9
AVF16128.1\|1182700_1183576_-	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
AVF16129.1\|1183575_1184409_-	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
AVF16130.1\|1184408_1185422_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF16131.1\|1185583_1186483_-	peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.9
AVF16132.1\|1186575_1187151_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
AVF16133.1\|1187214_1187664_-	DUF2919 domain-containing protein	NA	NA	NA	NA
AVF16134.1\|1187650_1188076_-	GNAT family acetyltransferase	NA	NA	NA	NA
AVF16135.1\|1188288_1189164_+	N-acetylmuramoyl-L-alanine amidase AmiA	E5DV68	Deep-sea_thermophilic_phage	1.6e-12	26.9

DBSCAN-SWA_85

1207783 : 1293926

Salmonella_phage(25.45%)

tail,tRNA,holin,transposase,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16149.1\|1207783_1209730_-\|tRNA	tRNA(Met) cytidine acetyltransferase	NA	NA	NA	NA
AVF16150.1\|1209729_1210599_-	neutral zinc metallopeptidase	NA	NA	NA	NA
AVF16151.1\|1210719_1211433_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	9.1e-38	35.2
AVF16152.1\|1211542_1212577_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
AVF16153.1\|1212593_1213472_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AVF16154.1\|1213617_1214187_+	glycine cleavage system transcriptional repressor	NA	NA	NA	NA
AVF16155.1\|1214186_1214657_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
AVF16156.1\|1214796_1215861_-	AI-2E family transporter	NA	NA	NA	NA
AVF16157.1\|1216081_1217545_+\|protease	beta-barrel assembly-enhancing protease	NA	NA	NA	NA
AVF16158.1\|1217558_1217915_+	arsenate reductase (glutaredoxin)	NA	NA	NA	NA
AVF16159.1\|1217911_1218736_-	trp operon repressor	NA	NA	NA	NA
AVF16160.1\|1218883_1220203_+	PTS system, cellobiose-specific IIC component	NA	NA	NA	NA
AVF16161.1\|1220206_1221163_+	beta-aspartyl-peptidase	NA	NA	NA	NA
AVF16162.1\|1221162_1222581_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	3.3e-39	32.8
AVF16163.1\|1222711_1223428_-	DnaA inactivator Hda	NA	NA	NA	NA
AVF16164.1\|1223509_1224799_-	uracil permease	Q9KX94	Enterobacteria_phage	4.1e-65	36.9
AVF16165.1\|1224881_1225508_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AVF16166.1\|1225484_1225730_+	hypothetical protein	NA	NA	NA	NA
AVF16167.1\|1225724_1227155_-	thiol peroxidase	NA	NA	NA	NA
AVF16168.1\|1227421_1228459_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.8e-72	44.8
AVF16169.1\|1228455_1229097_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.6e-28	40.0
AVF16170.1\|1229325_1231386_+	polyphosphate kinase 1	NA	NA	NA	NA
AVF16171.1\|1231389_1232928_+	exopolyphosphatase	NA	NA	NA	NA
AVF16172.1\|1232932_1235173_-	biofilm formation regulator HmsP	NA	NA	NA	NA
AVF16173.1\|1235523_1235712_+	DUF2633 domain-containing protein	G9L6F2	Escherichia_phage	1.9e-19	76.7
AVF16174.1\|1236100_1236937_-	MipA/OmpV family protein	NA	NA	NA	NA
AVF16175.1\|1237140_1237818_+	DNA-binding response regulator	NA	NA	NA	NA
AVF16176.1\|1237817_1239206_+	two-component system sensor histidine kinase QseC	NA	NA	NA	NA
AVF16177.1\|1239373_1239853_+	HTH-type transcriptional repressor NsrR	NA	NA	NA	NA
AVF16178.1\|1239918_1243071_-	multidrug efflux RND transporter permease subunit OqxB	NA	NA	NA	NA
AVF16179.1\|1243094_1244270_-	multidrug transporter subunit MdtA	NA	NA	NA	NA
AVF16180.1\|1244607_1244961_+	AraC family transcriptional regulator	NA	NA	NA	NA
AVF16181.1\|1245188_1245671_-	membrane protein insertase YidC	Q858E9	Salmonella_phage	9.1e-58	78.1
AVF16182.1\|1245667_1246297_-	endolysin	Q858F0	Salmonella_phage	1.8e-98	85.2
AVF16183.1\|1246286_1246580_-\|holin	phage holin family protein	A0A193GYK3	Enterobacter_phage	3.5e-28	67.7
AVF16184.1\|1246566_1246971_-	hypothetical protein	A0A0F6R7N0	Escherichia_coli_O157_typing_phage	3.8e-49	76.9
AVF16185.1\|1247124_1247487_+	GtrA family protein	U5P0S6	Shigella_phage	4.4e-49	83.3
AVF16186.1\|1247483_1248401_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	U5P087	Shigella_phage	3.0e-158	91.7
AVF16187.1\|1248397_1249855_+	hypothetical protein	NA	NA	NA	NA
AVF16188.1\|1249988_1251108_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF16189.1\|1253112_1253373_+	hypothetical protein	T1SA06	Salmonella_phage	1.5e-35	83.5
AVF16190.1\|1253692_1254397_+	hypothetical protein	A0A193GYJ9	Enterobacter_phage	3.3e-117	87.6
AVF16191.1\|1254444_1254921_-	fimbriae assembly protein	NA	NA	NA	NA
AVF16192.1\|1254963_1257855_-	hypothetical protein	G9L6D4	Escherichia_phage	0.0e+00	76.0
AVF16193.1\|1257854_1260548_-	lytic transglycosylase	G9L6D3	Escherichia_phage	0.0e+00	68.3
AVF16194.1\|1260560_1261100_-	hypothetical protein	A0A0F6TJ56	Escherichia_coli_O157_typing_phage	2.0e-61	73.9
AVF16195.1\|1261099_1261564_-	hypothetical protein	Q858G2	Salmonella_phage	1.1e-79	92.2
AVF16196.1\|1261563_1264041_-	hypothetical protein	Q858G3	Salmonella_phage	0.0e+00	95.4
AVF16197.1\|1264040_1264646_-	hypothetical protein	A0A0F6TJN5	Escherichia_coli_O157_typing_phage	3.2e-100	86.6
AVF16198.1\|1264645_1264969_-	hypothetical protein	A0A193GYH8	Enterobacter_phage	2.9e-36	71.8
AVF16199.1\|1265020_1265395_-	hypothetical protein	G9L6C7	Escherichia_phage	1.1e-21	48.8
AVF16200.1\|1265399_1265840_-	hypothetical protein	A0A193GYT9	Enterobacter_phage	4.1e-65	89.7
AVF16201.1\|1265891_1266878_-	hypothetical protein	G9L6C5	Escherichia_phage	2.8e-162	86.0
AVF16202.1\|1266895_1267660_-	peptidase	G9L6C4	Escherichia_phage	3.4e-75	78.7
AVF16203.1\|1267662_1267959_-	hypothetical protein	T1SBI9	Salmonella_phage	3.8e-38	77.6
AVF16204.1\|1267955_1269626_-\|tail	phage tail protein	T1S9Z7	Salmonella_phage	4.1e-299	93.5
AVF16205.1\|1269640_1269847_-	hypothetical protein	T1SA67	Salmonella_phage	2.1e-08	92.6
AVF16206.1\|1270473_1270671_-	hypothetical protein	H2D0E0	Salmonella_phage	1.9e-06	66.7
AVF16207.1\|1270828_1272304_-\|terminase	terminase	Q858H3	Salmonella_phage	7.1e-295	98.8
AVF16208.1\|1272300_1272930_-\|terminase	terminase small subunit	A0A193GYG6	Enterobacter_phage	4.6e-86	79.9
AVF16209.1\|1272987_1273317_-	hypothetical protein	K7PGV5	Enterobacterial_phage	3.7e-26	55.0
AVF16210.1\|1273394_1273733_-	hypothetical protein	A0A193GYX4	Enterobacter_phage	7.1e-49	84.8
AVF16211.1\|1273732_1273918_-	hypothetical protein	NA	NA	NA	NA
AVF16212.1\|1273904_1274111_-	hypothetical protein	NA	NA	NA	NA
AVF16213.1\|1274110_1274314_-	hypothetical protein	K7PKM4	Enterobacterial_phage	3.2e-12	58.5
AVF16214.1\|1274310_1274514_-	DNA-directed RNA polymerase subunit P	NA	NA	NA	NA
AVF16215.1\|1274513_1275233_-	hydrogenase/urease nickel incorporation protein HypA	A0A1I9KFE6	Aeromonas_phage	1.6e-21	79.7
AVF16216.1\|1275229_1275727_-	hypothetical protein	K7P6V8	Enterobacteria_phage	4.3e-10	44.3
AVF16217.1\|1275723_1275927_-	hypothetical protein	R9TRD3	Aeromonas_phage	1.5e-22	78.1
AVF16218.1\|1275923_1276565_-	eae-like domain protein	Q858D1	Salmonella_phage	6.5e-35	46.8
AVF16219.1\|1276621_1277086_-	crossover junction endodeoxyribonuclease RuvC	A0A193GYM2	Enterobacter_phage	8.4e-77	94.2
AVF16220.1\|1278103_1278292_-	hypothetical protein	NA	NA	NA	NA
AVF19297.1\|1278288_1278492_-	hypothetical protein	Q858D5	Salmonella_phage	4.2e-25	85.1
AVF16221.1\|1278639_1278870_-	hypothetical protein	A0A193GYK6	Enterobacter_phage	1.5e-31	84.0
AVF16222.1\|1279024_1279615_+	HTH-type transcriptional regulator TreR	G9L6A6	Escherichia_phage	6.7e-79	75.0
AVF16223.1\|1279912_1280980_+	translation initiation factor IF-2	A0A2H4JIB1	uncultured_Caudovirales_phage	3.2e-39	74.8
AVF16224.1\|1280987_1281287_+	hypothetical protein	A0A0F6R7M4	Escherichia_coli_O157_typing_phage	3.3e-18	53.5
AVF16225.1\|1281283_1282105_+	exodeoxyribonuclease VIII	A0A193GYK2	Enterobacter_phage	3.4e-137	85.3
AVF16226.1\|1282101_1283043_+	recombinase RecT	A0A193GYL3	Enterobacter_phage	1.3e-161	89.5
AVF16227.1\|1283092_1283356_+	AlpA family phage regulatory protein	A0A193GYW1	Enterobacter_phage	5.3e-28	70.7
AVF16228.1\|1283465_1283762_+	PerC family transcriptional regulator	T1S9J5	Salmonella_phage	8.1e-33	70.1
AVF16229.1\|1283754_1283913_+	DUF1317 domain-containing protein	T1SAR0	Salmonella_phage	1.6e-16	75.0
AVF16230.1\|1283909_1284557_+	adenine methylase	A0A193GYV6	Enterobacter_phage	8.6e-120	91.2
AVF16231.1\|1284592_1285843_-	tyrosine recombinase XerS	G9L697	Escherichia_phage	1.4e-190	80.1
AVF16232.1\|1286035_1287613_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
AVF16233.1\|1287680_1289147_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-88	39.1
AVF16234.1\|1289306_1290680_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.3e-40	34.7
AVF16235.1\|1290738_1291758_+	peptidase M4 family protein	NA	NA	NA	NA
AVF16236.1\|1291757_1292108_+	hypothetical protein	NA	NA	NA	NA
AVF16237.1\|1292104_1292326_-	hypothetical protein	NA	NA	NA	NA
AVF16238.1\|1292384_1293926_-	dipeptide/tripeptide permease DtpA	A0A0P0IY73	Acinetobacter_phage	2.2e-161	57.6

DBSCAN-SWA_86

1302749 : 1307984

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16246.1\|1302749_1303181_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.4e-19	39.4
AVF16247.1\|1303305_1304181_-	3-methyl-2-oxobutanoate dehydrogenase subunit delta	NA	NA	NA	NA
AVF16248.1\|1304180_1304960_-	dimethyl sulfoxide reductase	NA	NA	NA	NA
AVF16249.1\|1304952_1305582_-	dimethylsulfoxide reductase, chain B	A0A077SL61	Escherichia_phage	3.0e-61	55.4
AVF16250.1\|1305578_1307984_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.7e-136	38.0

DBSCAN-SWA_87

1321178 : 1327477

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16258.1\|1321178_1322465_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	4.9e-34	39.4
AVF16259.1\|1322518_1322719_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AVF16260.1\|1322720_1323056_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AVF16261.1\|1323057_1324908_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.3e-104	40.9
AVF16262.1\|1324922_1325438_-	co-chaperone HscB	NA	NA	NA	NA
AVF16263.1\|1325514_1325838_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.5e-21	46.7
AVF16264.1\|1325851_1326238_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	77.3
AVF16265.1\|1326262_1327477_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6

DBSCAN-SWA_88

1334848 : 1346029

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16274.1\|1334848_1336102_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4
AVF16275.1\|1336088_1336334_-	hypothetical protein	NA	NA	NA	NA
AVF16276.1\|1336406_1337597_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
AVF16277.1\|1337673_1338012_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
AVF16278.1\|1338092_1339430_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	2.0e-09	33.0
AVF16279.1\|1339426_1340179_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
AVF19298.1\|1340175_1341564_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	6.5e-16	27.9
AVF16280.1\|1342141_1346029_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	1.0e-130	58.7

