CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP019980	Lysinibacillus sphaericus strain DSM 28 chromosome, complete genome	3 crisprs	csa3,cas3,WYL,casR,DinG,DEDDh	1	3	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP019980_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019980_2

2465444-2465589

Orphan

Consensus_repeat	Method
TGTCTGGACTTTCTTGTCC	CRT

3 spacers

The CRISPR arrays of CP019980_2

>merge|CP019980|2|2465444-2465589|CRT
TGTCCGGACATTCTTGTCCTTTTTATTTTTTAAAAAAATGTACTGTCTGGACTTTCTTGTCCTTTTTAGCTTTTGAAATTGTGAGTTTGTCTGTATTTTCTTGTCCAAAAAGTAGGGAATTATCTTACGTCTGGACTTTCTTGTCC

>CP019980|2|1|2465444-2465589|CRT
TGTCCGGACATTCTTGTCC	TTTTTATTTTTTAAAAAAATGTAC
TGTCTGGACTTTCTTGTCC	TTTTTAGCTTTTGAAATTGTGAGTT
TGTCTGTATTTTCTTGTCC	AAAAAGTAGGGAATTATCTTA
CGTCTGGACTTTCTTGTCC

Protein	Signature genes	Signature genes Name	Protein_function
CP019980.1\|AVK97012.1\|2457938_2459414_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|377020
CP019980.1\|AVK97010.1\|2455737_2456817_-\|spore-gernimation-protein	unknown	unknown	gnl\|CDD\|274338
CP019980.1\|AVK97019.1\|2469944_2471489_+\|cation-acetate-symporter	unknown	unknown	gnl\|CDD\|236495
CP019980.1\|AVK99068.1\|2460717_2461833_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
CP019980.1\|AVK99070.1\|2471798_2472548_-\|DNAase	unknown	unknown	gnl\|CDD\|238635
CP019980.1\|AVK97020.1\|2471586_2471775_+\|hypothetical-protein	unknown	unknown	unknown
CP019980.1\|AVK97014.1\|2461837_2462671_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
CP019980.1\|AVK97023.1\|2474031_2474325_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376658
CP019980.1\|AVK97016.1\|2467260_2467596_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377315
CP019980.1\|AVK97011.1\|2456791_2457937_-\|spore-gernimation-protein	unknown	unknown	gnl\|CDD\|281794
CP019980.1\|AVK97009.1\|2455132_2455492_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP019980.1\|AVK97017.1\|2467596_2469150_+\|cation-acetate-symporter	unknown	unknown	gnl\|CDD\|271374
CP019980.1\|AVK97021.1\|2472537_2473287_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
CP019980.1\|AVK99069.1\|2462801_2465060_+\|bifunctional-glutamate--cysteine-ligase/glutathione-synthetase	unknown	unknown	gnl\|CDD\|179427
CP019980.1\|AVK97007.1\|2452546_2453869_+\|hypothetical-protein	unknown	unknown	unknown
CP019980.1\|AVK97018.1\|2469609_2469948_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377315
CP019980.1\|AVK97013.1\|2460227_2460590_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP019980.1\|AVK97022.1\|2473261_2474035_-\|nitrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP019980.1\|AVK97015.1\|2466080_2466701_-\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|239266
CP019980.1\|AVK97008.1\|2454004_2455000_-\|DGQHR-domain-containing-protein	unknown	unknown	gnl\|CDD\|319270

Protein	Function_ID	Function_description	E-value
CP019980.1\|AVK97012.1\|2457938_2459414_-\|spore-germination-protein	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
CP019980.1\|AVK97010.1\|2455737_2456817_-\|spore-gernimation-protein	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	7.91549e-50
CP019980.1\|AVK97019.1\|2469944_2471489_+\|cation-acetate-symporter	gnl\|CDD\|236495	PRK09395, actP, cation/acetate symporter ActP.	0
CP019980.1\|AVK99068.1\|2460717_2461833_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
CP019980.1\|AVK99070.1\|2471798_2472548_-\|DNAase	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	1.32865e-57
CP019980.1\|AVK97022.1\|2473261_2474035_-\|nitrate-ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	2.35747e-59
CP019980.1\|AVK97014.1\|2461837_2462671_+\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	1.98041e-114
CP019980.1\|AVK97023.1\|2474031_2474325_-\|hypothetical-protein	gnl\|CDD\|376658	pfam01910, Thiamine_BP, Thiamine-binding protein. The crystal structure of two of these members shows that this domain has a ferredoxin like fold and is likely to exists as at least homodimers. Sulphate ions are are located at the dimer interfaces, which are thought to confer additional stability. Although the function of this domain remains to be identified, its structure suggests a role in protein-protein interactions possibly regulated by the binding of small-molecule ligands. Solution of the structure of the hyperthermophilic anaerobic Thermotoga maritima sequence, UniProtKB:Q9WYV6, shows that this has a beta-alpha-beta-beta-alpha-beta ferredoxin-like fold and assembles as a homotetramer. It was possible to identify a pocket in each monmer that bound an unidentified ligand. It was also found that it bound charged thiamine though not hydroxymethyl pyrimidine. It is proposed that it is transporting charged thiamine around the cytoplasm. Under oxidative conditions this bacterium is under stress, and the transcriiptional unit within which this protein is expressed is up-regulated in these conditions, suggesting that the chelation of cytoplasmic thaimine is part of the response mechanism to such oxidatvie stress, which is mediated by this family.	1.41591e-21
CP019980.1\|AVK97016.1\|2467260_2467596_+\|hypothetical-protein	gnl\|CDD\|377315	pfam04341, DUF485, Protein of unknown function, DUF485. This family includes several putative integral membrane proteins.	2.98495e-14
CP019980.1\|AVK97011.1\|2456791_2457937_-\|spore-gernimation-protein	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	1.0471e-15
CP019980.1\|AVK97009.1\|2455132_2455492_+\|transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.20614e-11
CP019980.1\|AVK97017.1\|2467596_2469150_+\|cation-acetate-symporter	gnl\|CDD\|271374	cd11480, SLC5sbd_u4, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	1.50021e-171
CP019980.1\|AVK97021.1\|2472537_2473287_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	7.60232e-118
CP019980.1\|AVK99069.1\|2462801_2465060_+\|bifunctional-glutamate--cysteine-ligase/glutathione-synthetase	gnl\|CDD\|179427	PRK02471, PRK02471, bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB.	0
CP019980.1\|AVK97018.1\|2469609_2469948_+\|hypothetical-protein	gnl\|CDD\|377315	pfam04341, DUF485, Protein of unknown function, DUF485. This family includes several putative integral membrane proteins.	2.33926e-20
CP019980.1\|AVK97013.1\|2460227_2460590_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.07873e-31
CP019980.1\|AVK97015.1\|2466080_2466701_-\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	2.23959e-45
CP019980.1\|AVK97008.1\|2454004_2455000_-\|DGQHR-domain-containing-protein	gnl\|CDD\|319270	cd16413, DGQHR_domain, DGQHR motif containing domain. Uncharacterized diverse domain family with conserved DGQHR motif, in addition to QR and FXXXN motifs. Some proteins have been identified as parts of DNA phosphorothioation systems. Related to dndB, which acts in the regulation of DNA modifications, including DNA phosphorothioation. These proteins show similarity to the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system, and other members of the ParB/Srx superfamily.	1.80675e-40