DBSCAN-SWA_89

1352231 : 1452949

107

Escherichia_phage(17.86%)

tRNA,tail,portal,plate,holin,capsid,transposase,integrase,terminase,head

attL 1366868:1366884|attR 1460436:1460452

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16287.1\|1352231_1352492_+	ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-17	51.2
AVF16288.1\|1352488_1352869_-	holo-ACP synthase	NA	NA	NA	NA
AVF16289.1\|1352868_1353600_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
AVF16290.1\|1353675_1354383_-	DNA repair protein RecO	NA	NA	NA	NA
AVF16291.1\|1354400_1355306_-	GTPase Era	NA	NA	NA	NA
AVF16292.1\|1355302_1355983_-	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	9.6e-21	39.0
AVF16293.1\|1356206_1357181_-	signal peptidase I	NA	NA	NA	NA
AVF16294.1\|1357196_1359002_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	8.5e-24	25.9
AVF16295.1\|1359187_1359664_-	SoxR reducing system protein RseC	NA	NA	NA	NA
AVF16296.1\|1359660_1360614_-	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
AVF16297.1\|1360613_1361264_-	anti-sigma-E factor RseA	NA	NA	NA	NA
AVF16298.1\|1361295_1361871_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
AVF16299.1\|1362296_1363916_+	L-aspartate oxidase	NA	NA	NA	NA
AVF16300.1\|1363900_1364638_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AVF16301.1\|1364770_1366099_+	ATP-dependent RNA helicase SrmB	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-48	33.5
AVF16302.1\|1366150_1366534_-	autonomous glycyl radical cofactor GrcA	A0A193GZ98	Escherichia_phage	2.1e-33	71.8
AVF16303.1\|1366849_1367539_+	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	48.8
1366868:1366884	attL	NA	NA	NA	NA
AVF16304.1\|1367578_1368664_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
AVF16305.1\|1368868_1369288_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	1.2e-13	37.2
AVF16306.1\|1369358_1370057_+	DTW domain-containing protein	NA	NA	NA	NA
AVF16307.1\|1370092_1372756_+	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
AVF16308.1\|1372865_1374221_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
AVF16309.1\|1374267_1374591_+	hypothetical protein	NA	NA	NA	NA
AVF16310.1\|1374587_1375895_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.7e-43	29.6
AVF16311.1\|1376046_1376499_-	DUF4385 domain-containing protein	M4QHR1	Cyanophage	5.9e-35	50.0
AVF16312.1\|1382166_1384740_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	9.0e-128	35.7
AVF16313.1\|1384869_1385601_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
AVF16314.1\|1385597_1386578_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
AVF16315.1\|1386709_1387447_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
AVF16316.1\|1387714_1388056_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
AVF19299.1\|1388161_1388209_+	hypothetical protein	NA	NA	NA	NA
AVF16317.1\|1388316_1389477_+	prephenate dehydratase	NA	NA	NA	NA
AVF16318.1\|1389473_1390346_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
AVF16319.1\|1390406_1391528_-	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
AVF16320.1\|1391538_1392609_-	3-deoxy-7-phosphoheptulonate synthase	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	51.5
AVF16321.1\|1392821_1393196_+	DUF2799 domain-containing protein	NA	NA	NA	NA
AVF16322.1\|1393349_1393886_+	DUF4154 domain-containing protein	NA	NA	NA	NA
AVF16323.1\|1393878_1395099_+	diguanylate cyclase	A0A2K8I9Y5	Pseudomonas_phage	1.2e-05	39.8
AVF16324.1\|1395111_1395597_+	OmpA family lipoprotein	NA	NA	NA	NA
AVF16325.1\|1395599_1396970_-	PepSY domain-containing protein	NA	NA	NA	NA
AVF16326.1\|1397008_1397413_-	DUF2946 domain-containing protein	NA	NA	NA	NA
AVF16327.1\|1397657_1398689_-	tyrosine recombinase XerS	A0A0M4S6G4	Salmonella_phage	2.0e-166	80.7
AVF19300.1\|1398691_1399558_-	phage repressor protein CI	Q6K1G0	Salmonella_virus	1.4e-69	44.6
AVF16328.1\|1399684_1399912_+	hypothetical protein	NA	NA	NA	NA
AVF16329.1\|1399943_1400453_+	hypothetical protein	Q6K1F8	Salmonella_virus	4.9e-78	86.4
AVF16330.1\|1400460_1400661_+	DUF2724 domain-containing protein	Q6K1F7	Salmonella_virus	1.2e-32	100.0
AVF16331.1\|1400624_1400963_+	hypothetical protein	A0A218M4I7	Erwinia_phage	1.6e-53	93.8
AVF16332.1\|1401030_1401258_+	DUF2732 domain-containing protein	A0A0M3UL87	Salmonella_phage	1.9e-29	96.0
AVF16333.1\|1401257_1401479_+	DksA/TraR family C4-type zinc finger protein	Q6K1F5	Salmonella_virus	1.0e-32	95.8
AVF19301.1\|1401761_1401953_+	hypothetical protein	A5X9G6	Aeromonas_virus	7.1e-14	56.6
AVF16334.1\|1401955_1404169_+	replication endonuclease	A0A218M4H2	Erwinia_phage	0.0e+00	91.4
AVF16335.1\|1404291_1404474_+	hypothetical protein	A0A0M5M1G5	Salmonella_phage	5.0e-17	74.1
AVF16336.1\|1404477_1404708_+	DinI family protein	NA	NA	NA	NA
AVF19302.1\|1404792_1405524_+	hypothetical protein	Q37850	Escherichia_phage	3.6e-122	88.5
AVF19303.1\|1405671_1405929_+	hypothetical protein	J9Q7T5	Salmonella_phage	9.8e-19	56.4
AVF16337.1\|1405975_1406599_+	hypothetical protein	NA	NA	NA	NA
AVF16338.1\|1406599_1406716_-	acetyl xylan esterase	NA	NA	NA	NA
AVF16339.1\|1406925_1407951_-\|portal	phage portal protein	Q6K1J0	Salmonella_virus	4.6e-168	83.0
AVF16340.1\|1407952_1409722_-	oxidoreductase	A0A218M4M1	Erwinia_phage	2.1e-301	85.4
AVF16341.1\|1409887_1410742_+\|capsid	capsid scaffolding protein	S4TP53	Salmonella_phage	2.4e-114	73.6
AVF16342.1\|1410797_1411865_+\|capsid	major capsid protein	A0A0M4R4W2	Salmonella_phage	9.7e-169	83.6
AVF16343.1\|1411868_1412624_+\|terminase	terminase	Q6K1I5	Salmonella_virus	1.5e-83	70.1
AVF16344.1\|1412723_1413230_+\|head	head completion/stabilization protein	O80306	Escherichia_phage	9.9e-63	71.4
AVF16345.1\|1413229_1413433_+\|tail	phage tail protein	Q858W3	Yersinia_virus	3.3e-25	79.1
AVF16346.1\|1413423_1413645_+	primosomal protein	A0A218M4L5	Erwinia_phage	7.1e-26	74.0
AVF16347.1\|1413628_1414138_+	glycoside hydrolase	A0A218M4K3	Erwinia_phage	1.2e-81	87.5
AVF16348.1\|1414134_1414560_+	protein lysB	A0A218M4K2	Erwinia_phage	5.6e-43	66.9
AVF19304.1\|1414447_1414693_+\|holin	holin	S4TNY4	Salmonella_phage	6.5e-28	75.3
AVF16349.1\|1414655_1415123_+\|tail	phage tail protein	A0A218M4K6	Erwinia_phage	8.0e-59	69.0
AVF16350.1\|1415115_1415562_+	phage virion morphogenesis protein	O80313	Escherichia_phage	6.0e-48	67.3
AVF16351.1\|1416321_1416963_+\|plate	phage baseplate assembly protein V	A0A0M4S6F6	Salmonella_phage	3.3e-95	82.2
AVF16352.1\|1416959_1417310_+\|plate	baseplate assembly protein	A0A0M4RE59	Salmonella_phage	1.6e-40	73.3
AVF16353.1\|1417315_1418224_+\|plate	baseplate assembly protein	S4TNY7	Salmonella_phage	6.4e-137	83.8
AVF16354.1\|1418216_1418747_+\|tail	phage tail protein I	Q37841	Escherichia_phage	2.8e-92	88.1
AVF16355.1\|1418758_1421107_+\|tail	phage tail protein	A0A0F7LDR4	Escherichia_phage	3.6e-115	51.4
AVF16356.1\|1421108_1421540_+\|tail	tail fiber assembly protein	B6SCW7	Bacteriophage	1.2e-16	39.7
AVF16357.1\|1421914_1423108_+\|tail	phage tail protein	A0A0F7LBW9	Escherichia_phage	1.4e-184	80.9
AVF16358.1\|1423120_1423639_+\|tail	phage major tail tube protein	A0A218M4J0	Erwinia_phage	2.9e-78	81.4
AVF16359.1\|1423696_1424020_+\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	2.3e-25	66.3
AVF16360.1\|1424052_1424175_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	2.9e-13	87.2
AVF16361.1\|1424164_1426615_+\|tail	phage tail tape measure protein	Q858U7	Yersinia_virus	9.3e-308	76.3
AVF16362.1\|1426625_1427090_+\|tail	phage tail protein	A0A218M4I2	Erwinia_phage	7.2e-60	72.1
AVF16363.1\|1427086_1428250_+	hypothetical protein	Q6K1G4	Salmonella_virus	3.0e-171	78.5
AVF16364.1\|1428326_1428545_+	transcriptional regulator	Q37973	Salmonella_virus	1.5e-28	76.4
AVF16365.1\|1428704_1429052_-	50S ribosomal protein L19	NA	NA	NA	NA
AVF16366.1\|1429095_1429863_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AVF16367.1\|1429894_1430434_-	ribosome maturation factor RimM	NA	NA	NA	NA
AVF16368.1\|1430449_1430698_-	30S ribosomal protein S16	NA	NA	NA	NA
AVF16369.1\|1430814_1432176_-	signal recognition particle protein	NA	NA	NA	NA
AVF19305.1\|1432342_1433134_+	inner membrane protein YpjD	NA	NA	NA	NA
AVF16370.1\|1433153_1434440_+	magnesium/cobalt transporter CorC	NA	NA	NA	NA
AVF16371.1\|1434492_1435110_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AVF16372.1\|1435208_1436087_+	NAD(+) kinase	NA	NA	NA	NA
AVF16373.1\|1436172_1437834_+	DNA repair protein RecN	NA	NA	NA	NA
AVF16374.1\|1437808_1437991_+	hypothetical protein	NA	NA	NA	NA
AVF16375.1\|1437972_1438311_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
AVF16376.1\|1438372_1438660_-	RnfH family protein	NA	NA	NA	NA
AVF16377.1\|1438649_1439126_-	ubiquinone-binding protein	NA	NA	NA	NA
AVF16378.1\|1439243_1439726_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8
AVF16379.1\|1440302_1441574_+	DUF4102 domain-containing protein	A0A1B5FPC6	Escherichia_phage	2.3e-217	91.0
AVF16380.1\|1441898_1445546_+	helicase	NA	NA	NA	NA
AVF16381.1\|1446604_1447724_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF16382.1\|1447756_1449631_-	DNA-binding protein	NA	NA	NA	NA
AVF16383.1\|1449627_1450932_-\|integrase	integrase	NA	NA	NA	NA
AVF16384.1\|1450924_1452127_-\|integrase	site-specific integrase	NA	NA	NA	NA
AVF16385.1\|1452422_1452722_-	hypothetical protein	NA	NA	NA	NA
AVF16386.1\|1452742_1452949_-	AlpA family transcriptional regulator	A0A0R6PGY4	Moraxella_phage	8.5e-05	41.1
1460436:1460452	attR	NA	NA	NA	NA

DBSCAN-SWA_90

1460492 : 1461548

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16393.1\|1460492_1461548_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.0e-21	32.3

DBSCAN-SWA_91

1484976 : 1491074

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16413.1\|1484976_1487685_+	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	6.7e-65	33.6
AVF16414.1\|1487653_1489852_+	glycoside hydrolase family 2	NA	NA	NA	NA
AVF16415.1\|1490351_1491074_-	SDR family NAD(P)-dependent oxidoreductase	A0A2P0VP75	Tetraselmis_virus	4.4e-08	27.1

DBSCAN-SWA_92

1505890 : 1508083

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16419.1\|1505890_1508083_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-32	30.7

DBSCAN-SWA_93

1519221 : 1519827

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16428.1\|1519221_1519827_-	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	3.2e-07	25.2

DBSCAN-SWA_94

1524686 : 1529955

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16437.1\|1524686_1524926_+	NrdH-redoxin	A0A0M7REK7	Lactobacillus_phage	3.7e-12	41.9
AVF16438.1\|1524922_1525333_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.0e-17	44.3
AVF16439.1\|1525305_1527450_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	2.9e-188	47.0
AVF16440.1\|1527459_1528419_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	2.0e-136	72.4
AVF16441.1\|1528752_1529955_+	proline/glycine betaine ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.1e-27	37.6

DBSCAN-SWA_95

1544022 : 1551957

Vibrio_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16453.1\|1544022_1544208_-	carbon storage regulator	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
AVF16454.1\|1544449_1547077_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.2
AVF16455.1\|1547208_1547709_-	recombination regulator RecX	NA	NA	NA	NA
AVF16456.1\|1547777_1548836_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.5e-113	63.1
AVF16457.1\|1548925_1549423_-	hypothetical protein	B5TK85	Pseudomonas_phage	9.1e-29	47.1
AVF16458.1\|1549553_1550432_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF16459.1\|1550446_1551307_-	zinc ABC transporter permease	NA	NA	NA	NA
AVF16460.1\|1551303_1551957_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	1.4e-08	24.5

DBSCAN-SWA_96

1557543 : 1558509

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16468.1\|1557543_1558509_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	6.7e-36	34.2

DBSCAN-SWA_97

1566838 : 1567852

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16475.1\|1566838_1567852_-	HTH-type transcriptional regulator GalR	C6ZCU4	Enterobacteria_phage	9.3e-28	27.4

DBSCAN-SWA_98

1586972 : 1592401

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16495.1\|1586972_1587734_+	heme ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.0e-15	30.4
AVF16496.1\|1587749_1588970_+	multidrug transporter MdtH	NA	NA	NA	NA
AVF16497.1\|1588975_1589347_-	nitrous oxide-stimulated promoter family protein	NA	NA	NA	NA
AVF16498.1\|1589495_1589726_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
AVF16499.1\|1589839_1592401_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.1e-32	20.7

DBSCAN-SWA_99

1597994 : 1601669

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16507.1\|1597994_1598987_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6
AVF16508.1\|1599046_1600171_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	3.8e-06	35.1
AVF16509.1\|1600287_1600914_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.7e-36	50.0
AVF16510.1\|1600907_1601669_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.9e-55	47.2

DBSCAN-SWA_100

1604680 : 1606710

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16516.1\|1604680_1605286_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	3.8e-29	38.6
AVF16517.1\|1605285_1606710_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	2.0e-36	28.4

DBSCAN-SWA_101

1620515 : 1621187

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16528.1\|1620515_1621187_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	1.1e-11	31.4

DBSCAN-SWA_102

1624551 : 1627570

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16531.1\|1624551_1625850_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.4e-129	57.9
AVF16532.1\|1625932_1627570_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	50.9

DBSCAN-SWA_103

1630935 : 1639018

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16535.1\|1630935_1632234_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.0e-38	27.4
AVF16536.1\|1632291_1635051_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.3e-55	29.7
AVF16537.1\|1635101_1636247_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	3.3e-50	41.8
AVF16538.1\|1636324_1637662_-	glucarate dehydratase	NA	NA	NA	NA
AVF19310.1\|1637677_1639018_-	galactonate dehydratase	Q6A202	Oenococcus_phage	2.0e-06	23.7

DBSCAN-SWA_104

1643505 : 1644348

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16545.1\|1643505_1644348_+	preQ(1) synthase	A0A2I7SAX1	Vibrio_phage	1.0e-40	36.4

DBSCAN-SWA_105

1649165 : 1649921

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16549.1\|1649165_1649921_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	4.7e-08	28.6

DBSCAN-SWA_106

1653193 : 1668644

environmental_halophage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16554.1\|1653193_1654399_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	1.0e-73	37.8
AVF16555.1\|1654398_1654845_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
AVF16556.1\|1654835_1655642_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.1e-15	33.7
AVF16557.1\|1655717_1656815_-	murein transglycosylase A	NA	NA	NA	NA
AVF16558.1\|1657559_1658813_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.8e-12	28.0
AVF16559.1\|1659040_1660372_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
AVF16560.1\|1660405_1662226_-	exodeoxyribonuclease V subunit alpha	A0A2P0VMS9	Tetraselmis_virus	7.2e-23	27.1
AVF16561.1\|1662222_1665765_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	4.3e-11	21.1
AVF16562.1\|1665761_1668644_-	pitrilysin	A0A1V0SJA4	Klosneuvirus	1.3e-61	24.2

DBSCAN-SWA_107

1674073 : 1678226

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16568.1\|1674073_1674868_-	thymidylate synthase	R4IFY1	Cronobacter_phage	2.6e-118	62.9
AVF16569.1\|1674874_1675750_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AVF16570.1\|1675979_1678226_-	phosphoenolpyruvate-protein phosphotransferase PtsP	A0A1V0SGR7	Hokovirus	5.4e-12	23.9

DBSCAN-SWA_108

1682944 : 1685104

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16576.1\|1682944_1685104_-	bifunctional acyl-ACP--phospholipid O-acyltransferase/long-chain-fatty-acid--ACP ligase	A0A2H4PQU7	Staphylococcus_phage	1.3e-18	26.8

DBSCAN-SWA_109

1691083 : 1692121

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16582.1\|1691083_1692121_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.8e-27	27.0

DBSCAN-SWA_110

1699057 : 1704059

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16591.1\|1699057_1700185_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.8e-11	24.5
AVF16592.1\|1700198_1701485_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AVF16593.1\|1701569_1702985_-	D-xylose transporter XylE	O13311	Aichi_virus	1.4e-26	26.8
AVF16594.1\|1703297_1704059_-	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-19	32.1

DBSCAN-SWA_111

1722169 : 1725141

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16616.1\|1722169_1723054_+	KR domain-containing protein	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.0e-78	56.0
AVF16617.1\|1723158_1725141_-	ribonuclease Z	A0A2P0VMX1	Tetraselmis_virus	1.4e-152	46.0

DBSCAN-SWA_112

1731375 : 1741285

Leptospira_phage(25.0%)

transposase,integrase

attL 1733750:1733770|attR 1741372:1741392

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16625.1\|1731375_1732495_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF16626.1\|1732522_1733194_-	HNH endonuclease	NA	NA	NA	NA
1733750:1733770	attL	NA	NA	NA	NA
AVF16627.1\|1734692_1735839_+	DDE domain-containing protein	U5P429	Shigella_phage	5.0e-147	92.6
AVF16628.1\|1736156_1736621_-	XRE family transcriptional regulator	NA	NA	NA	NA
AVF16629.1\|1737490_1738051_-	recombinase family protein	A0A219Y912	Aeromonas_phage	1.9e-22	40.0
AVF19311.1\|1738943_1739153_-	hypothetical protein	NA	NA	NA	NA
AVF16630.1\|1739332_1741285_-\|integrase	integrase	A0A059XK29	uncultured_phage	2.0e-10	24.9
1741372:1741392	attR	NA	NA	NA	NA

DBSCAN-SWA_113

1750010 : 1752891

Mycobacterium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16638.1\|1750010_1750568_+	recombinase family protein	G8I4U3	Mycobacterium_phage	8.7e-28	39.2
AVF16639.1\|1750744_1751101_-	hypothetical protein	NA	NA	NA	NA
AVF16640.1\|1751103_1751646_-	type IV secretion protein Rhs	NA	NA	NA	NA
AVF16641.1\|1751770_1752891_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_114

1756871 : 1764460

Microcystis_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16645.1\|1756871_1757612_-	LysM peptidoglycan-binding domain-containing protein	A0A7K9	Microcystis_virus	2.2e-10	35.7
AVF16646.1\|1757775_1758318_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
AVF16647.1\|1758366_1759884_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	7.7e-87	37.5
AVF16648.1\|1759893_1760992_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	39.0
AVF16649.1\|1761082_1762816_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.9e-60	28.7
AVF16650.1\|1762821_1763535_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
AVF16651.1\|1763563_1764460_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.1e-29	29.3

DBSCAN-SWA_115

1768902 : 1770336

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16658.1\|1768902_1770336_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	3.3e-31	26.2

DBSCAN-SWA_116

1774788 : 1777662

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16664.1\|1774788_1777662_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	1.8e-262	51.2

DBSCAN-SWA_117

1785458 : 1786691

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16672.1\|1785458_1786691_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	9.0e-102	47.4

DBSCAN-SWA_118

1807658 : 1809207

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16692.1\|1807658_1808453_-	short chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.4e-07	26.0
AVF16693.1\|1808436_1809207_-	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	A0A249XTU1	Mycobacterium_phage	1.6e-08	35.7

DBSCAN-SWA_119

1822054 : 1823209

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16705.1\|1822054_1823209_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.1e-128	63.2

DBSCAN-SWA_120

1853479 : 1855264

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16738.1\|1853479_1855264_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A2K9L0Z8	Tupanvirus	2.7e-14	23.7

DBSCAN-SWA_121

1865194 : 1872298

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16745.1\|1865194_1866526_+	poly-beta-1,6 N-acetyl-D-glucosamine synthase	B9UDL7	Salmonella_phage	8.5e-05	34.8
AVF16746.1\|1866522_1866957_+	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
AVF16747.1\|1867009_1868872_-	bifunctional glutathionylspermidine amidase/synthase	Q56ES0	Aeromonas_virus	1.5e-20	24.0
AVF16748.1\|1869055_1869922_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
AVF16749.1\|1869998_1870748_+	DeoR/GlpR family transcriptional regulator	NA	NA	NA	NA
AVF16750.1\|1870750_1872298_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9

DBSCAN-SWA_122

1881424 : 1887437

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16762.1\|1881424_1882252_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.9e-63	44.9
AVF16763.1\|1882338_1883364_-	DUF3362 domain-containing protein	M1QSD9	Pseudomonas_phage	1.5e-105	71.7
AVF16764.1\|1883463_1883793_-	hypothetical protein	NA	NA	NA	NA
AVF16765.1\|1883997_1886181_-	hypothetical protein	NA	NA	NA	NA
AVF16766.1\|1886316_1887437_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_123

1891310 : 1892420

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16770.1\|1891310_1892420_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.2e-30	28.7

DBSCAN-SWA_124

1896667 : 1901928

Stx2-converting_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16773.1\|1896667_1896970_+	hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	3.2e-08	39.0
AVF16774.1\|1896966_1897317_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBY2	Stx2-converting_phage	9.6e-41	65.5
AVF16775.1\|1899480_1900449_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	6.9e-182	96.9
AVF19320.1\|1900602_1901928_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.5e-114	48.1

DBSCAN-SWA_125

1908992 : 1911109

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16781.1\|1908992_1909949_+	iron-dicitrate transporter subunit FecD	A0A2H4IY97	uncultured_Caudovirales_phage	5.3e-17	26.1
AVF16782.1\|1909949_1910717_+	ferric citrate ABC transporter ATP-binding protein FecE	G3M9Y6	Bacillus_virus	9.8e-14	25.2
AVF19321.1\|1910815_1911109_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZDM8	Stx2-converting_phage	4.7e-49	95.9

DBSCAN-SWA_126

1914749 : 1919028

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16785.1\|1914749_1915832_+	lac repressor	C6ZCU4	Enterobacteria_phage	6.5e-189	98.1
AVF16786.1\|1915953_1919028_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.8

DBSCAN-SWA_127

1923244 : 1924099

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16791.1\|1923244_1924099_+	DDE domain-containing protein	U5P429	Shigella_phage	8.0e-81	56.2

DBSCAN-SWA_128

1934785 : 1937564

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16800.1\|1934785_1937044_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.3e-85	35.1
AVF16801.1\|1937162_1937564_-	TIGR00156 family protein	A0A1I9LJU6	Stx_converting_phage	1.3e-20	44.4

DBSCAN-SWA_129

1946814 : 1954928

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16811.1\|1946814_1948707_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	6.5e-91	34.8
AVF16812.1\|1948735_1949317_-	esterase YqiA	NA	NA	NA	NA
AVF16813.1\|1949316_1950144_-	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
AVF16814.1\|1950171_1950594_-	hypothetical protein	NA	NA	NA	NA
AVF16815.1\|1950590_1951223_-	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.2e-20	36.2
AVF16816.1\|1951426_1952905_+	outer membrane channel protein TolC	NA	NA	NA	NA
AVF16817.1\|1953099_1953765_+	DUF1190 domain-containing protein	A0A173GEW8	Erwinia_phage	1.5e-39	47.5
AVF16818.1\|1953767_1954928_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	9.1e-88	43.6

DBSCAN-SWA_130

1961911 : 1964746

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16825.1\|1961911_1962565_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.6e-44	44.9
AVF16826.1\|1962941_1963238_+	hypothetical protein	NA	NA	NA	NA
AVF16827.1\|1963315_1964746_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.3e-38	28.6

DBSCAN-SWA_131

1969883 : 1971125

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16831.1\|1969883_1971125_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	9.4e-91	47.8

DBSCAN-SWA_132

1980384 : 1988755

Sodalis_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19323.1\|1980384_1982379_-	carboxypeptidase/penicillin-binding protein 1A	Q2A0D0	Sodalis_phage	2.8e-20	24.1
AVF16844.1\|1982718_1983399_+	transcriptional regulator RcsB	NA	NA	NA	NA
AVF16845.1\|1983430_1984444_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.8e-109	58.9
AVF16846.1\|1984680_1984896_+	30S ribosomal protein S21	NA	NA	NA	NA
AVF16847.1\|1985011_1986757_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-76	39.0
AVF16848.1\|1986774_1986894_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AVF16849.1\|1986910_1988755_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7

DBSCAN-SWA_133

1994564 : 1999687

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16856.1\|1994564_1996124_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-08	31.9
AVF16857.1\|1996364_1997885_-	methyl-accepting chemotaxis protein II	A0A1B0V854	Salmonella_phage	4.2e-32	36.7
AVF16858.1\|1998280_1999687_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	1.7e-32	27.6

DBSCAN-SWA_134

2005501 : 2006989

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16866.1\|2005501_2006989_-	autoinducer 2 ABC transporter ATP-binding protein LsrA	A0A2H4PQG7	Staphylococcus_phage	8.8e-19	30.2

DBSCAN-SWA_135

2015171 : 2016137

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16873.1\|2015171_2016137_+	TerC family protein	A0A291LBC5	Escherichia_phage	1.8e-36	33.4

DBSCAN-SWA_136

2033285 : 2035580

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16892.1\|2033285_2035580_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	4.4e-158	41.4

DBSCAN-SWA_137

2041264 : 2042410

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16896.1\|2041264_2042410_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	1.4e-48	39.7

DBSCAN-SWA_138

2059342 : 2067134

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16912.1\|2059342_2060206_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.3e-50	43.8
AVF16913.1\|2060267_2062406_+	short chain dehydrogenase	NA	NA	NA	NA
AVF16914.1\|2062363_2062759_+	YraN family protein	NA	NA	NA	NA
AVF16915.1\|2062780_2063371_+	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	4.1e-12	31.8
AVF16916.1\|2063380_2063956_+	osmotically-inducible protein OsmY	NA	NA	NA	NA
AVF16917.1\|2064006_2065044_-	permease	NA	NA	NA	NA
AVF16918.1\|2065084_2065729_-	hypothetical protein	NA	NA	NA	NA
AVF16919.1\|2065857_2066376_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.4e-11	29.3
AVF16920.1\|2066355_2066790_-	hypothetical protein	NA	NA	NA	NA
AVF16921.1\|2066804_2067134_+	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	8.8e-12	46.8

DBSCAN-SWA_139

2072807 : 2074703

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16928.1\|2072807_2074703_-	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	5.4e-53	31.5

DBSCAN-SWA_140

2080144 : 2091773

Cafeteria_roenbergensis_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16935.1\|2080144_2082832_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.9e-27	27.0
AVF16936.1\|2082856_2084359_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AVF16937.1\|2084387_2084852_-	ribosome maturation factor RimP	NA	NA	NA	NA
AVF16938.1\|2085410_2086757_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	9.6e-65	94.4
AVF16939.1\|2087006_2087339_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AVF16940.1\|2087561_2088899_-	phosphoglucosamine mutase	NA	NA	NA	NA
AVF16941.1\|2088891_2089740_-	dihydropteroate synthase	S4W084	Pandoravirus	9.8e-23	29.0
AVF16942.1\|2089838_2091773_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	7.0e-117	43.5