>CP019980.1|AVK99069.1|2462801_2465060_+|bifunctional-glutamate--cysteine-ligase/glutathione-synthetase
MDYKKMLVNDHVKPYLLKARYGIEKESKRVDLSGNLAKTDHPKSISQQDDHPYIQRDFSELQMELITPVTDTLNELFDYLAAIHDVAYRSMGENEMLWPLSMPPQLPEKDEDIVMAKLKSAENVRYRQSLSNSYGRRKQMLCGVHFNFEFGDELIQALFNAQSEIKEYQHFKTEIYLKATRNYLHYRWLVTYFYGASPRSEKNFFEENLLNEVVRSIRSSKYGYTNSKDVQVSYSSIQNYVSDLSSMVKRGLLSAEREFYSPVRLRGGHHVSELEDNGIRYIELRNIDLNPFETYGISYEQAEFLHLFLIYLLWKDEGENSDEWVKIGECYNDIVALEHPLEHTQFEKEAKKMIDEMKHLATILNLTISDTLFVHLKEMLMDPSKTLAGRLFEESEKCSQRQLATSIAKENYKKSWDKPYQLAGFTDMELSTQILMFDAIQQGIQVEILDRQDQFLKLKLKEHVEYVKNGNMTSKDNYVSTLIMENKTVTKKILQQHGFRVPKGKEFQTIEQALRSYDLFSSKPFVVKPKTTNYGLGISIFKEGSNYEDYQKAIILAFKEDSSILVEEFLKGTEYRFFVLDDRVKAVLLRVPANVKGDGKHTIEELVMQKNRNPLRGRDHRTPLEIIQLGELENLMLKAQGYQVNSIPKMDEIIFLRENSNISTGGDSINVTDLIPDDYKKIAVDAVASLGAKICGIDLIIENGNKNAYGIIEANFNPSMYMHIYPYKGETRRLTMHIIHYLFPELLHSQSN
>CP019980.1|AVK97014.1|2461837_2462671_+|S-formylglutathione-hydrolase
MSLKLIEKHRSFGGEQYKYRHYSQSLKCDMTFSIYLPANKEEKKIPLIWWLSGLTCTDDNFSQKSGFQRLAEKYQVAVIIPDTSPRGGNVANNEGWDLGQGAGFYLNATQDPWAKHYNMYTYIVDELTAIATSLIPHYSGEQSIMGHSMGGHGALVIGMKNATIFKAISAFSPISNPSEVQWGINAFSTYLGEDKASWKEWDASELVKEAGMPPILITQGTQDEFYPKQLDETNFLKNARENNHLVHYKKAEGYDHSYFFIATFLEEHFAFHMEYLR
>CP019980.1|AVK99068.1|2460717_2461833_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFKPGEPLEIVEIDVEEPKAKEVLVKILYTSVCHTDAFTLSGDDPEGVFPAVLGHEGAGIVIAVGDEVTLVKPGDHVIPLYTAECGECKFCRSGKTNLCSAVRETQGKGLMPDGTTRFSYNGEPIYHYMGTSTFSEYTVVPEISLAKINKEAPLDKVGLFGCGVTTGIGAVHNTAKVQEGAVTAVFGLGAIGLAAIQGLVQAKASRIIAIDLKEDKYELAKKMGATDFLNPSKFDKPIQEVIVEMTDGGVDYSFECIGNVEVMRSALECCHKGWGESTIIGVAGAGKEIHTRPFQLVTGRVWRGSAFGGVKGRTQLPGMVDDYMNGEIDIDSFITHHLNFTDINEAFDLLHKGESIRTMLTYGE
>CP019980.1|AVK97013.1|2460227_2460590_-|transcriptional-regulator
MEIHYKEKTFFTGKDLALSVIGGRWKIAIIWCLLQQSPLRLSEIQRYLPDVNQRMLIRQLRELEEDQIIVRDVYPVVPPRVEYQLSEIGLRLEPVVNSICDWGDNFREFLKENADKTSVE
>CP019980.1|AVK97012.1|2457938_2459414_-|spore-germination-protein
MFRKIQSNENKPVSQSNVELKISIESLKKALVQMDDAEFVELNISENQHVVLIYIRTLIDQERLNESIVKPLSNRSKQSIQEYYVHSTINSISTLNEAKKQLFQGSVVLFDSSSNLWFAIPLKNPLGRAIEPSDTETILLGAKDSFSEQLEQNITLIRKRLPTHELKTEKFTVGSLSETNVVLLYIEGLTNPEFVSIAKKKILEINYDLFFESSQVAAFIEENPDSIFPQFQQTDRPDVVAYSLGIGKITILVDNTPFALVAPITMFHLFQSPEDYINRWVVASFLRIIRYVSFILSITLIPFYVALTTHHYQMIPLQTLFVLVESRSKLPFTPFWEAFIMLIFIEIIKEASLRMPTKTGQTLGVIGGIVIGQAAVEAGLASKVLIVMVGISTIASFLVPNYLVTKANSLIQFILLVCSSFLGIIGIVLAMIIILAHLNGLSSLRQPYLSPVAPFYGKDWLDLFIRGPLVKMKERPEHLKPLKKKRYQARR
>CP019980.1|AVK97011.1|2456791_2457937_-|spore-gernimation-protein
MMEALQLFNKNETYNGFYIMLMVNRLQLLYFFLIMPRYLIHPYMIWVIILVGLLSQLNILLLSRWFLTRFSSDGYNGFVQLFGKKLVRFLSLVGLFFILLKLFVIMLGFTEIVQIFMFPATDSNWLIFFILLTCLYVAWKGVGKTIRFVIISFFCTFWMFLFFVFFFFPPIAHLSDLYPIIPMELTRDSWKGILLILSSFSGPEFLVFLGPWFKANNRTFRYLSYGNALTVIEYVTFYMASLFYFGSNYLSKTPFPIVTMARYFQNPVIERIDMVMLALELFNIVFAGSIFLLLFYGASKVVNEKVYKPSSRIGFIFSVFIIFIGMLLVNEWIWKSDEKQVVLLNLQIIAGSLSYFAVPIIIIVAMKIKGVHKHDTTKEDG
>CP019980.1|AVK97010.1|2455737_2456817_-|spore-gernimation-protein
MILRKKMAKKFSILFIAVWLTGCAPFTENNIIEELAPVTFLSLRKGDEGKIKISTILPPLSKEKKSVMTREVSLIKEGLMVFNSNFYQEMKSGQMRMLIINEDIGKEGIMSIINVLLNDPDISLRIYLVVVKGNFEGYLENQLDKQDNLDYSFYRMLKHYEEKNQGEISVVNLHEFKNLLYTPYSDPFLPVFKIENDAISYEGTALFQNDKLVEIITTFDDRIFQLLKDDYYLSVLPIPDLEVVLGHVRSNTKVEINNSLSTMTYTVNLDSRIEEYRGEKQIFEPKELEDLKKEIQFKLEKQTQELIKKMQELKVDPLQLGIHTLKPFSKPMDEKEWIEIFKKMDIKIDYQLNIVPLTD
>CP019980.1|AVK97009.1|2455132_2455492_+|transcriptional-regulator
MDSLIKLVGSNIKEIRKLKKLTQEELAEKCGLQTSYLAGVERGDRNITIQTLEKITEGLEEAPSSIFKFDTLNFDNKYFEKKELVLILQNLIEDRNESEIRLILNIANEVFNTYEKKEK
>CP019980.1|AVK97008.1|2454004_2455000_-|DGQHR-domain-containing-protein
MSNHLPSNIAIENVLQSKMRGRVTYQGFVSSQIAVNFSYSKLYNDPSGKGYQRPIDKKRSKDFANYLSQGEDALYTPILLNASGNWEFHAYDGHRRNFGRLICTKKATLMDGQHRLGGISEYINETDSTLNVPFLAFHYLDEDEEIKLFDVINSKAKGIGTSLSRYLNRDNDDLSWVATNLILKPESPFFSKGTLIGRRTKEKNVTLQNLYNIMNLLTKKSALASLSKERKLNMALFYFNLIKDLFPEQWDDNQLYRMTHITCLNALAIVGNKIINDNYSMKSQQPDSIELTKLLRNLKDIDWLSSGNLKYIKGAAGSKMLADDILNCLKG