DBSCAN-SWA_141

2095215 : 2096918

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16947.1\|2095215_2095878_+	two-component system response regulator BasR	W8CYM9	Bacillus_phage	9.0e-32	38.1
AVF16948.1\|2095874_2096918_+	two-component system sensor histidine kinase BasS	W8CYF6	Bacillus_phage	7.3e-12	23.0

DBSCAN-SWA_142

2100049 : 2101538

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16953.1\|2100049_2101021_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	3.5e-08	26.2
AVF19325.1\|2101250_2101538_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	1.0e-16	69.8

DBSCAN-SWA_143

2105582 : 2132066

Staphylococcus_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16960.1\|2105582_2106395_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	2.2e-19	30.2
AVF16961.1\|2106480_2106681_+	hypothetical protein	NA	NA	NA	NA
AVF16962.1\|2106622_2107600_+	calcium/sodium antiporter	NA	NA	NA	NA
AVF16963.1\|2107613_2108600_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.1e-38	31.7
AVF16964.1\|2108614_2109181_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	8.5e-55	75.6
AVF16965.1\|2109177_2109753_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AVF16966.1\|2109721_2110276_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
AVF16967.1\|2110282_2111008_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	27.4
AVF16968.1\|2111055_2112489_+	RNA polymerase sigma-54 factor	NA	NA	NA	NA
AVF16969.1\|2112511_2112799_+	ribosome hibernation promoting factor	NA	NA	NA	NA
AVF16970.1\|2112881_2113373_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
AVF16971.1\|2113418_2114273_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
AVF16972.1\|2114269_2114542_+	HPr family phosphocarrier protein	NA	NA	NA	NA
AVF16973.1\|2114581_2115307_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AVF16974.1\|2115303_2115957_-	isoprenoid biosynthesis protein ElbB	NA	NA	NA	NA
AVF16975.1\|2116189_2118523_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	8.4e-40	30.7
AVF16976.1\|2118660_2119743_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
AVF16977.1\|2119742_2120843_-	LPS export ABC transporter permease LptF	NA	NA	NA	NA
AVF16978.1\|2121108_2122620_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.2e-47	36.2
AVF16979.1\|2122737_2123181_+	DNA polymerase III subunit chi	NA	NA	NA	NA
AVF16980.1\|2123180_2126036_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-141	36.9
AVF16981.1\|2126159_2126663_+	aminoalkylphosphonate N-acetyltransferase	NA	NA	NA	NA
AVF16982.1\|2126746_2127766_+	alcohol dehydrogenase AdhP	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	7.1e-44	30.7
AVF16983.1\|2127858_2129505_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
AVF16984.1\|2129642_2131145_+	ATP-binding protein	A0A248XCZ8	Klebsiella_phage	3.3e-82	43.9
AVF19326.1\|2131124_2132066_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.2e-16	34.2

DBSCAN-SWA_144

2144458 : 2144956

Pseudomonas_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19327.1\|2144458_2144956_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-26	53.7

DBSCAN-SWA_145

2148976 : 2150344

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF16998.1\|2148976_2150344_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	26.4

DBSCAN-SWA_146

2170032 : 2171076

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17015.1\|2170032_2171076_-	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_147

2184331 : 2186416

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17030.1\|2184331_2186416_+	oxygen-sensing cyclic-di-GMP phosphodiesterase	G3MA91	Bacillus_virus	7.0e-22	34.8

DBSCAN-SWA_148

2199829 : 2204154

Pandoravirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17038.1\|2199829_2200402_-	L-threonylcarbamoyladenylate synthase type 1 TsaC	S4VW33	Pandoravirus	4.9e-10	26.2
AVF17039.1\|2200394_2200949_-	type I DNA topoisomerase	NA	NA	NA	NA
AVF17040.1\|2200975_2201449_-	DUF494 domain-containing protein	NA	NA	NA	NA
AVF17041.1\|2201420_2202545_-	DNA-protecting protein DprA	NA	NA	NA	NA
AVF17042.1\|2202672_2203182_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-18	40.3
AVF17043.1\|2203206_2204154_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.1e-06	35.0

DBSCAN-SWA_149

2224041 : 2227410

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17081.1\|2224041_2225226_-	elongation factor Tu	A0A2K9L516	Tupanvirus	1.3e-12	26.1
AVF17082.1\|2225295_2227410_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-57	27.5

DBSCAN-SWA_150

2235217 : 2240641

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17095.1\|2235217_2237122_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.3e-75	33.5
AVF17096.1\|2237137_2238070_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVF17097.1\|2238165_2239062_-	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
AVF17098.1\|2239061_2239679_-	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
AVF17099.1\|2239681_2240641_-	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	1.7e-55	93.5

DBSCAN-SWA_151

2246459 : 2253034

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17105.1\|2246459_2246678_+	hypothetical protein	A0A2H4J8A7	uncultured_Caudovirales_phage	1.1e-05	39.1
AVF17106.1\|2246708_2247578_+	phosphoribulokinase	NA	NA	NA	NA
AVF17107.1\|2247673_2248078_-	OsmC family protein	NA	NA	NA	NA
AVF19330.1\|2248004_2248226_+	hypothetical protein	NA	NA	NA	NA
AVF17108.1\|2248388_2249021_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
AVF17109.1\|2249078_2251166_+	hypothetical protein	H9YQA8	environmental_Halophage	2.0e-64	84.8
AVF17110.1\|2251162_2252398_-	acetylornithine transaminase	NA	NA	NA	NA
AVF17111.1\|2252470_2253034_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	3.0e-60	56.5

DBSCAN-SWA_152

2263335 : 2264148

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17123.1\|2263335_2264148_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	2.7e-70	50.2

DBSCAN-SWA_153

2280930 : 2284701

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17140.1\|2280930_2282547_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.4e-139	51.7
AVF17141.1\|2282638_2283985_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	2.5e-12	24.1
AVF17142.1\|2283981_2284701_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.5e-29	34.7

DBSCAN-SWA_154

2290939 : 2291722

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17148.1\|2290939_2291722_-	pimeloyl-[acyl-carrier protein] methyl ester esterase	G9VYU4	Mycobacterium_phage	7.0e-07	33.7

DBSCAN-SWA_155

2296875 : 2299269

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17153.1\|2296875_2299269_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	6.8e-13	40.2

DBSCAN-SWA_156

2302608 : 2303367

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17155.1\|2302608_2303367_-	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.2e-21	30.3

DBSCAN-SWA_157

2306478 : 2308926

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17159.1\|2306478_2308926_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	1.2e-33	83.3

DBSCAN-SWA_158

2327014 : 2328822

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17174.1\|2327014_2327755_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	9.2e-09	24.5
AVF17175.1\|2327751_2328822_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	9.8e-20	34.2

DBSCAN-SWA_159

2332275 : 2333755

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17179.1\|2332275_2332989_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	6.3e-15	31.2
AVF17180.1\|2332990_2333755_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-12	25.6

DBSCAN-SWA_160

2339310 : 2343534

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17187.1\|2339310_2340576_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.3e-26	27.6
AVF17188.1\|2340712_2341570_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.2e-45	42.3
AVF17189.1\|2341820_2342876_-	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
AVF17190.1\|2342868_2343534_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	3.8e-14	26.6

DBSCAN-SWA_161

2346563 : 2349438

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17195.1\|2346563_2347190_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	1.5e-31	62.8
AVF17196.1\|2347266_2349438_+	zinc/cadmium/mercury/lead-transporting ATPase	E4ZFI9	Streptococcus_phage	4.5e-120	37.6

DBSCAN-SWA_162

2352556 : 2353634

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17200.1\|2352556_2352799_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	6.0e-10	80.6
AVF17201.1\|2352968_2353634_+	VUT family protein	A0A2I7SAW6	Vibrio_phage	7.4e-58	55.3

DBSCAN-SWA_163

2372822 : 2383155

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17224.1\|2372822_2373848_-	tellurium resistance protein TerC	K7QKE8	Escherichia_phage	4.6e-75	47.4
AVF17225.1\|2374176_2375511_+	hexose-6-phosphate:phosphate antiporter	NA	NA	NA	NA
AVF17226.1\|2375547_2376285_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
AVF17227.1\|2376454_2377147_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	E3T536	Cafeteria_roenbergensis_virus	1.2e-07	36.2
AVF17228.1\|2377146_2378091_+	phosphoglycerate dehydrogenase	M1HBE3	Paramecium_bursaria_Chlorella_virus	6.0e-21	33.2
AVF17229.1\|2378460_2378895_-	copper-binding protein	NA	NA	NA	NA
AVF17230.1\|2379112_2380513_-	sensor histidine kinase	W8CYF6	Bacillus_phage	3.2e-18	26.6
AVF17231.1\|2380509_2381190_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AVF17232.1\|2381244_2381934_-	copper resistance protein CopD	NA	NA	NA	NA
AVF17233.1\|2382035_2383155_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_164

2392951 : 2394994

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17241.1\|2392951_2394994_-	oligopeptidase A	A0A1V0SD92	Indivirus	6.8e-46	22.9

DBSCAN-SWA_165

2441518 : 2442133

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17272.1\|2441518_2442133_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.8e-19	34.0

DBSCAN-SWA_166

2450803 : 2451799

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17279.1\|2450803_2451799_+	glucans biosynthesis protein MdoC	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	7.0e-12	24.1

DBSCAN-SWA_167

2456124 : 2457666

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17282.1\|2456124_2457666_+	D-xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-16	29.8

DBSCAN-SWA_168

2481344 : 2483183

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17302.1\|2481344_2483183_-\|tRNA	selenocysteinyl-tRNA-specific translation elongation factor SelB	A0A2K9KZ60	Tupanvirus	1.4e-13	25.5

DBSCAN-SWA_169

2508804 : 2510451

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17323.1\|2508804_2510451_-	acetolactate synthase 2 catalytic subunit	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	4.5e-64	31.9

DBSCAN-SWA_170

2520646 : 2522494

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17329.1\|2520646_2522494_-	vitamin B12/cobalamin outer membrane transporter	A0A0P0I887	Acinetobacter_phage	2.2e-11	29.3

DBSCAN-SWA_171

2550789 : 2555759

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17353.1\|2550789_2552121_+	HslU--HslV peptidase ATPase subunit	A0A173GE36	Erwinia_phage	1.9e-44	29.7
AVF17354.1\|2552183_2553110_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
AVF17355.1\|2553202_2553688_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
AVF17356.1\|2553853_2554048_-	hypothetical protein	NA	NA	NA	NA
AVF17357.1\|2554274_2554514_-	septal ring assembly protein ZapB	NA	NA	NA	NA
AVF17358.1\|2554913_2555759_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	7.5e-15	28.7

DBSCAN-SWA_172

2567635 : 2571119

Feldmannia_irregularis_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17370.1\|2567635_2568334_+	DNA-binding response regulator	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3
AVF17371.1\|2568330_2569704_+	two-component system sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	7.2e-15	25.6
AVF17372.1\|2569757_2570432_-	MOSC domain-containing protein	NA	NA	NA	NA
AVF17373.1\|2570498_2571119_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.9e-64	59.8

DBSCAN-SWA_173

2579330 : 2580833

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17382.1\|2579330_2580833_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.9e-19	29.0

DBSCAN-SWA_174

2607440 : 2610218

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17411.1\|2607440_2608241_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.1e-23	30.5
AVF17412.1\|2608275_2609172_-	ribokinase	NA	NA	NA	NA
AVF17413.1\|2609327_2610218_+	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	1.6e-63	94.6

DBSCAN-SWA_175

2623250 : 2625724

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17423.1\|2623250_2624300_+	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	3.4e-09	26.1
AVF17424.1\|2624311_2625724_+	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	1.1e-05	27.9

DBSCAN-SWA_176

2629643 : 2632436

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17429.1\|2629643_2632436_-	DNA polymerase I	A0A1B1IWN2	uncultured_Mediterranean_phage	1.1e-54	27.6

DBSCAN-SWA_177

2644568 : 2652489

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17437.1\|2644568_2645561_-	transcriptional regulator RbsR	C6ZCU4	Enterobacteria_phage	1.1e-36	33.7
AVF17438.1\|2645564_2646494_-	ribokinase	NA	NA	NA	NA
AVF17439.1\|2646602_2647493_-	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	3.3e-05	23.7
AVF17440.1\|2647520_2648486_-	ribose ABC transporter permease	NA	NA	NA	NA
AVF17441.1\|2648490_2649996_-	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	1.3e-17	21.7
AVF17442.1\|2650003_2650423_-	D-ribose pyranase	NA	NA	NA	NA
AVF17443.1\|2650620_2652489_-	low affinity potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	1.7e-64	29.7

DBSCAN-SWA_178

2655653 : 2656646

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17446.1\|2655653_2656646_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.5e-48	37.0

DBSCAN-SWA_179

2668429 : 2671855

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17460.1\|2668429_2669800_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	3.4e-33	34.0
AVF17461.1\|2670025_2671855_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	4.7e-131	42.7

DBSCAN-SWA_180

2677302 : 2684107

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17466.1\|2677302_2678343_+	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.7e-48	38.7
AVF17467.1\|2678471_2679431_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AVF17468.1\|2679430_2680321_+	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AVF17469.1\|2680368_2681142_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
AVF17470.1\|2681168_2681894_+	phosphate transport system regulator PhoU	NA	NA	NA	NA
AVF17471.1\|2681938_2682604_-	sugar phosphatase	NA	NA	NA	NA
AVF17472.1\|2682766_2684107_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.6e-65	37.6

DBSCAN-SWA_181

2691615 : 2698966

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17480.1\|2691615_2691873_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7
AVF17481.1\|2691836_2692196_-	ribonuclease P protein component	NA	NA	NA	NA
AVF17482.1\|2692212_2692353_-	50S ribosomal protein L34	NA	NA	NA	NA
AVF17483.1\|2692464_2692665_+	hypothetical protein	NA	NA	NA	NA
AVF17484.1\|2692953_2694348_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
AVF17485.1\|2694352_2695453_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.5e-52	35.0
AVF17486.1\|2695452_2696526_+	DNA replication and repair protein RecF	NA	NA	NA	NA
AVF17487.1\|2696554_2698966_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.1e-114	34.2

DBSCAN-SWA_182

2704384 : 2705533

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17494.1\|2704384_2705533_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-52	33.1