>CP019980.1|AVK97007.1|2452546_2453869_+|hypothetical-protein
MIYKKLKPILGLTYAYAIRENITICPCCIKFGFHSIFHQITLFKTCIFHTNETLVDSCEKCGKVLGKYLLSNFSNPPFTCACGFCFLDNNNVISIFRSWKNKFRIENEELLNLLSIYKSQKETPLLIQPIRILRKNNEFVQSNLSLLIDYQKNYYLNKELNENTILKEVYSQNFFSSKSALKNIMTNYEYNFNYRYNIRSFLQKDKIDAVFYEIYMQSRDIYKAIKRYLMKYYLNDHKTCIQLNNELKANDSFCGFALAFTFWREEFEEINLSKKIKQGPVETKIFNYECYLERFSLYPKGIYSNYLEDLLNNSFKITHDFNLIDINQIKKIINTMLPYLLLERFAEYLDLILNPTKYKSNNYYLHDIIPMHLIIIEQHIQDTTIYHQNIFNKLEKLIQDMQKEKNICGFDKNIKYERYRTPSELAILKMDLNRGENITN
>CP019980.1|AVK97015.1|2466080_2466701_-|cytochrome-c-oxidase-assembly-protein
MISWREVYTLLRRKWIVLVGLLVISSLLTACGSYKFEPEMSIDVQDFSFTNQNNEQVNLDSFKGKPWLAMFIFTNCNSICPPMTYNMTDVQKSLEDEGVKDYQIVAFSVDPEVDTPEVLKNYLKTYSVVDDSKWQLLTGYKQVYIEQFARKSFNSLVKNDPNSDQVVHMSSFYLVNADGVVVKDYDGTTDVPVETIVADMKALSKN
>CP019980.1|AVK97016.1|2467260_2467596_+|hypothetical-protein
MANITENKNVQSVDYNAIEAMESFNNFVKKKNTFLFSITAGFLILYILLPILAFQPVLQQKVIGSITGVWIYSAGLFIMTIVLCTVYVKKASSFDKAAAAVLAEYQAKGGK
>CP019980.1|AVK97017.1|2467596_2469150_+|cation-acetate-symporter
MNLVSVGFFLGIVGLTLIVTYIAAKRTSSASDFYTAGGGLKGWQNGFAIAGDYLSAAAFLGVSGAIALTGFDGFFFSVGYVVANLVLLYVIAEPMRNLGRYTLADMLTARFNEKRIRGVAATGTIIIVILYMIAQLVGAGALIKLLFGIEYWVAVLIVGVMMTTYVLFGGMTATSWVQIIKAGLLLFGTGLLATLVLMKFDFSLVKMFDTISTDHGDKFLVPGMKYSSSIDSVSMMMALVLGTSGLPHILMRFFTVKDAKTARASISWTTWITAIFFSLTIFLGFGAMHFVGLDKIIAESKAGNTAAPLLAEFLGGDVLMSFICAVAFATILAVVSGLVLTGASAISHDIYGEIIKNGKLTEKQQVLAARTGSISIAIVSIILALFAQSLNVSFLVSFAFCIGASANLPVILYTIYWKKFNSTGAVTAMVTGLVSCLVLGAMGPNVWSPVEGAAIFVGNPLVPLAVPAIITIPLGFIAGYLGSVLSSNKVSQAEADRIYKEIRVKANTGVSVSDISH
>CP019980.1|AVK97018.1|2469609_2469948_+|hypothetical-protein
MANNQASKSIVIDYDAIAKQESFKALVRKKNAFLWSITVFFLAAYMLLPILTSYTTILHQKAIGEVTWVWIYAAGLFIMTWSLCHLYVAKANSYDKEAKAIIAEYENGGGRL
>CP019980.1|AVK97019.1|2469944_2471489_+|cation-acetate-symporter
MSFIAIFFFVAIVGLTLVITWWASKRTSSASDFYTAGGGLTGWQNGLAIAGDYLSAASFLGIAGAVALFGFDGFFFSIGYLVAYLVVLYIVAEPLRNLGKFTLADMITARFNNSKVRGTAALSTITIVLFYMIAQLVGAGALIQLLLGIDYWVAVLIVGVMMTTYVLFGGMTATSWVQIIKACLLMLGTVIISFLVLKEFGFSISTMFTEMSTATDSGAAYLNPGLKYTNGIDTISVLIALVLGTAGLPHILMRFFTVKDAKTARSSVIWATWIVGLFYVLTIFLGFGAAAFVGKEDIIAANAAGNMAAPLLAEALGGDILFSFVCAVAFATILAVVAGLVLSGASALSHDIYGQIIKKGKITEKEQVLAARIGSITISIVSILLALGAQTLNVAFLVSLAFCIAGSANLPVIIYTIYWKRFNTAGAVTAMLTGLISALILVAVSPNVWNPVEGKAIFVGNPLIMLTNPAIISVPLGFLGGFIGTLLSKESDDAKYREVDVKANTGISVQDVSH
>CP019980.1|AVK97020.1|2471586_2471775_+|hypothetical-protein
MALSKAKKKRMHLKRTQGKDVEKKRQTAPFSTHERVTKTKHATLEHNRTKHRKQPHGDDYSL
>CP019980.1|AVK99070.1|2471798_2472548_-|DNAase
MLIDAHIHLDQYQEEEVPLLLDEAQTVIAVSTDLQSCEKTLKLSRAYAKVKAAYGFHPEQSLPNDKEKEALFNWIRLHASEMIAVGEVGLPYYRKQTHVLDERPYIALLEQFILLAQELHKPIVLHAVYEDALIACDLLEKHGVKKAHFHWFKGSEEAIVRMIHNGYYISITPDCVYEAEIQDLITKYPLELMMVETDGPWPFEGPFDKARTSPSMMAKSIEVIATLKGITTQEAANTLTRNTKLFYDL
>CP019980.1|AVK97021.1|2472537_2473287_-|ABC-transporter-ATP-binding-protein
MLNIQDISKSFGSLEVVYNLSFTVQEGEFVAIIGPSGSGKSTLFQLIGGITPVDRGAILLNGDNIQRKTGSIGYMPQQPCLLPWRTILENVMIVEELQRRPNKELAKAWLEKVGLASFENAYPHALSGGMQQRVSFLRAIVSGKPILCLDEPFSALDEFTRLEMQAWLLSIWEEHKKSILFVTHSIEEALFLADRIIVLTKRPATVKEEIIVPFARPRSEEIRHSTQFTQLKQQLFQYLKEEKDDAYVD
>CP019980.1|AVK97022.1|2473261_2474035_-|nitrate-ABC-transporter-permease
MKQVMLKGRSIIFIAFLLFIWELIIRVADIPHWLLPAPSAIMIEGIESYSTFIPHVWATIQLALLGLAIGVMCGLSVAVFLHRSSTIRAFVYPILIVSQNVPVLVLAPLLIIWFGFGLLPKLIIICLVCFFPIVIAAMDGFRQTSPELKHYFAMIGATKGQTFWKLEWPYAYPSIFSGIKIAATYSVMGAVIAEWLGAKKGIGVYMTLAQSSFRTDRVFVAIFAIVLLSLLLFSVIRFVEKLVVKGRGAHAEHSRHI
>CP019980.1|AVK97023.1|2474031_2474325_-|hypothetical-protein
MANSLISVQIIPKTEKYEDVIPFVDAAIAVIDASGVHYEVHPLETTMEGELSTLLQIIEEMNKKMIDLGAINVITQVKILYQPAGITMGTLTEKYRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019980_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019980_3