DBSCAN-SWA_183

2708913 : 2709889

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17498.1\|2708913_2709324_+	heat shock protein IbpA	A0A218MKI2	uncultured_virus	4.1e-19	39.2
AVF17499.1\|2709460_2709889_+	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	2.5e-14	37.3

DBSCAN-SWA_184

2718804 : 2719989

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19341.1\|2718804_2719989_-	multidrug transporter EmrD	S4TR35	Salmonella_phage	2.1e-15	25.6

DBSCAN-SWA_185

2723205 : 2724894

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17511.1\|2723205_2724894_+	acetolactate synthase 2 catalytic subunit	G8DDL3	Micromonas_pusilla_virus	7.6e-59	31.0

DBSCAN-SWA_186

2742500 : 2743658

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17529.1\|2742500_2743658_-	MFS transporter	S4TR35	Salmonella_phage	5.6e-29	26.8

DBSCAN-SWA_187

2771516 : 2773613

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17557.1\|2771516_2773613_+	multidrug ABC transporter permease/ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	1.3e-12	24.4

DBSCAN-SWA_188

2776730 : 2780905

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17562.1\|2776730_2777819_-	DNA replication/repair protein RecF	A0A077SLJ9	Escherichia_phage	2.3e-125	62.2
AVF17563.1\|2777965_2778925_-	UV DNA damage repair endonuclease UvsE	NA	NA	NA	NA
AVF17564.1\|2779537_2780263_-	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.4e-41	43.2
AVF17565.1\|2780380_2780905_+	hypothetical protein	A0A1W6JNX6	Morganella_phage	4.9e-49	58.2

DBSCAN-SWA_189

2792461 : 2799579

uncultured_Caudovirales_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17580.1\|2792461_2793582_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF17581.1\|2794376_2795855_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.1e-199	74.2
AVF17582.1\|2795873_2796701_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	2.2e-51	42.0
AVF17583.1\|2796883_2798089_+	MFS transporter	NA	NA	NA	NA
AVF17584.1\|2798540_2798864_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AVF17585.1\|2798865_2799579_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	4.3e-96	73.0

DBSCAN-SWA_190

2803044 : 2812204

uncultured_Caudovirales_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17590.1\|2803044_2803470_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.7e-52	72.9
AVF17591.1\|2803482_2804772_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.0e-172	74.2
AVF17592.1\|2804819_2806571_-	arsenical pump-driving ATPase	NA	NA	NA	NA
AVF17593.1\|2806588_2806954_-	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AVF17594.1\|2807001_2807352_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	8.1e-24	51.9
AVF17595.1\|2807557_2809258_+	ATP-dependent endonuclease	NA	NA	NA	NA
AVF17596.1\|2809259_2810885_+	ATP-dependent helicase	Q331U3	Clostridium_botulinum_C_phage	2.8e-10	21.9
AVF17597.1\|2810980_2812204_-	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	5.5e-160	69.7

DBSCAN-SWA_191

2818368 : 2819760

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17601.1\|2818368_2819760_-	xanthine permease XanP	H9YQ34	environmental_Halophage	2.3e-69	95.9

DBSCAN-SWA_192

2823970 : 2828979

Bordetella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17605.1\|2823970_2826085_-	bifunctional GTP diphosphokinase/guanosine-3',5'-bis(diphosphate) 3'-diphosphatase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5
AVF17606.1\|2826104_2826380_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AVF17607.1\|2826434_2827058_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	9.7e-20	35.0
AVF17608.1\|2827105_2827291_-	hypothetical protein	NA	NA	NA	NA
AVF17609.1\|2827308_2828979_+	NAD-dependent DNA ligase LigB	F8SJM3	Pseudomonas_phage	1.9e-22	24.3

DBSCAN-SWA_193

2841444 : 2849043

Xanthomonas_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19345.1\|2841444_2841900_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	9.5e-49	60.8
AVF19346.1\|2841880_2843092_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.4e-40	32.1
AVF17621.1\|2843265_2843931_+	JAB domain-containing protein	NA	NA	NA	NA
AVF17622.1\|2844148_2844385_+	50S ribosomal protein L28	NA	NA	NA	NA
AVF17623.1\|2844407_2844575_+	50S ribosomal protein L33	NA	NA	NA	NA
AVF17624.1\|2844647_2845457_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	1.2e-25	32.6
AVF17625.1\|2845459_2845939_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.1e-26	43.9
AVF17626.1\|2845942_2846713_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AVF17627.1\|2846712_2847987_-	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AVF17628.1\|2848053_2849043_-	glycosyltransferase	A0A1V0SAH6	Catovirus	2.7e-08	26.4

DBSCAN-SWA_194

2857548 : 2860929

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17637.1\|2857548_2858481_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.8e-36	36.4
AVF17638.1\|2858694_2859891_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	4.6e-34	27.8
AVF17639.1\|2859900_2860929_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8

DBSCAN-SWA_195

2865029 : 2876956

Planktothrix_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17644.1\|2865029_2866313_-	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	4.6e-08	35.4
AVF17645.1\|2866322_2867867_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AVF17646.1\|2868115_2868547_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
AVF17647.1\|2868558_2868810_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	1.1e-14	52.1
AVF17648.1\|2868841_2869309_+	protein-export chaperone SecB	NA	NA	NA	NA
AVF17649.1\|2869308_2870328_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AVF19347.1\|2870403_2871225_+	serine O-acetyltransferase	NA	NA	NA	NA
AVF17650.1\|2871279_2871561_-	peptidylprolyl isomerase C	NA	NA	NA	NA
AVF17651.1\|2871646_2873671_+	DNA helicase Rep	A7KV33	Bacillus_phage	7.6e-114	37.5
AVF17652.1\|2873722_2875207_-	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
AVF17653.1\|2875213_2876482_-	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	3.7e-42	31.2
AVF17654.1\|2876626_2876956_+	thioredoxin TrxA	A0A1V0SD63	Indivirus	2.5e-14	38.5

DBSCAN-SWA_196

2881019 : 2885218

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17658.1\|2881019_2882150_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.4e-27	30.2
AVF17659.1\|2882146_2883409_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	1.5e-22	26.4
AVF17660.1\|2883405_2884083_+	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
AVF17661.1\|2884087_2885218_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	5.1e-19	33.5

DBSCAN-SWA_197

2903150 : 2907011

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17678.1\|2903150_2904053_+	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	7.0e-19	29.9
AVF17679.1\|2904052_2904769_+	dUMP phosphatase	NA	NA	NA	NA
AVF17680.1\|2904848_2907011_+	DNA helicase II	A7KV33	Bacillus_phage	2.5e-115	37.2

DBSCAN-SWA_198

2910937 : 2912767

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17686.1\|2910937_2912767_+	DNA helicase RecQ	A0A1V0SBK0	Catovirus	1.3e-83	37.4

DBSCAN-SWA_199

2925112 : 2928403

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17699.1\|2925112_2926753_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	2.8e-42	28.2
AVF17700.1\|2926829_2927084_+	Sec-independent protein translocase protein TatA	NA	NA	NA	NA
AVF17701.1\|2927087_2927630_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
AVF17702.1\|2927632_2928403_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.9e-25	31.7

DBSCAN-SWA_200

2932337 : 2936813

Erysipelothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17705.1\|2932337_2933957_+	energy-dependent translational throttle protein EttA	A0A2I4R674	Erysipelothrix_phage	8.1e-26	25.5
AVF17706.1\|2933995_2934283_-	transcriptional regulator	NA	NA	NA	NA
AVF17707.1\|2934613_2935324_+	chromosome partition protein MukB	NA	NA	NA	NA
AVF17708.1\|2935567_2935780_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.2e-22	74.3
AVF17709.1\|2935838_2936813_-	glyoxylate/hydroxypyruvate reductase GhrB	M1HTA3	Paramecium_bursaria_Chlorella_virus	9.5e-22	27.7

DBSCAN-SWA_201

2941992 : 2944362

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17715.1\|2941992_2944362_+	trimethylamine-N-oxide reductase TorA	A0A077SK27	Escherichia_phage	3.5e-70	30.0

DBSCAN-SWA_202

2952926 : 2953895

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17724.1\|2952926_2953895_+\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	6.9e-182	96.9

DBSCAN-SWA_203

2960804 : 2965853

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17730.1\|2960804_2961788_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-14	28.9
AVF17731.1\|2961784_2962798_+	dipeptide ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-17	29.4
AVF17732.1\|2962840_2963791_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.1e-27	32.0
AVF17733.1\|2964668_2965853_+	elongation factor Tu	A0A2K9L516	Tupanvirus	2.6e-13	26.5

DBSCAN-SWA_204

2969842 : 2980577

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17740.1\|2969842_2973871_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	3.6e-22	29.4
AVF17741.1\|2973947_2978171_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	4.5e-68	27.4
AVF17742.1\|2978229_2978547_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
AVF17743.1\|2978546_2978855_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AVF17744.1\|2979035_2980577_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.7e-12	35.1

DBSCAN-SWA_205

2988997 : 2994415

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17754.1\|2988997_2989669_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	1.3e-22	30.1
AVF17755.1\|2989710_2990301_+	DUF416 domain-containing protein	NA	NA	NA	NA
AVF17756.1\|2990487_2990760_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	1.2e-19	56.7
AVF17757.1\|2990771_2991464_+	DUF1481 domain-containing protein	NA	NA	NA	NA
AVF17758.1\|2991517_2992810_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AVF17759.1\|2992825_2994415_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.1e-67	48.4

DBSCAN-SWA_206

3007130 : 3013256

Brucella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17765.1\|3007130_3010814_+	methionine synthase	A0A140XBC7	Dickeya_phage	2.2e-26	91.8
AVF17766.1\|3011031_3012663_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
AVF19350.1\|3012659_3012947_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.2e-12	44.3
AVF17767.1\|3012953_3013256_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.9e-22	53.8

DBSCAN-SWA_207

3028020 : 3029130

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17781.1\|3028020_3029130_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_208

3036226 : 3036835

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17787.1\|3036226_3036835_+	repressor LexA	Q9G0C2	Lactococcus_phage	2.7e-14	40.7

DBSCAN-SWA_209

3043892 : 3046401

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17794.1\|3043892_3045305_+	replicative DNA helicase DnaB	O80281	Escherichia_phage	8.2e-200	78.3
AVF17795.1\|3045321_3046401_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.8e-30	28.6

DBSCAN-SWA_210

3049569 : 3053168

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17800.1\|3049569_3052392_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.8
AVF17801.1\|3052643_3053168_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	5.1e-54	96.3

DBSCAN-SWA_211

3058879 : 3060264

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17805.1\|3058879_3059999_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF17806.1\|3060051_3060264_-	hypothetical protein	Q70BJ6	Escherichia_phage	9.3e-07	51.9

DBSCAN-SWA_212

3073147 : 3074497

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17816.1\|3073147_3074497_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.7e-159	71.8

DBSCAN-SWA_213

3080581 : 3082540

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17823.1\|3080581_3082540_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.0e-91	41.1

DBSCAN-SWA_214

3085631 : 3088767

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17827.1\|3085631_3087779_-	formate dehydrogenase subunit alpha	A0A077SK27	Escherichia_phage	3.6e-29	23.9
AVF17828.1\|3088035_3088767_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.8e-26	38.2

DBSCAN-SWA_215

3093414 : 3094929

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17834.1\|3093414_3094929_-	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-15	27.1

DBSCAN-SWA_216

3100657 : 3102201

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17841.1\|3100657_3101338_-	phosphonate C-P lyase system protein PhnL	F2Y2R6	Organic_Lake_phycodnavirus	6.5e-09	29.2
AVF17842.1\|3101445_3102201_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	3.6e-16	27.4

DBSCAN-SWA_217

3107816 : 3108605

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17849.1\|3107816_3108605_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.9e-14	28.7

DBSCAN-SWA_218

3115097 : 3116600

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17855.1\|3115097_3116600_+	proline/glycine betaine transporter ProP	Q6JIH2	Burkholderia_virus	7.7e-55	31.7

DBSCAN-SWA_219

3133456 : 3135437

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17867.1\|3133456_3133750_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3
AVF17868.1\|3133790_3135437_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3

DBSCAN-SWA_220

3141727 : 3142258

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17879.1\|3141727_3142258_-	hypothetical protein	A0A1W6JNX6	Morganella_phage	1.7e-44	49.7

DBSCAN-SWA_221

3148152 : 3149130

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17886.1\|3148152_3149130_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	4.4e-27	28.8

DBSCAN-SWA_222

3156412 : 3156958

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17890.1\|3156412_3156958_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	3.4e-29	41.0

DBSCAN-SWA_223

3160874 : 3173856

Vibrio_phage(20.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17894.1\|3160874_3162215_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	3.3e-17	30.1
AVF17895.1\|3162224_3164069_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.7e-59	30.4
AVF17896.1\|3164061_3165012_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AVF17897.1\|3165097_3165409_+	RNA-binding protein Hfq	NA	NA	NA	NA
AVF17898.1\|3165483_3166764_+	GTPase HflX	NA	NA	NA	NA
AVF17899.1\|3166820_3168080_+\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
AVF17900.1\|3168082_3169087_+\|protease	protease modulator HflC	NA	NA	NA	NA
AVF17901.1\|3169158_3169356_+	DUF2065 domain-containing protein	NA	NA	NA	NA
AVF17902.1\|3169459_3170758_+	adenylosuccinate synthase	W5S5V7	Pithovirus	6.4e-66	35.4
AVF19357.1\|3170950_3171376_+	HTH-type transcriptional repressor NsrR	NA	NA	NA	NA
AVF17903.1\|3171414_3173856_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.8e-67	32.4

DBSCAN-SWA_224

3178650 : 3179814

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17910.1\|3178650_3179814_+	bifunctional glutathionylspermidine amidase/synthase	B2ZXR7	Ralstonia_phage	2.0e-79	42.1

DBSCAN-SWA_225

3182936 : 3184868

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17913.1\|3182936_3184868_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	36.2

DBSCAN-SWA_226

3200875 : 3202525

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17935.1\|3200875_3202525_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	30.7