3794258-3794352

Orphan

Consensus_repeat	Method
TAAATTGTTTGAGTGACTGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP019980_3

>merge|CP019980|3|3794258-3794352|CRISPRCasFinder
TAAATTGTTTGAGTGACTGGCACCGATAATACGTAAAAAACCCACTTCTCGTGGGTTTTCCTTTTAATATTCAAAATTGTTTGAGTGACTGGCAC

>CP019980|3|2|3794258-3794352|CRISPRCasFinder
TAAATTGTTTGAGTGACTGGCAC	CGATAATACGTAAAAAACCCACTTCTCGTGGGTTTTCCTTTTAATATTC
AAAATTGTTTGAGTGACTGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP019980.1\|AVK98200.1\|3806337_3806790_-\|thiol-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|239310
CP019980.1\|AVK98199.1\|3802861_3805384_-\|lysylphosphatidylglycerol-synthetase	unknown	unknown	gnl\|CDD\|225451
CP019980.1\|AVK98198.1\|3802058_3802556_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
CP019980.1\|AVK98183.1\|3783386_3784730_-\|branched-chain-alpha-keto-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
CP019980.1\|AVK98187.1\|3788088_3788877_-\|phosphonoacetaldehyde-hydrolase	unknown	unknown	gnl\|CDD\|184075
CP019980.1\|AVK98202.1\|3807976_3808519_+\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
CP019980.1\|AVK98196.1\|3797825_3798659_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019980.1\|AVK98188.1\|3788866_3789967_-\|2-aminoethylphosphonate--pyruvate-transaminase	unknown	unknown	gnl\|CDD\|184076
CP019980.1\|AVK98192.1\|3793485_3794244_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
CP019980.1\|AVK98190.1\|3790967_3792593_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|274495
CP019980.1\|AVK98184.1\|3784777_3785755_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP019980.1\|AVK98195.1\|3795777_3797445_+\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
CP019980.1\|AVK98201.1\|3807029_3807572_-\|thioredoxin	unknown	unknown	gnl\|CDD\|239313
CP019980.1\|AVK99127.1\|3805494_3806157_-\|potassium-transporter-Trk	unknown	unknown	gnl\|CDD\|223643
CP019980.1\|AVK98191.1\|3792585_3793338_-\|ABC-transporter	unknown	unknown	gnl\|CDD\|226361
CP019980.1\|AVK98197.1\|3798758_3801848_+\|Swarming-motility-protein-SwrC	unknown	unknown	gnl\|CDD\|223911
CP019980.1\|AVK98186.1\|3787269_3787827_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|234668
CP019980.1\|AVK98189.1\|3789981_3790965_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270262
CP019980.1\|AVK98194.1\|3795562_3795772_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184224
CP019980.1\|AVK98185.1\|3785758_3786874_-\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|213783

Protein	Function_ID	Function_description	E-value
CP019980.1\|AVK98200.1\|3806337_3806790_-\|thiol-disulfide-oxidoreductase	gnl\|CDD\|239310	cd03012, TlpA_like_DipZ_like, TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.	5.46747e-28
CP019980.1\|AVK98199.1\|3802861_3805384_-\|lysylphosphatidylglycerol-synthetase	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	2.60076e-140
CP019980.1\|AVK98198.1\|3802058_3802556_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	5.30541e-31
CP019980.1\|AVK98183.1\|3783386_3784730_-\|branched-chain-alpha-keto-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	0
CP019980.1\|AVK98187.1\|3788088_3788877_-\|phosphonoacetaldehyde-hydrolase	gnl\|CDD\|184075	PRK13478, PRK13478, phosphonoacetaldehyde hydrolase; Provisional.	2.20837e-151
CP019980.1\|AVK98202.1\|3807976_3808519_+\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.28369e-19
CP019980.1\|AVK98196.1\|3797825_3798659_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.04464e-15
CP019980.1\|AVK98188.1\|3788866_3789967_-\|2-aminoethylphosphonate--pyruvate-transaminase	gnl\|CDD\|184076	PRK13479, PRK13479, 2-aminoethylphosphonate--pyruvate transaminase; Provisional.	0
CP019980.1\|AVK98192.1\|3793485_3794244_+\|transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	3.2316e-74
CP019980.1\|AVK98190.1\|3790967_3792593_-\|iron-ABC-transporter-permease	gnl\|CDD\|274495	TIGR03262, PhnU2, putative 2-aminoethylphosphonate ABC transporter, permease protein. [Transport and binding proteins, Amino acids, peptides and amines].	2.51483e-97
CP019980.1\|AVK98184.1\|3784777_3785755_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
CP019980.1\|AVK98195.1\|3795777_3797445_+\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	0
CP019980.1\|AVK98201.1\|3807029_3807572_-\|thioredoxin	gnl\|CDD\|239313	cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides. The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric interface in atypical 2-cys PRX and PRX5) at the opposite end of the monomer to form the stable decameric (pentamer of dimers) structure.	3.25569e-108
CP019980.1\|AVK99127.1\|3805494_3806157_-\|potassium-transporter-Trk	gnl\|CDD\|223643	COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism].	3.8328e-59
CP019980.1\|AVK98191.1\|3792585_3793338_-\|ABC-transporter	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	2.06109e-103
CP019980.1\|AVK98197.1\|3798758_3801848_+\|Swarming-motility-protein-SwrC	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
CP019980.1\|AVK98186.1\|3787269_3787827_+\|peptide-deformylase	gnl\|CDD\|234668	PRK00150, def, peptide deformylase; Reviewed.	2.98113e-66
CP019980.1\|AVK98189.1\|3789981_3790965_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270262	cd13544, PBP2_Fbp_like_1, Substrate binding domain of a putative ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The substrate domain of this group shows a high homology to the periplasmic component of ferric iron transporter (Fbp), but its biochemical characterization has not been performed. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	5.00727e-35
CP019980.1\|AVK98194.1\|3795562_3795772_+\|hypothetical-protein	gnl\|CDD\|184224	PRK13667, PRK13667, hypothetical protein; Provisional.	3.0842e-27
CP019980.1\|AVK98185.1\|3785758_3786874_-\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	gnl\|CDD\|213783	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit. Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc. [Energy metabolism, Pyruvate dehydrogenase].	0

>CP019980.1|AVK98192.1|3793485_3794244_+|transcriptional-regulator
MYTVERQQHILQFIRNNKVVKLVTLTKEFNVSMETIRRDIQQLVQEKKIEKFYGGVKYIEPVEGLMDNRLTQQLTEKIAIAKACASLVNNGDCIFIDSGSTTYQMTPFLLGKEKLTVVTNSLPVAFDLIGSNIEVMIIGGRVRHSEKSVTSNDFLFHFDHLNINKAFICASGVTLEKGISDFSLEEAMTRKQLINISQTVYVATDSTKFNKDVAIQVCPLEEVDMILTDNGLPKETLHQFTEAGIQLKVVDI
>CP019980.1|AVK98191.1|3792585_3793338_-|ABC-transporter
MLELKNISKSYKNKNVLRDINLTIDSGEIVSLLGPSGCGKTTLLNIVLGLTEQTDGQLFYNGQDISKQSMQDRGFNIVFQDFALFPHLNAYDNIVYGLKNKKQQMSKAEIQEYVDFLELAPHLHKKIHELSGGQKQRVSIARTLVMQPKILLLDEPLSALDGVIKESIKERIKSIARQFKLTTIIVTHDPEEALTLSDKVLIINEGTVSQYGTPHEILKTPKNQFVEDFILKQLHIKRHNIYQLFGESYA
>CP019980.1|AVK98190.1|3790967_3792593_-|iron-ABC-transporter-permease
MLKTNKMVKILFLPIVFFFLFFLIVPLLYMFWQSLKKGNSVTIQNYVEALQSVEIREAFLNSFQVSFVAAVITTCLAFALAYAMHFTTMNQHLKKLVHIGVTLPMLLPTITYGFVLLYTFGNQGIITKLLGKPLVTIYGFNGLLIGYVLYTLPVAFILMQNSMQYIDKRFLLVSMLMHDRPSRRFYHTVFRPMIGTIGGAFILTFILSFTDFGIPASVGGGYKVIATELYQAMLGSIVRFEQGAVISVLMLVPAVLGIVMLSVLDRFNFQYKHVSQSALVVHRLRDSIFTVLSLVCVSTIFIIFSTMFIVPFTKGYPYDFSFTLEHVQNVLAEKNLTRVYMNSLIVAFFTAILGVGIAFVSALLNVRTPLKGRSTLDFASMITNTVPGMVLGLSYLFFFNGSSLKGTFFIIIAYTVVHFFTTPYLMAKNSLQKMDPTWEVTGELLKDSWLQTVIRVILPNIRPTIFQMFSYYFLNAMVTVSGVIFLVSTKTMLVSTRIKELQHFAKYTDIFVLSIFILCTNLIVKLGCDYITTNKEKFKEM
>CP019980.1|AVK98189.1|3789981_3790965_-|ABC-transporter-substrate-binding-protein
MKKSTVMMFGTVSSAIVLAACGGAEADTKDQVIIYSNADDEAIEVMQTTLDKKGYEGKYIIQSFGTSELGGKMMAEGKDIEADVVTMASYFIESAQTSKSMFVELTSELKPLDGGSTYALPILGNVGSIFINTDLLAQKGLPVPQTIKDLTKPEYKDLVSFPNILDSSTGWLLVQAIMSEYGEKEGKQVLADLIKNAGPHIESSGSGPIKKVKTGEVAAGFGLRIQAIDAKNEGLPIDYIDPTEGNFTLTESVAVVDKEGDEALASEIAKVIATEARADLLKQYPVALYEGEQVEEKYVPKYLKKWDTTLTVDLLEKHQTFFKEAQQ
>CP019980.1|AVK98188.1|3788866_3789967_-|2-aminoethylphosphonate--pyruvate-transaminase
MNTYKLLTPGPLTTTEAVKKEMLVDRCTWDDDYKQVTQEIRKQLVAIAQVDETDYTAILMQGSGSFVVESVLTTAIGNADKVLIITNGAYGERIVEMATVLQLQHVVYSVPYHEQPSPLEVQAILEKDVAITHVAIVHCETTTGILNPIDEIGKVVKSFNKTFIVDAMSSFGGVPMDLSNMQIDFLISSANKCIQGVPGFGFVVAKIEALEKCKGQAKSVALDLYKQWEVMSEDGKWRFTSPTHVVAAFAKALEELAEEGGVAARYTRYAKNNQLLRERLSRCGFEAYISAEMQSPIITTFLYPYEGFSFEHFYHEMKQAGFVIYPGKLTEFDTFRIGNIGDVHEEDMTTLCNVIENYMAVKNNEN
>CP019980.1|AVK98187.1|3788088_3788877_-|phosphonoacetaldehyde-hydrolase
MKIEAVIFDWAGTAVDFGCFAPVNVFLTIFEDAGVAVTLEEARKPMGMLKIDHIRTMLEMPRVSEAWARVYGRSFTEQDVQALYSQFETKLMASLAKYTDPIPHVKETVQQLRQAGIRIGSTTGYTAAMMEVVTHHAAEKGYKPDFLVTPTDIGDKGRPYPYMIFRNLEELGVKATKQVVKVGDTTSDIQEALNAGVWAVGVIVGSSEMGLTEQEFMSLSDEEQQAVIEKTKAIFEQTGAHYTIQTMRELPALIETINARLV
>CP019980.1|AVK98186.1|3787269_3787827_+|peptide-deformylase
MILMDDIIREGHPTLRTKTEEVQFPLTDEIKQLATDMLQFLINSQDPEIADKYDLRSGIGLAANQVNSLHRMFALHLKDDKGEQLSFIAINPKIVSHSVENTYLPTGEGCLSVDRNVPGYVPRHARITVKFKTMDGEEKKMRLTGLPAIAFQHELDHLNGIMFYDRINEKNPFAEIPDAVPYERD
>CP019980.1|AVK98185.1|3785758_3786874_-|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha
MSKKNNNIFDPQQTLTEIEEKFEMFQILNEEGEIINEEADPKLADEELVELMTRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQLASHFALEKEDWILPGYRDVPQIVWHGLPLDKAFLFSRGHFEGNQIPEGVNVLPPQIIIGAQFIQAAGVALGMQKRGKKAVAVTYTGDGGSSQGDFYEGMNFAGAFKSPAIFIVQNNQFAISTPRELQTAAKTIAQKGVAAGIPSILVDGMDALAVYVATRDARERAINGEGPTFIETMCYRYGPHTMAGDDPTRYRTSDTDNEWAQKDPLVRFRKYLEGKGLWDEKKEEAVIERAKEEIKDAIKKADAAPKQKVTQLMENMYKGEMPSNLKEQYEIYKEKESK
>CP019980.1|AVK98184.1|3784777_3785755_-|alpha-ketoacid-dehydrogenase-subunit-beta
MAQMTMIQAITDALRTELKNDENVLLFGEDIGVNGGVFRATEGLQKEFGVDRVFDTPLAESGIGGLAIGLSLQGFRPVPEIQFFGFVYEVMDSISGQLARLSYRSGGVYNAPVTIRSPFGGGVHTPEMHSDSLESLMTAQPGLTVVVPSTPYDAKGLLISSIRNDNPVIFLEHLKLYRSFREEVPEEAYEIPLGKADVKREGKDLTIIAYGLMVHESLKAAEELEKEGHSVEVIDLRTIQPIDIETIIASVEKTGRAIVVQEAQKQAGIAANVVAEITERAILSLEAPVLRVAAPDTVYPFPQAEGVWLPNYKDVMETAKKVLTF
>CP019980.1|AVK98183.1|3783386_3784730_-|branched-chain-alpha-keto-acid-dehydrogenase-subunit-E2
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTVKEDDILCEVQNDKAVVEIPSPVEGKVEEILVGEGTVAVVGDVLIRLDAPGYEDLKLKGDDHAEAKTEAQVQSTAEAGQDVAKAPAKEEAPKAPATAQVAVKQETADSTKRIIAMPSVRKFARDNEVNIHEVSGTGKNGRILKEDIENFLNGGGAVQAAEAPVANEEAVAQQETAQAAPVVLEGDFPETREKMSGIRKAIAKAMVHSKQTAPHVTLMDEVDVTALVAHRKKFKDIAAEKGVKLTYLPYVVKALISTLREFPEFNRSLDDATQEIIQKHYYNIGIAADTEKGLLVPVIKHADRKSVFAVSNEINDLATKARDGKLAPHEMKGASMSITNIGSAGGQWFTPVINHPEVAILGIGRISEKPVIKNGEIVAAPVLALSLSFDHRMIDGATAQNALNHLKRLLSEPELLLMEA
>CP019980.1|AVK98194.1|3795562_3795772_+|hypothetical-protein
MIYKVYYQEKANEIPVRENTKSLYLEAASEREVRQKLQDRHYNIEFIQLLEGNYLEYEQASPNFVLEEI
>CP019980.1|AVK98195.1|3795777_3797445_+|ribonuclease-J