DBSCAN-SWA_227

3218413 : 3226537

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17949.1\|3218413_3218944_-	inorganic pyrophosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.6e-55	62.7
AVF17950.1\|3219253_3220210_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF17951.1\|3220312_3221815_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.0e-10	28.8
AVF17952.1\|3221828_3222851_+	ribose ABC transporter permease	NA	NA	NA	NA
AVF17953.1\|3222837_3223839_+	sugar ABC transporter permease YjfF	NA	NA	NA	NA
AVF17954.1\|3223932_3225501_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-07	27.1
AVF17955.1\|3225538_3226537_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	3.7e-69	43.0

DBSCAN-SWA_228

3239963 : 3242707

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17971.1\|3239963_3240428_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	1.2e-51	56.4
AVF17972.1\|3240568_3242707_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.7e-268	64.9

DBSCAN-SWA_229

3246321 : 3256490

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF17975.1\|3246321_3247269_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	6.0e-13	21.5
AVF17976.1\|3247655_3250364_+	magnesium-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	2.0e-37	25.0
AVF17977.1\|3250566_3252951_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
AVF17978.1\|3253036_3254485_-	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.2e-22	35.3
AVF17979.1\|3254623_3255010_-	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
AVF17980.1\|3255083_3255545_-	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
AVF17981.1\|3255557_3256490_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-52	40.2

DBSCAN-SWA_230

3274310 : 3277661

Thermus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19362.1\|3274310_3275519_+	DNA cytosine methyltransferase	A7XXH6	Thermus_virus	3.7e-31	28.2
AVF17997.1\|3275515_3276166_+	Eco29kI family restriction endonuclease	NA	NA	NA	NA
AVF17998.1\|3276541_3277661_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8

DBSCAN-SWA_231

3282317 : 3284678

Liberibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18002.1\|3282317_3284678_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	3.9e-29	24.3

DBSCAN-SWA_232

3291760 : 3292465

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18006.1\|3291760_3292465_-	HNH endonuclease	R9TGY8	Vibrio_phage	1.0e-04	36.1

DBSCAN-SWA_233

3300241 : 3303147

Acidithiobacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18014.1\|3300241_3302194_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	K4I1H4	Acidithiobacillus_phage	5.7e-26	30.7
AVF18015.1\|3302325_3303147_-	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	A0A076YKN0	Mycobacterium_phage	7.3e-15	27.8

DBSCAN-SWA_234

3308932 : 3316041

IC4_retrovirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18023.1\|3308932_3314515_+	two-component system sensor histidine kinase AtoS	Q67624	IC4_retrovirus	3.4e-07	33.3
AVF18024.1\|3314518_3315136_-	two-component system response regulator NarL	NA	NA	NA	NA
AVF18025.1\|3315435_3316041_+\|protease	ATP-dependent Clp protease proteolytic subunit	G3M9Z8	Bacillus_virus	7.2e-28	39.8

DBSCAN-SWA_235

3319227 : 3319482

Edwardsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18028.1\|3319227_3319482_-	hypothetical protein	A0A077KGV8	Edwardsiella_phage	2.1e-05	38.7

DBSCAN-SWA_236

3348583 : 3350248

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18057.1\|3348583_3350248_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-14	30.4

DBSCAN-SWA_237

3354162 : 3355442

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18061.1\|3354162_3354900_-	DNA replication protein DnaC	A0A1W6JP39	Morganella_phage	7.1e-62	48.1
AVF18062.1\|3354896_3355442_-	primosomal protein DnaT	T1SA92	Salmonella_phage	2.6e-24	56.4

DBSCAN-SWA_238

3362766 : 3363831

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18072.1\|3362766_3363831_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.4e-20	36.9

DBSCAN-SWA_239

3367570 : 3370369

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18077.1\|3367570_3369160_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	5.3e-30	26.0
AVF18078.1\|3369464_3370082_+	molecular chaperone OsmY	NA	NA	NA	NA
AVF18079.1\|3370189_3370369_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.5e-13	69.8

DBSCAN-SWA_240

3375829 : 3377152

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18084.1\|3375829_3377152_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	6.8e-79	39.5

DBSCAN-SWA_241

3384556 : 3391832

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18089.1\|3384556_3385789_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.4e-88	44.4
AVF18090.1\|3385862_3386864_-	alcohol dehydrogenase AdhP	NA	NA	NA	NA
AVF18091.1\|3386972_3387872_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
AVF18092.1\|3388000_3389668_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	1.1e-41	26.6
AVF18093.1\|3389894_3391832_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	1.4e-11	35.5

DBSCAN-SWA_242

3405241 : 3419069

Synechococcus_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18108.1\|3405241_3406195_+	transaldolase	A0A0E3G6C9	Synechococcus_phage	5.7e-11	35.2
AVF18109.1\|3406305_3406893_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AVF18110.1\|3407015_3408338_+	MFS transporter	NA	NA	NA	NA
AVF18111.1\|3408314_3408881_-	hypothetical protein	NA	NA	NA	NA
AVF18112.1\|3409176_3411090_+	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.3
AVF18113.1\|3411177_3412323_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.1e-24	35.3
AVF18114.1\|3412496_3413672_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	3.4e-74	49.4
AVF18115.1\|3413730_3414630_+	transcriptional activator NhaR	NA	NA	NA	NA
AVF18116.1\|3414688_3414952_-	30S ribosomal protein S20	NA	NA	NA	NA
AVF18117.1\|3415002_3415206_+	hypothetical protein	NA	NA	NA	NA
AVF18118.1\|3415280_3416207_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AVF18119.1\|3416252_3419069_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	1.0e-79	26.3

DBSCAN-SWA_243

3422569 : 3423718

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18124.1\|3422569_3423718_+	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.4e-48	31.9

DBSCAN-SWA_244

3433331 : 3434698

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18129.1\|3433331_3433811_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	2.6e-28	46.4
AVF18130.1\|3433849_3434698_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A1J0MGN8	Acinetobacter_phage	3.7e-06	43.1

DBSCAN-SWA_245

3442337 : 3447729

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18138.1\|3442337_3445244_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	2.9e-21	37.1
AVF18139.1\|3445186_3445375_-	hypothetical protein	NA	NA	NA	NA
AVF18140.1\|3445371_3447729_-	DNA polymerase II	A0A0P0YM26	Yellowstone_lake_phycodnavirus	5.9e-33	25.2

DBSCAN-SWA_246

3453947 : 3454646

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18146.1\|3453947_3454646_-	thiamine ABC transporter ATP-binding protein ThiQ	G9BWD6	Planktothrix_phage	1.4e-22	35.2

DBSCAN-SWA_247

3467833 : 3469558

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18159.1\|3467833_3469558_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.2e-36	26.5

DBSCAN-SWA_248

3495509 : 3496553

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18182.1\|3495509_3496553_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.1e-103	56.6

DBSCAN-SWA_249

3500745 : 3501309

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18187.1\|3500745_3501309_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	3.7e-10	31.2

DBSCAN-SWA_250

3512249 : 3513674

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18195.1\|3512249_3513674_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.5e-41	27.3

DBSCAN-SWA_251

3526182 : 3528501

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18203.1\|3526182_3526719_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.3e-17	33.1
AVF18204.1\|3526804_3527467_-	carbonate dehydratase	NA	NA	NA	NA
AVF18205.1\|3527574_3528501_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-22	32.3

DBSCAN-SWA_252

3541069 : 3547843

unidentified_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19373.1\|3541069_3542494_-	polynucleotide adenylyltransferase	H7BUW3	unidentified_phage	1.6e-25	31.5
AVF18220.1\|3542509_3543400_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
AVF18221.1\|3543459_3543915_-	RNA polymerase-binding transcription factor DksA	NA	NA	NA	NA
AVF18222.1\|3544091_3544796_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
AVF18223.1\|3544785_3545340_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
AVF18224.1\|3545413_3547843_+	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	6.9e-37	30.6

DBSCAN-SWA_253

3553011 : 3553809

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18228.1\|3553011_3553809_+	iron-hydroxamate transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	6.0e-14	27.4

DBSCAN-SWA_254

3559733 : 3560078

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18233.1\|3559733_3560078_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.5e-27	51.4

DBSCAN-SWA_255

3564013 : 3565447

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18238.1\|3564013_3565447_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-26	29.2

DBSCAN-SWA_256

3576824 : 3577583

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18248.1\|3576824_3577583_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	8.5e-26	43.0

DBSCAN-SWA_257

3586424 : 3590542

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18257.1\|3586424_3587021_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.6e-27	40.8
AVF18258.1\|3587059_3590542_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	6.5e-206	36.4

DBSCAN-SWA_258

3602507 : 3603539

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18272.1\|3602507_3603539_-	D-methionine ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-35	39.7

DBSCAN-SWA_259

3610083 : 3610887

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18274.1\|3610083_3610887_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.9e-39	36.6

DBSCAN-SWA_260

3614943 : 3619148

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18278.1\|3614943_3616308_-	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	9.9e-09	36.0
AVF18279.1\|3616376_3617135_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AVF18280.1\|3617167_3617884_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AVF18281.1\|3617884_3618352_-	ribonuclease HI	J9Q745	Salmonella_phage	4.0e-50	58.4
AVF18282.1\|3618407_3619148_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.0e-39	39.5

DBSCAN-SWA_261

3623019 : 3623598

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18285.1\|3623019_3623598_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.5e-14	31.4

DBSCAN-SWA_262

3636799 : 3640526

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18300.1\|3636799_3637852_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	5.9e-118	60.6
AVF18301.1\|3638157_3639261_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-59	39.9
AVF18302.1\|3639272_3640526_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	6.8e-97	46.1

DBSCAN-SWA_263

3645526 : 3653771

Shigella_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18304.1\|3645526_3646673_+	DDE domain-containing protein	U5P429	Shigella_phage	5.0e-147	92.6
AVF18305.1\|3647227_3648196_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	6.9e-182	96.9
AVF18306.1\|3648551_3649672_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF18307.1\|3651105_3651810_+	transcriptional regulator FeaR	NA	NA	NA	NA
AVF18308.1\|3651806_3652421_+	hypothetical protein	NA	NA	NA	NA
AVF18309.1\|3652509_3652920_+	hypothetical protein	A0A1B2IBY1	Erwinia_phage	3.1e-30	52.5
AVF18310.1\|3652996_3653233_+	DUF905 domain-containing protein	NA	NA	NA	NA
AVF18311.1\|3653312_3653771_+	antirestriction protein	A0A2D0W9W4	Bordetella_phage	1.5e-14	34.3

DBSCAN-SWA_264

3657265 : 3662522

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18318.1\|3657265_3658234_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	6.9e-182	96.9
AVF18319.1\|3659859_3660354_-	oxidoreductase	NA	NA	NA	NA
AVF18320.1\|3660737_3662522_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.1e-18	34.4

DBSCAN-SWA_265

3667418 : 3668186

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18325.1\|3667418_3668186_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	G9BWD6	Planktothrix_phage	6.1e-24	37.5

DBSCAN-SWA_266

3676682 : 3677843

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18332.1\|3676682_3677843_-	D-alanyl-D-alanine- carboxypeptidase/endopeptidase AmpH	A0A2H4JAN9	uncultured_Caudovirales_phage	3.9e-06	22.9

DBSCAN-SWA_267

3685757 : 3686861

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18342.1\|3685757_3686861_+	PleD family two-component system response regulator	A0A127AWB9	Bacillus_phage	1.4e-16	31.4

DBSCAN-SWA_268

3690468 : 3699024

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18348.1\|3690468_3691383_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	5.7e-101	62.7
AVF18349.1\|3691506_3692412_+	fructokinase	NA	NA	NA	NA
AVF18350.1\|3692496_3695628_-	exonuclease subunit SbcC	M1U9H5	Synechococcus_phage	3.0e-08	30.1
AVF18351.1\|3695624_3696830_-	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	1.1e-08	24.9
AVF18352.1\|3697017_3697707_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	9.7e-37	37.6
AVF18353.1\|3697728_3699024_+	two-component system sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.7e-26	30.3

DBSCAN-SWA_269

3710843 : 3715183

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18362.1\|3710843_3711971_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.2e-89	46.3
AVF18363.1\|3711993_3712326_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
AVF18364.1\|3712353_3714201_+	protein translocase subunit SecD	NA	NA	NA	NA
AVF18365.1\|3714211_3715183_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.5e-46	40.2

DBSCAN-SWA_270

3718765 : 3720427

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18369.1\|3718765_3719869_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	6.5e-51	33.1
AVF18370.1\|3719956_3720427_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-29	48.0

DBSCAN-SWA_271

3736714 : 3738214

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18386.1\|3736714_3738214_-	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	2.8e-20	30.0

DBSCAN-SWA_272

3752189 : 3757237

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18399.1\|3752189_3752813_+	ATP-dependent Clp endopeptidase, proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.2e-64	63.9
AVF18400.1\|3752940_3754215_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-132	56.8
AVF18401.1\|3754399_3756754_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.7
AVF18402.1\|3756964_3757237_+	DNA-binding protein HU-beta	A3E2K9	Sodalis_phage	8.5e-21	61.8

DBSCAN-SWA_273

3760393 : 3761759

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18406.1\|3760393_3760744_+	addiction module killer protein	A4JWV2	Burkholderia_virus	3.4e-14	47.6
AVF18407.1\|3760730_3761060_+	DNA-binding protein	NA	NA	NA	NA
AVF18408.1\|3761063_3761759_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	5.5e-88	68.9

DBSCAN-SWA_274

3766139 : 3769668

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18413.1\|3766139_3767894_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-47	30.0
AVF18414.1\|3767886_3769668_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-41	27.8

DBSCAN-SWA_275

3776820 : 3781084

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18424.1\|3776820_3777891_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.1e-87	52.2
AVF18425.1\|3777994_3781084_+	beta-galactosidase subunit alpha	L0N6M2	Herpes_simplex_virus	0.0e+00	66.6

DBSCAN-SWA_276

3785332 : 3792385

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18432.1\|3785332_3786793_+	transcriptional regulator PtsJ	A0A1X9I5H2	Streptococcus_phage	2.0e-15	26.8
AVF18433.1\|3786764_3787232_-	hypothetical protein	NA	NA	NA	NA
AVF18434.1\|3787348_3787900_-	maltose O-acetyltransferase	NA	NA	NA	NA
AVF18435.1\|3788108_3788327_-	hemolysin expression modulator Hha	NA	NA	NA	NA
AVF18436.1\|3788354_3788729_-	Hha toxicity attenuator	NA	NA	NA	NA
AVF18437.1\|3789238_3792385_-	aminoglycoside/multidrug transporter permease	S5VTK5	Leptospira_phage	4.4e-52	23.0