MKFVKNDQAAVFALGGLGEIGKNTYGVQFQDEIILIDAGIKFPEDDLLGIDYVIPDYTYLVRNVDKIKGLFITHGHEDHIGGIPYLLRQVNVPVYGGKLALGLLRNKLEEHGLLRTTKLIEIKEEDIIKFRKTSVSFFRTTHSIPDAYGIVVKTPPGNIVHTGDFKFDFTPVGEPANLTKMAEIGRDGVLCLLSDSTNAEKPNFTMSERTVGKSIDEIFRKVDSRIIFATFASNIHRLQQATDAAIKYGRKIAVFGRSMDNAITIGRELGYINAPKDTFIDAQSINRLPANEVMILCTGSQGEPMAALSRIANGTHRQIQIQPGDTVVFSSSPVPGNTVSVNKIINLLFRAGAEVIHGALNNIHTSGHGSQEEQKLMLRLMKPKFFMPIHGEFRMLKMHTHLAEDCDVPLENTFVMENGDVLALSANEAHVAGRIPSGDVYIDGNGIGDIGNIVLRDRRILSEEGLVIVVVSVDMENQKIVSGPDIISRGFVYMRESGTMINEAQKMLNRHLNETIQGKTPQWTELKNEITDVLGPYLFEKTKRRPMILPIIMEV
>CP019980.1|AVK98196.1|3797825_3798659_-|TetR-family-transcriptional-regulator
MLKKQLIMEKALELFSEQGFEATSVQQITERCGISKGAFYLSFKTKDELLFSMVDYYLQQFIADIDHVVRNSNKKDVMLVDFYKNIFQAFKKHAASSRVFFNEKVFLTNKELFLKVSAYEADMSKSIVQMLEQLYREELQETKYDVMYCVKGFMKSYAELFIFSDLPLDLDQLAQSLAEKTDIIARHTTIPFITEELAQLVARPCDQEITQESLLQLIDQNIHNLEPSIERESLELLKNQVEHTTYSQAIIKGLIENIRLQPGCQWVVYVLDKYFQF
>CP019980.1|AVK98197.1|3798758_3801848_+|Swarming-motility-protein-SwrC
MKGLVNFVLKNKLAVWLLTIIITVSGIYSGTRMKMESIPDISIPYLIVMGVYPGATPEQVMNELSIPFEKSIESLEDVKAVYSTSSSNVAQVQVEYDYGIDMDEKKRQLESALDNVKLPEGAQEPTIMAISMNMMPVVALSVSSSKEDIVDLTSTVEDLLLPKIEKIDGVASATITGQHIEEVSFKYDEEKMAALGLTEDAVKQMIQASDMSLSLGLYQFTVGEQAVSVDGKVKSIDELKDLLIPVTPSATQPSPFVRLGDIATIEVEGKVQSVSRTNGKDAIAIQIVKSQDANTVTVVNAVKELIKDEEKRIDGLKIDISLDQGAPIEDSVFTMIEKAVFGGAIAVLIILLFLRDFKSTIISIISIPVSVFMALLLLNWMDITLNIMTLGAITVAIGRVIDDSIVVVENIYRRIHLKQEKLTGRALIREATIEMFKPILSSTLVTVAVFAPLMFVGGMVGELFMPFALTMTFALGASLIVAITIVPALSHFLFRKKIYGEKKESQHQEVGKLAIWYRGILEKALNHKIITSTIAILMLVGSLALTPLIGFSFMGSQEEKVMYLTYTPGTGELADETEVNVAQVEKELMKRKDIDILQVSITDATNADPAAMMMGGTAGGALMYLIFDPEMEDFPAARQEVEDYVFNLDQSGEWKSQNFSSTSMASNEVSYTLYSEDLNKLRSAVKDVEGSLKEVKGLEDVKSDYEDPYVEHVLKVEQKNVLQYGLTTAQIVMALNSTASQEVLTTVERDGKDINVIVKRDAKAAALSIDDVLKTEIKTALGTTMTIGELVNVEEGTTLNSLSRSKGEYFATVSATIIGDDISKATTAADKKIDKLDLPKGVTTGVSGVAADMQETFTQLGIAMLAAIAIVYFILVVTFGEGLAPFAILFSLPFAVIGAFVGLYVTNQTISVSVMMGLLMLIGIVVTNAIVLVDRIIHMERDGLGMREAILEAGATRLRPILMTAIATIGAMIPMAIGNGGSGLISKDLAITVIGGLLSSTLLTLVVVPIVYEMLSKMLKKNRKDVEEN
>CP019980.1|AVK98198.1|3802058_3802556_-|GNAT-family-N-acetyltransferase
MLITENCVIEFLKPHHQDDIYSLYCNQDVRAFLGGIPDKNYILSSFNSMLQSSFPNSYFTISLKNTNDFIGLVSIDEYHEQTTYELSYQFLPQYWGKGYAQEVLTAVIHYGFTSLQLSKLVAETQTANIASCRVLEKIGMEKIQVLERFGQEQAVYQLLSTNNGC
>CP019980.1|AVK98199.1|3802861_3805384_-|lysylphosphatidylglycerol-synthetase
MFKFRKEPLLRFLKIIFPIILLAIAIYEIQQSLRGVNVNLLRNEVSQLQVWELLLIFFITFCAITPMIFYDVILVKLLGMKINKRTLVNNSFIVNTFSNLIGFGGLVGVFLRNYFYSKYKVDREGLLKSIATVTLFYLTGISLLTWLMYLFFWDFPMLKEIRWLSIAVIVVSLYVPVFLVTHLIRYNKRSALTYKVFLQLMITSVAEWLAVFFVIWMLTIIIQIPMELSTLIPIFLIASCAGIVSMIPGGVGSFDLVFLWGTQSVGIAEEKVLFLLILYRVGYFVLPFLVSVLLFMKDYWERWNRSWDDVPNVIFQKISHMLLTSLVFISGIVLLLSASVPGILSRLKIAQEFLSSPIMNISHQLTVAAGFILLGLCRGIKYKVKTAYQLAIIVLSSSALFSISKGFDYEEAIFLLIVAVLLMASKKQFYRESYVLTWGTILFDLAAVIFITAMYLLIGYINLPTAKIHIPTPLQYYILTDYRDLFFSAMIGILIACAIFYLGYLTRGPKKMYKLLSKEHEDKIKSHLMEYTGTEFSHLIFLHDKFVYWNKENTVLFAYQIYADKIVVLGDPVGPESDLLSAIQEFLEVADRHGYTPVFYEINNKIFPVLHEHGYSFFKLGEEAFVDLEMFTFAGKEMKGSRAVKNRFERENYTVTILSPPYSQEVMTELAEVSRKWLQGRAEKGFSLGFFDENYLNTSKIAVLRGAEGVIGFASIMPMYDNGERISVDLMRFKPGAPSGTMDFIFLSLFQWAKEQGYHVFNMGMSPLSNVGQSRYSFLSEKIAAQIFLHGQYFYHFKGLKNFKLKYADFWEPKYVAYRKKSSLPFTMAQITLLIGRKRK
>CP019980.1|AVK99127.1|3805494_3806157_-|potassium-transporter-Trk
MKKEFAVIGLGRFGGSIVRELMSQGAQVMAIDHSSERVDEFAAIATQAVIADSTDESVLNSLGIRNFEHVIVAIGEDIQASILTTIILKEIGVQQITVKAQNDYHEKVLRKIGADFVVHPERDMGIRIANNMLSNTVLDYLELSDEHSIMELKANDAIAGYSIMDLDIRAKYGINIVGIKRGSDIIVSPQASDKILLGDIMLLIGADVDINRFVKKAMKE
>CP019980.1|AVK98200.1|3806337_3806790_-|thiol-disulfide-oxidoreductase
MKLREQMPELTGATTWLNGEVTKAQLVGEKPTLIHFWSVSCHLCKEAMPEVNNFRDQYKDELNVIAVHMPRSEADTDLDTIKAVAAEHDITQPIFVDNEMKLTDAFENQYVPAYFVFDKDGQLRHMQAGGSGMKMLEKRVNRVLDEMRNA
>CP019980.1|AVK98201.1|3807029_3807572_-|thioredoxin
MAERMVGKQAPDFTMEAVLPDKSFGKVSLEEIKSQDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDAEVIGVSTDTIHTHLAWINTDRTQNGLGELKYPLAADTNHAISKEYGVLIEEEGIALRGLFIINPEGELKYQTVFDNNIGRDVDETLRVLQALQTGGLCPANWRPGQATL
>CP019980.1|AVK98202.1|3807976_3808519_+|Cro/Cl-family-transcriptional-regulator
MQIGGKIKALRLKKGLTQEELGERTDLSKGYISQLERDLNSPSIETLFSLLEVLGSTPKEFFDDDAPEQKVVYTEEDQSTYTDEEKKYEIQWLIPTSNEKEMEPIFLTLAADGEFKQFEPSLSETFIYIVKGRIRLVLGNEQYIASEGNALYFDAADHHQIFNAHDDETKILLVATDSYL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019980_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019980_5