DBSCAN-SWA_277

3799154 : 3804699

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18445.1\|3799154_3799706_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	45.9
AVF18446.1\|3799794_3801723_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.0e-43	42.9
AVF18447.1\|3801776_3802109_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AVF18448.1\|3802108_3802714_+	recombination protein RecR	NA	NA	NA	NA
AVF18449.1\|3802824_3804699_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.3e-112	36.1

DBSCAN-SWA_278

3814667 : 3817166

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18458.1\|3814667_3817166_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	3.4e-108	37.3

DBSCAN-SWA_279

3820196 : 3820868

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18463.1\|3820196_3820868_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	1.6e-23	33.8

DBSCAN-SWA_280

3824000 : 3824687

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18468.1\|3824000_3824687_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-32	35.9

DBSCAN-SWA_281

3832757 : 3834143

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18476.1\|3832757_3834143_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-44	34.8

DBSCAN-SWA_282

3837928 : 3838795

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18480.1\|3837928_3838795_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	5.0e-30	34.5

DBSCAN-SWA_283

3858610 : 3859582

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18497.1\|3858610_3859582_+	DNA-binding transcriptional regulator CytR	C6ZCU4	Enterobacteria_phage	3.5e-24	31.4

DBSCAN-SWA_284

3863543 : 3863831

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18501.1\|3863543_3863831_+	XRE family transcriptional regulator	A0A088CD40	Shigella_phage	9.0e-05	38.1

DBSCAN-SWA_285

3871887 : 3874596

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18509.1\|3871887_3874596_+	zinc/cadmium/mercury/lead-transporting ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	8.4e-68	26.9

DBSCAN-SWA_286

3889312 : 3890840

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18521.1\|3889312_3890017_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-22	35.3
AVF18522.1\|3890003_3890840_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-13	32.0

DBSCAN-SWA_287

3895338 : 3903214

Catovirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18527.1\|3895338_3897003_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.5e-59	31.3
AVF18528.1\|3897016_3898489_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
AVF18529.1\|3898502_3899090_-	transcriptional regulator BetI	NA	NA	NA	NA
AVF18530.1\|3899218_3901252_+	L-carnitine/gamma-butyrobetaine antiporter	A0A2I7QNT1	Vibrio_phage	3.4e-21	27.6
AVF18531.1\|3901493_3902405_+	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF18532.1\|3902407_3903214_+	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	6.7e-13	26.5

DBSCAN-SWA_288

3909407 : 3914155

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18539.1\|3909407_3913265_+	p-hydroxybenzoic acid--AMP ligase FadD22	A0A2K9KZV5	Tupanvirus	8.3e-61	28.9
AVF18540.1\|3913354_3914155_-	iron-enterobactin transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	8.4e-08	23.6

DBSCAN-SWA_289

3926083 : 3930500

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18551.1\|3926083_3926488_-	XRE family transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	8.8e-06	33.3
AVF18552.1\|3926459_3926765_-	plasmid stabilization protein	NA	NA	NA	NA
AVF18553.1\|3926948_3927692_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
AVF18554.1\|3927749_3928838_-	oxidoreductase	NA	NA	NA	NA
AVF18555.1\|3928997_3930500_+	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-17	26.9

DBSCAN-SWA_290

3939686 : 3950372

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18565.1\|3939686_3940313_-	hypothetical protein	A0A0F7L444	uncultured_marine_virus	8.5e-56	51.8
AVF19382.1\|3940297_3941521_-	phosphoadenylyl-sulfate reductase	A0A220GKF8	Streptococcus_phage	1.1e-59	34.3
AVF18566.1\|3941686_3942592_-	transcriptional regulator LeuO	NA	NA	NA	NA
AVF18567.1\|3943219_3943783_+	peroxiredoxin	NA	NA	NA	NA
AVF18568.1\|3943970_3945536_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.4e-43	34.0
AVF18569.1\|3945805_3946309_+	molecular chaperone	NA	NA	NA	NA
AVF18570.1\|3946305_3948582_+	thiosulfate reductase PhsA	A0A077SK27	Escherichia_phage	1.8e-47	24.0
AVF18571.1\|3948578_3949136_+	tetrathionate reductase subunit TtrB	A0A077SL61	Escherichia_phage	2.4e-25	36.4
AVF18572.1\|3949135_3949903_+	hydrogenase	NA	NA	NA	NA
AVF18573.1\|3949943_3950372_-	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	4.0e-17	36.4

DBSCAN-SWA_291

3964944 : 3965787

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18586.1\|3964944_3965184_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	8.0e-23	72.9
AVF18587.1\|3965403_3965787_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.4e-24	54.6

DBSCAN-SWA_292

3970576 : 3973034

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18594.1\|3970576_3971788_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.0e-101	49.4
AVF18595.1\|3971927_3973034_-	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	8.1e-09	51.6

DBSCAN-SWA_293

3979424 : 3984545

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18603.1\|3979424_3982031_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	4.9e-182	41.9
AVF19383.1\|3982221_3982704_+	hypothetical protein	NA	NA	NA	NA
AVF18604.1\|3982758_3983700_-	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
AVF18605.1\|3983819_3984545_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.1e-30	36.8

DBSCAN-SWA_294

3990372 : 3991419

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18612.1\|3990372_3991419_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	6.4e-48	45.6

DBSCAN-SWA_295

3995345 : 3997010

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18615.1\|3995345_3997010_-	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	2.1e-85	39.0

DBSCAN-SWA_296

4001617 : 4005404

Vibrio_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18620.1\|4001617_4003567_+	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.9e-08	48.6
AVF18621.1\|4003736_4005404_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.2

DBSCAN-SWA_297

4017063 : 4017741

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18632.1\|4017063_4017741_-	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.0e-26	29.7

DBSCAN-SWA_298

4021013 : 4027378

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18635.1\|4021013_4023062_-	K(+)-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.4e-27	22.6
AVF18636.1\|4023080_4024760_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
AVF18637.1\|4024759_4024849_-	potassium-transporting ATPase subunit F	NA	NA	NA	NA
AVF18638.1\|4025160_4025367_+	DUF2517 domain-containing protein	NA	NA	NA	NA
AVF18639.1\|4025965_4027378_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	6.8e-61	33.1

DBSCAN-SWA_299

4030474 : 4031266

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18642.1\|4030474_4031266_+	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	6.8e-10	28.1

DBSCAN-SWA_300

4060088 : 4063559

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18667.1\|4060088_4060808_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	4.0e-25	36.4
AVF18668.1\|4060804_4061743_-	cation-efflux pump FieF	A0A1V0SED0	Indivirus	5.8e-24	28.4
AVF18669.1\|4061842_4062202_-	ATP-independent periplasmic protein-refolding chaperone	NA	NA	NA	NA
AVF18670.1\|4062506_4063559_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VT43	Edwardsiella_phage	5.2e-82	48.3

DBSCAN-SWA_301

4067882 : 4074411

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18675.1\|4067882_4068899_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.8e-79	45.4
AVF18676.1\|4069100_4070573_-	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	2.3e-11	29.5
AVF18677.1\|4070640_4071429_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AVF18678.1\|4071556_4071709_+	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
AVF18679.1\|4071887_4072664_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AVF18680.1\|4072660_4073353_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AVF18681.1\|4073352_4074411_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	1.8e-18	34.4

DBSCAN-SWA_302

4082679 : 4086134

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18689.1\|4082679_4084200_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	6.1e-84	39.6
AVF18690.1\|4084302_4084779_-	kinase inhibitor	NA	NA	NA	NA
AVF18691.1\|4084826_4086134_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.2e-20	30.2

DBSCAN-SWA_303

4093357 : 4094266

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18698.1\|4093357_4094266_-	hypothetical protein	A1IMD5	Streptococcus_phage	1.0e-25	29.3

DBSCAN-SWA_304

4103964 : 4111228

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18711.1\|4103964_4105704_-	heme ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-19	30.5
AVF18712.1\|4105696_4106692_-	secretion protein HlyD	NA	NA	NA	NA
AVF18713.1\|4106688_4107366_-	transcriptional regulator	NA	NA	NA	NA
AVF18714.1\|4107570_4108953_+	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.8e-51	32.9
AVF18715.1\|4109050_4111228_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.2e-43	26.1

DBSCAN-SWA_305

4118467 : 4119121

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18723.1\|4118467_4118734_-	DksA/TraR family C4-type zinc finger protein	E5E4B1	Acinetobacter_phage	4.9e-13	50.6
AVF18724.1\|4118857_4119121_-	DUF1471 domain-containing protein	A0A142IIN6	Enterobacteria_phage	1.3e-05	43.8

DBSCAN-SWA_306

4122649 : 4127789

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18728.1\|4122649_4123372_-	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-34	42.7
AVF18729.1\|4123368_4124028_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
AVF18730.1\|4124121_4124865_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
AVF18731.1\|4124917_4125046_+	reductase	NA	NA	NA	NA
AVF18732.1\|4125226_4125730_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	9.3e-05	24.4
AVF18733.1\|4126028_4126916_-	threonine/homoserine exporter RhtA	NA	NA	NA	NA
AVF18734.1\|4127270_4127789_+	outer membrane protein X	K7PJP9	Enterobacteria_phage	3.2e-16	31.4

DBSCAN-SWA_307

4137241 : 4138618

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18743.1\|4137241_4138618_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.6e-22	23.5

DBSCAN-SWA_308

4141907 : 4143503

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18747.1\|4141907_4143503_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	9.4e-59	28.4

DBSCAN-SWA_309

4151014 : 4155141

Citrobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18753.1\|4151014_4153447_-	formate C-acetyltransferase	A0A076YHZ7	Citrobacter_phage	1.0e-08	49.1
AVF18754.1\|4153451_4154351_-	[formate-C-acetyltransferase]-activating enzyme	NA	NA	NA	NA
AVF18755.1\|4154478_4155141_+	fructose-6-phosphate aldolase	A0A0E3HJ81	Synechococcus_phage	1.3e-25	32.7

DBSCAN-SWA_310

4158472 : 4160344

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18759.1\|4158472_4160344_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	5.9e-12	28.6

DBSCAN-SWA_311

4167829 : 4169880

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18767.1\|4167829_4169035_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-98	47.2
AVF18768.1\|4169121_4169880_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	8.2e-13	26.5

DBSCAN-SWA_312

4175844 : 4191973

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18775.1\|4175844_4176276_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.0e-48	66.4
AVF18776.1\|4176288_4177578_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	4.0e-169	71.2
AVF18777.1\|4177618_4177939_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-22	53.7
AVF18778.1\|4178193_4179879_-	transporter	NA	NA	NA	NA
AVF18779.1\|4180153_4180528_+	hypothetical protein	NA	NA	NA	NA
AVF18780.1\|4180558_4180828_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	7.9e-27	71.8
AVF18781.1\|4181013_4181736_+	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AVF18782.1\|4181800_4182703_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	4.8e-36	33.6
AVF18783.1\|4182766_4183243_+	YbjN domain-containing protein	NA	NA	NA	NA
AVF18784.1\|4183239_4183428_-	hypothetical protein	NA	NA	NA	NA
AVF18785.1\|4183593_4184706_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AVF18786.1\|4184849_4185983_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.5e-30	34.4
AVF18787.1\|4185992_4186946_+	putrescine ABC transporter permease	NA	NA	NA	NA
AVF18788.1\|4186942_4187788_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AVF18789.1\|4187830_4188328_+	DUF2593 domain-containing protein	NA	NA	NA	NA
AVF18790.1\|4188368_4189499_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	7.2e-29	28.2
AVF18791.1\|4189812_4190520_+	two-component system response regulator CreB	W8CYM9	Bacillus_phage	7.1e-35	36.3
AVF18792.1\|4190503_4191973_+	two-component system sensor histidine kinase CreC	W8CYF6	Bacillus_phage	1.8e-24	30.1

DBSCAN-SWA_313

4195100 : 4195829

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18797.1\|4195100_4195829_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.8e-28	36.2

DBSCAN-SWA_314

4212228 : 4214931

Orgyia_leucostigma_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18816.1\|4212228_4214931_+	PKD domain-containing protein	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	4.9e-193	60.9

DBSCAN-SWA_315

4232657 : 4247786

Vibrio_phage(42.86%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18829.1\|4232657_4234598_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	3.8e-38	40.5
AVF18830.1\|4234668_4234890_-	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
AVF18831.1\|4235157_4235478_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.9
AVF18832.1\|4235505_4237785_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.0
AVF18833.1\|4238254_4238695_+	hypothetical protein	NA	NA	NA	NA
AVF18834.1\|4239943_4240927_+	type I-F CRISPR-associated endonuclease Cas1	A0A2D0YFC9	Vibrio_phage	3.1e-44	34.8
AVF18835.1\|4240923_4244142_+	type I-F CRISPR-associated helicase Cas3	A0A2I7RCU8	Vibrio_phage	2.4e-77	27.1
AVF18836.1\|4244340_4244532_+	cystathionine beta-lyase	NA	NA	NA	NA
AVF18837.1\|4244531_4245842_+	type I-F CRISPR-associated protein Csy1	NA	NA	NA	NA
AVF18838.1\|4245838_4246774_+	type I-F CRISPR-associated protein Csy2	NA	NA	NA	NA
AVF18839.1\|4246787_4247786_+	type I-F CRISPR-associated protein Csy3	A0A2D0YRR8	Vibrio_phage	6.5e-50	41.5