4402600-4402692

Orphan

Consensus_repeat	Method
GTGCCAGTCACTCAAACAATTCTCACACAATTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP019980_5

>merge|CP019980|5|4402600-4402692|CRISPRCasFinder
GTGCCAGTCACTCAAACAATTCTCACACAATTTAGCAAGAGCCAGGGAAAGGCTCTTGCGGTGCCAGTCACTCAAACAATTCTTACACAATTT

>CP019980|5|4|4402600-4402692|CRISPRCasFinder
GTGCCAGTCACTCAAACAATTCTCACACAATTT	AGCAAGAGCCAGGGAAAGGCTCTTGCG
GTGCCAGTCACTCAAACAATTCTTACACAATTT

Protein	Signature genes	Signature genes Name	Protein_function
CP019980.1\|AVK98721.1\|4408572_4409190_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019980.1\|AVK98712.1\|4400346_4401714_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224089
CP019980.1\|AVK98707.1\|4395058_4395640_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223489
CP019980.1\|AVK98710.1\|4397598_4398300_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|378925
CP019980.1\|AVK98705.1\|4392373_4393888_-\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|350769
CP019980.1\|AVK98719.1\|4406510_4407695_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
CP019980.1\|AVK98708.1\|4395652_4396609_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|335768
CP019980.1\|AVK98717.1\|4405252_4405852_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374749
CP019980.1\|AVK98704.1\|4391479_4392259_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371367
CP019980.1\|AVK98724.1\|4413248_4414154_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019980.1\|AVK98706.1\|4394210_4394882_+\|alkylhydroperoxidase	unknown	unknown	gnl\|CDD\|200420
CP019980.1\|AVK98715.1\|4403736_4404357_+\|hypothetical-protein	unknown	unknown	unknown
CP019980.1\|AVK98711.1\|4399665_4400247_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
CP019980.1\|AVK98722.1\|4409313_4411500_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225272
CP019980.1\|AVK98716.1\|4404637_4404901_-\|hypothetical-protein	unknown	unknown	unknown
CP019980.1\|AVK99144.1\|4398353_4399505_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|367135
CP019980.1\|AVK98709.1\|4396753_4397602_+\|bacitracin-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
CP019980.1\|AVK98720.1\|4407740_4408169_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225283
CP019980.1\|AVK98718.1\|4405877_4406093_-\|hypothetical-protein	unknown	unknown	unknown
CP019980.1\|AVK98723.1\|4411576_4413091_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794

Protein	Function_ID	Function_description	E-value
CP019980.1\|AVK98721.1\|4408572_4409190_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	8.56438e-15
CP019980.1\|AVK98712.1\|4400346_4401714_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.20842e-135
CP019980.1\|AVK98707.1\|4395058_4395640_+\|hypothetical-protein	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	2.87668e-14
CP019980.1\|AVK98710.1\|4397598_4398300_+\|ABC-transporter	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	2.22692e-06
CP019980.1\|AVK98705.1\|4392373_4393888_-\|ATP-dependent-helicase	gnl\|CDD\|350769	cd18011, DEXDc_RapA, DEXH-box helicase domain of RapA. In bacteria, RapA is an RNA polymerase (RNAP)-associated SWI2/SNF2 (switch/sucrose non-fermentable) protein that mediates RNAP recycling during transcription. The ATPase activity of RapA is stimulated by its interaction with RNAP and inhibited by its N-terminal domain. The conformational changes of RapA and its interaction with RNAP are essential for RNAP recycling. RapA is part of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	9.04031e-58
CP019980.1\|AVK98719.1\|4406510_4407695_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	2.76632e-124
CP019980.1\|AVK98708.1\|4395652_4396609_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|335768	pfam04397, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	4.49384e-28
CP019980.1\|AVK98717.1\|4405252_4405852_+\|hypothetical-protein	gnl\|CDD\|374749	pfam16717, RAC_head, Ribosome-associated complex head domain. The RAC head domain is involved in ribosome binding.	0.00446801
CP019980.1\|AVK98704.1\|4391479_4392259_-\|hypothetical-protein	gnl\|CDD\|371367	pfam11079, YqhG, Bacterial protein YqhG of unknown function. This family of putative proteins is conserved in the Bacillaceae family of the Firmicutes. The function is not known.	4.2626e-154
CP019980.1\|AVK98706.1\|4394210_4394882_+\|alkylhydroperoxidase	gnl\|CDD\|200420	TIGR04169, perox_w_seleSAM, alkylhydroperoxidase/carboxymuconolactone decarboxylase family protein. Members of this family are usually annotated as putative carboxymuconolactone decarboxylases, are related also to alkylhydroperoxidase AhpD, and contain a peroxidase-like Cys-X-X-Cys putative redox-active disulfide. All members occur in genomes with a radical SAM protein of family TIGR04167, which occasionally are selenoproteins.	6.04456e-19
CP019980.1\|AVK98711.1\|4399665_4400247_-\|N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	7.47521e-31
CP019980.1\|AVK98722.1\|4409313_4411500_+\|hypothetical-protein	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	1.16594e-80
CP019980.1\|AVK99144.1\|4398353_4399505_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|367135	pfam02655, ATP-grasp_3, ATP-grasp domain. No functional information or experimental verification of function is known in this family. This family appears to be an ATP-grasp domain (Pers. obs. A Bateman).	0.000486216
CP019980.1\|AVK98709.1\|4396753_4397602_+\|bacitracin-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.9597e-87
CP019980.1\|AVK98720.1\|4407740_4408169_-\|hypothetical-protein	gnl\|CDD\|225283	COG2427, COG2427, Uncharacterized conserved protein [Function unknown].	4.11423e-10
CP019980.1\|AVK98724.1\|4413248_4414154_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.27432e-15
CP019980.1\|AVK98723.1\|4411576_4413091_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.66248e-103

>CP019980.1|AVK98712.1|4400346_4401714_+|GntR-family-transcriptional-regulator
MELAISFIGNKPKYAQIYENIKHAILSKKLLAHEQLPSKRMLATTLHVSVHTIKEAYEQLLAEGYIYSKERSGYYIAQLEFEWLQPLQTEKSASLPMTEQSVTYDFSNGHVDKDTFPFSIFHKLMKQHFTINSLSTSPWQGEAALRQEIAKYVGRSRGIHCDPSQVFVYSGTQSQLQALCHYFGPQTHVGLEEPGFKRVRATLQQCGLPIYPITVDNLGVTVPQKAIHMLYTTPAHQFPLGMVMSAERRVALLQWANLNEAFIIEDDYDGEFRYKGLPIPSLANMDQLQRVIYFGTFSKTLLPSLRISYVILPQSLIASFSSFYQEQKSVVSKVDQLVLADFLGQGLFDKHLAKMRTIYRKKQQTLLAAIANHFSNEFKVIGEHAGLHIIVKLPKKLSEQDALHLAHTVGVNVYPCSTSFQSPPEHAMIIIGYGGLSLEQIEEGISLLASVWHAY
>CP019980.1|AVK98711.1|4399665_4400247_-|N-acetyltransferase
MKFNMVENNVVLLRPLVRGDSPALLAAGSYPEIWSYMSTTIEDESDVHNFVENALSNKSLMKEYPFVIVDKLSGQIIGSTRFMDIDSKHQRLEIGTTWLTPSFWRTAVNTNCKYLLLTYCFEVLGLQRVQIKTDHDNLRSQKAIERIGATKEGVLRNHMIRKDGSTRHTVMYSITLQEWPKVKAHLEILLEME
>CP019980.1|AVK99144.1|4398353_4399505_-|ATP-grasp-domain-containing-protein
MKPKLTLRQIYGDNAVYTPRTPYSDNPWMMDDCHKLDALTSREVAIADIPVLVHRATQTAKAKKLHEVAGLAWIEQPYTYETQEEYLAQLDAWCAEGKTIVCQYLHDAEDMNRNCYWMDAAKFNELNTKAYIDHLIDSKYVPSRLNIELYKLSDAMKNWKPPVVLKPGDDSPTSGGYGVIICQNQDELTEGLRQFRMNGTESIIIEELLQAKDNYSCQFVYSEALGIQYLGASKQMTDDNGIYEGNVIVEKVPEKVIEVGRHIMERGVAEGFVGVAGFDLIVTEAGDVQAIDLNFRQNGSTSMLMFHEALGKPVNKFASYASKGVEENASFFQTIEQCIKQGVLVPLSFYDGDYFENKVASRFIGIWYADTLQEIEQLEHQLL
>CP019980.1|AVK98710.1|4397598_4398300_+|ABC-transporter
MNMSFTRIQAIFMKDYKEFSRNYAVSVMVFLPLILAFAYNKIGTSSIDAYFLPINLVFAVVTAYVQCCLIAEEKEKNTLRNLMLSPASLADILIGKSLFVFIVTIVVVSLAIFLVGYEPANLLILAIALLLSTVFYIALGTLCGLFAKTIMEASIIVMPVMFIFSFGPFALSLASAYPILELAKWLPSSQLVLLAEALEGPYTMMDCIIPIVTITVWSLLTWGITGFIYKKLN
>CP019980.1|AVK98709.1|4396753_4397602_+|bacitracin-ABC-transporter-ATP-binding-protein
METVIDVQHLNKVFNRETALQDVSFTIKKGEIFGFLGPSGSGKTTTIKILTAQTEKTAGDVSLFNRPVSEMKSSQNRQRFGILTDNSGLYTRLSIEENLLLYSSLYQLPTSAVKDALDFVNLYAERKKKISQLSKGMIQRVTLARAIMHKPELLFLDEPTSALDPVNTQHIYNGLRKLNELGTTIFLTTHDMSEAEILCDRVAFLHQGKIRAIGSPKQLKKEFGDETITVELTNGHYETIQNGEQDAQKLYDWMQSNAVARLYTNEPTLGDIFMQITGSDLI
>CP019980.1|AVK98708.1|4395652_4396609_+|ABC-transporter-ATP-binding-protein
MNQNKYIEIEPYIESGNIIYPSFQFPLQPDCIIGIYTDVAKIKPLMEWFLKQPNCYTCLRESALYERLTVMEYIQFCLKLYTIPLHNKDEILKLLTLTEHKNKKINKLQNGEKQRLKLLHTYLNSAQIQVIEEPFQNLDEFSKHSVQQLLTALQKKEKTIILLSNNLEDLIISSGEIYRLDALGLHALDVEEDEIETVSTPIDNAPIRFDKIPTKKNDKIILFNPPEIDYIESVEGVVSVYVANEAYPCTLSLNDLEQKLTPFGFFRSHRSYIVNLQKVREIITWTRNSYSLALNSNEKTVVPLSKNKLADLKEILGI
>CP019980.1|AVK98707.1|4395058_4395640_+|hypothetical-protein
MKRKKIFILHEIYGVNDFIKDQGQTYSDSNTNVECISLYSNGKVFSYSQEKEAYQYFTQEIGFDRPLERLTLLLLEAKVQYDEVVLIGFSVGATLAWRLSNLPIHRIICIYGSRIRQYLDVHPTCPTLVILPSHEKSFDVNELKKAIERLPFVQTAQLSGKHGFMDYNNSNYCDNSYLQAQSVIHYFLHKEQL
>CP019980.1|AVK98706.1|4394210_4394882_+|alkylhydroperoxidase
MSTNSLYQKNYFNRLGEFANLSPESFHAFVKFDTLALKEGKLSAKLKELIAIAVAHTTGCPYCIELHITQAKQKNASKEEASEAIMIATALKAGSALAHGVNALNAYDGNTDEELYKEQYFLRIKEFSTLHSSAFNAFIDFDTKTMKDGLLTGYEKELIAIAVAHTTGCPYCISLHVQAAKKLGVSKEEIAESIMVATALKAGSALAHGVNALNAYDQVALLT
>CP019980.1|AVK98705.1|4392373_4393888_