DBSCAN-SWA_316

4252490 : 4274864

Organic_Lake_phycodnavirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18845.1\|4252490_4254212_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	F2Y2R6	Organic_Lake_phycodnavirus	2.7e-19	27.8
AVF18846.1\|4254211_4255978_-	thiol reductant ABC exporter subunit CydD	F2Y302	Organic_Lake_phycodnavirus	2.1e-11	27.4
AVF18847.1\|4256092_4257061_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-61	42.7
AVF18848.1\|4257604_4258099_+	leucine-responsive regulatory protein	NA	NA	NA	NA
AVF18849.1\|4258234_4261903_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	2.6e-88	49.2
AVF18850.1\|4262030_4262645_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AVF18851.1\|4262654_4263998_+	Holliday junction branch migration DNA helicase RuvB	G3MBE0	Bacillus_virus	5.6e-81	40.6
AVF18852.1\|4264090_4265383_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.7e-93	45.2
AVF18853.1\|4265595_4268040_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	6.8e-218	49.4
AVF18854.1\|4268050_4268668_+	dimethylsulfoxide reductase, chain B	A0A077SL61	Escherichia_phage	4.0e-74	58.6
AVF18855.1\|4268669_4269533_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
AVF18856.1\|4269584_4269767_-	hypothetical protein	NA	NA	NA	NA
AVF18857.1\|4269807_4270956_+	MFS transporter	NA	NA	NA	NA
AVF18858.1\|4271079_4271601_+	hypothetical protein	NA	NA	NA	NA
AVF18859.1\|4271637_4272378_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.4e-20	26.1
AVF18860.1\|4272581_4274864_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-161	41.9

DBSCAN-SWA_317

4278921 : 4280010

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18864.1\|4278921_4280010_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	9.2e-82	46.5

DBSCAN-SWA_318

4284186 : 4288736

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18868.1\|4284186_4284474_+	integration host factor subunit beta	A7KV42	Bacillus_phage	5.5e-10	40.2
AVF18869.1\|4284686_4286951_+	ComEC family protein	NA	NA	NA	NA
AVF18870.1\|4286987_4288736_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.7e-58	30.5

DBSCAN-SWA_319

4305932 : 4314106

Enterobacteria_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18886.1\|4305932_4306991_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	4.4e-97	52.3
AVF18887.1\|4307399_4307585_-	hypothetical protein	NA	NA	NA	NA
AVF18888.1\|4307596_4308997_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.9e-79	37.3
AVF18889.1\|4309165_4310368_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.8e-45	31.9
AVF18890.1\|4310622_4313235_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.0e-18	21.8
AVF18891.1\|4313335_4314106_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.4e-30	39.0

DBSCAN-SWA_320

4319541 : 4324778

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18898.1\|4319541_4320651_-	NADH oxidoreductase	A0A0E3FP00	Synechococcus_phage	5.4e-05	35.1
AVF19392.1\|4320749_4322858_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
AVF18899.1\|4322870_4324778_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	3.3e-50	28.5

DBSCAN-SWA_321

4337267 : 4339322

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18911.1\|4337267_4339322_+	DNA helicase IV	A7KV33	Bacillus_phage	6.7e-17	27.5

DBSCAN-SWA_322

4343553 : 4348194

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18919.1\|4343553_4344213_-	transmembrane protein	A0A2H4JFM9	uncultured_Caudovirales_phage	2.0e-47	53.9
AVF18920.1\|4344211_4344397_+	hypothetical protein	NA	NA	NA	NA
AVF18921.1\|4344483_4346112_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
AVF18922.1\|4346404_4347166_-	heme ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-11	29.8
AVF18923.1\|4347162_4348194_-	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	1.3e-13	23.5

DBSCAN-SWA_323

4353824 : 4354574

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18929.1\|4353824_4354574_-	short-chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.8e-21	32.4

DBSCAN-SWA_324

4357867 : 4361826

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18934.1\|4357867_4358038_+	stress-induced protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6
AVF18935.1\|4358154_4359060_+	drug/metabolite exporter YedA	NA	NA	NA	NA
AVF19394.1\|4359134_4359404_+	DUF1778 domain-containing protein	NA	NA	NA	NA
AVF18936.1\|4359410_4359932_+	N-acetyltransferase	NA	NA	NA	NA
AVF18937.1\|4359990_4361313_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	2.8e-210	88.4
AVF18938.1\|4361334_4361826_-	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	1.2e-41	83.3

DBSCAN-SWA_325

4378212 : 4379277

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18953.1\|4378212_4379277_+	phosphate starvation-inducible protein PhoH	A0A1B2ICF6	Erwinia_phage	3.6e-91	69.9

DBSCAN-SWA_326

4386230 : 4387064

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18961.1\|4386230_4387064_-	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	2.3e-40	39.9

DBSCAN-SWA_327

4391215 : 4391752

Red_sea_bream_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18969.1\|4391215_4391752_+	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	4.1e-27	43.1

DBSCAN-SWA_328

4399391 : 4400318

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18977.1\|4399391_4400318_-	lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase	A0A1W6JP29	Morganella_phage	5.3e-54	41.5

DBSCAN-SWA_329

4404923 : 4405169

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF18983.1\|4404923_4405169_-	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	4.5e-13	50.0

DBSCAN-SWA_330

4420269 : 4421223

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19001.1\|4420269_4421223_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A160LKR7	Bacillus_phage	2.8e-10	38.0

DBSCAN-SWA_331

4435476 : 4436602

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19014.1\|4435476_4436211_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	6.5e-15	33.3
AVF19015.1\|4436365_4436602_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	3.4e-10	45.2

DBSCAN-SWA_332

4439880 : 4441523

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19019.1\|4439880_4440522_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.4e-29	39.1
AVF19020.1\|4440518_4441523_+	DNA polymerase III subunit delta'	A0A2H4IBD4	Erwinia_phage	2.0e-06	28.4

DBSCAN-SWA_333

4453767 : 4454025

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19032.1\|4453767_4454025_+	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	5.6e-06	37.1

DBSCAN-SWA_334

4458804 : 4468887

Gordonia_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19035.1\|4458804_4459878_-	glucans biosynthesis protein MdoC	A0A142KBN9	Gordonia_phage	1.9e-07	25.9
AVF19036.1\|4460134_4461334_+	lipoprotein-releasing system transmembrane subunit LolC	NA	NA	NA	NA
AVF19037.1\|4461326_4462028_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.4e-37	42.3
AVF19038.1\|4462027_4463272_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
AVF19039.1\|4463326_4464238_+	N-acetylglucosamine kinase	NA	NA	NA	NA
AVF19040.1\|4464252_4465074_+	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	9.5e-23	34.6
AVF19041.1\|4465108_4466143_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
AVF19042.1\|4466139_4466931_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
AVF19043.1\|4466927_4467785_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	2.7e-12	24.8
AVF19044.1\|4467768_4468887_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	8.4e-30	34.1

DBSCAN-SWA_335

4475281 : 4476652

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19051.1\|4475281_4476652_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.1e-108	45.8

DBSCAN-SWA_336

4479734 : 4484948

Phage_21(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19056.1\|4479734_4480985_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.9e-21	94.4
AVF19057.1\|4481060_4481306_+	DUF2543 domain-containing protein	NA	NA	NA	NA
AVF19058.1\|4481310_4482810_-	oxygen-sensing cyclic-di-GMP phosphodiesterase	NA	NA	NA	NA
AVF19059.1\|4482934_4483027_-	stress response membrane protein YncL	NA	NA	NA	NA
AVF19060.1\|4483398_4483647_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AVF19398.1\|4483700_4483775_-	hypothetical protein	NA	NA	NA	NA
AVF19061.1\|4483775_4483874_-	hypothetical protein	NA	NA	NA	NA
AVF19062.1\|4483919_4484948_-	cyclic di-GMP phosphodiesterase	G3MA91	Bacillus_virus	7.2e-12	31.6

DBSCAN-SWA_337

4494895 : 4505157

Shigella_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19074.1\|4494895_4496015_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AVF19075.1\|4497803_4500185_+	SGNH/GDSL hydrolase family protein	G0XNW5	Escherichia_phage	1.4e-90	32.4
AVF19076.1\|4500224_4501670_-	hypothetical protein	NA	NA	NA	NA
AVF19077.1\|4501666_4502584_-	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	U5P087	Shigella_phage	7.8e-159	91.4
AVF19078.1\|4502580_4502943_-	GtrA family protein	U5P0S6	Shigella_phage	5.8e-49	83.3
AVF19079.1\|4503055_4503295_+	hypothetical protein	K7P7E2	Enterobacteria_phage	2.9e-25	67.9
AVF19080.1\|4503294_4503615_+	hypothetical protein	K7PGV5	Enterobacterial_phage	1.4e-25	53.8
AVF19081.1\|4503873_4505157_-	hypothetical protein	A0A140HLI1	Bacillus_phage	1.1e-09	28.3

DBSCAN-SWA_338

4511502 : 4513618

Buzura_suppressaria_nuclear_polyhedrosis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19087.1\|4511502_4512756_-	chitinase	W5VKF1	Buzura_suppressaria_nuclear_polyhedrosis_virus	5.3e-25	29.3
AVF19088.1\|4512976_4513618_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	2.7e-17	34.6

DBSCAN-SWA_339

4518446 : 4520369

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19092.1\|4518446_4520369_+	DNA topoisomerase I	A0A1X9I6W8	Streptococcus_phage	6.9e-40	29.5

DBSCAN-SWA_340

4525333 : 4525954

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19098.1\|4525333_4525954_-	thiamine ABC transporter ATP-binding protein ThiQ	W8CYL7	Bacillus_phage	1.0e-08	29.0

DBSCAN-SWA_341

4530561 : 4531782

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19103.1\|4530561_4531782_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	1.5e-24	27.3

DBSCAN-SWA_342

4539111 : 4539939

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19111.1\|4539111_4539939_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.1e-71	54.2

DBSCAN-SWA_343

4546149 : 4551857

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19119.1\|4546149_4548399_-	catalase HPII	A0A2K9L572	Tupanvirus	4.9e-138	48.0
AVF19120.1\|4548587_4548842_+	cell division activator CedA	NA	NA	NA	NA
AVF19121.1\|4548890_4550282_-	L-cystine transporter	NA	NA	NA	NA
AVF19122.1\|4550409_4551000_-	metal-dependent hydrolase	NA	NA	NA	NA
AVF19123.1\|4551095_4551857_-	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-18	32.7

DBSCAN-SWA_344

4557981 : 4571400

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19132.1\|4557981_4559910_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.9e-128	37.1
AVF19133.1\|4559913_4560456_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	32.9
AVF19134.1\|4560553_4560751_+	50S ribosomal protein L35	NA	NA	NA	NA
AVF19135.1\|4560801_4561158_+	50S ribosomal protein L20	NA	NA	NA	NA
AVF19136.1\|4561462_4562446_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.9e-35	43.2
AVF19137.1\|4562461_4564849_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AVF19138.1\|4564853_4565153_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
AVF19139.1\|4565256_4566237_+	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
AVF19140.1\|4566270_4566822_+	glutathione peroxidase	NA	NA	NA	NA
AVF19141.1\|4566821_4567577_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2K9L407	Tupanvirus	5.0e-10	25.7
AVF19142.1\|4567649_4568114_+	endopeptidase	A0A1V0DZX6	Clostridioides_phage	2.3e-13	36.7
AVF19143.1\|4568406_4569120_+	EAL domain-containing protein	NA	NA	NA	NA
AVF19144.1\|4569181_4570624_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	5.1e-56	34.7
AVF19145.1\|4570620_4571400_-	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	7.6e-14	29.5

DBSCAN-SWA_345

4576720 : 4581465

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19150.1\|4576720_4577767_-	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	2.7e-83	47.4
AVF19151.1\|4577917_4578751_-	kinase/pyrophosphorylase	NA	NA	NA	NA
AVF19152.1\|4579086_4581465_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.1e-171	36.6

DBSCAN-SWA_346

4603646 : 4610884

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19171.1\|4603646_4604375_+	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	5.6e-51	51.8
AVF19172.1\|4604484_4604943_-	DUF3828 domain-containing protein	NA	NA	NA	NA
AVF19173.1\|4604942_4605305_-	CHAP domain-containing protein	NA	NA	NA	NA
AVF19174.1\|4605587_4605809_-	hypothetical protein	NA	NA	NA	NA
AVF19175.1\|4605797_4606166_+	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	2.9e-16	42.2
AVF19176.1\|4606174_4607665_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AVF19177.1\|4607674_4608421_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	2.9e-10	31.4
AVF19178.1\|4608395_4609667_+	signal peptide peptidase SppA	NA	NA	NA	NA
AVF19179.1\|4609663_4610884_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	4.4e-93	41.9

DBSCAN-SWA_347

4615992 : 4618785

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19185.1\|4615992_4617363_-	CBS domain-containing protein	A0A1W6JHY1	Lactococcus_phage	3.7e-48	37.4
AVF19186.1\|4617762_4618785_+	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	1.6e-27	34.7

DBSCAN-SWA_348

4621996 : 4622812

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19192.1\|4621996_4622812_-	L-cystine ABC transporter ATP-binding protein YecC	G9BWD6	Planktothrix_phage	6.3e-35	41.0

DBSCAN-SWA_349

4630007 : 4641168

Cyanophage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19200.1\|4630007_4630478_+	heat-shock protein	A0A1D7SNF0	Cyanophage	4.5e-09	31.8
AVF19201.1\|4630967_4632341_-	multidrug transporter MdtK	NA	NA	NA	NA
AVF19202.1\|4632566_4633208_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.0e-24	37.8
AVF19203.1\|4633238_4634387_-	cyclopropane-fatty-acyl-phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.8e-83	44.6
AVF19204.1\|4634685_4635885_-	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
AVF19205.1\|4635998_4636910_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVF19206.1\|4636927_4637953_-	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.3e-32	32.2
AVF19207.1\|4638250_4638340_+	YnhF family membrane protein	NA	NA	NA	NA
AVF19208.1\|4638501_4639668_+	MFS transporter AraJ	NA	NA	NA	NA
AVF19209.1\|4639705_4640287_-	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	8.1e-45	45.3
AVF19210.1\|4640409_4641168_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	A0A217EQL1	Bacillus_phage	9.4e-17	38.7

DBSCAN-SWA_350

4648026 : 4648545

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19219.1\|4648026_4648545_+	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	6.3e-49	57.2

DBSCAN-SWA_351

4652319 : 4653684

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19221.1\|4652319_4653684_-	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	6.9e-18	35.4

DBSCAN-SWA_352

4656980 : 4658255

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVF19226.1\|4656980_4658255_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.5e-86	43.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026851

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP026852

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP026850

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection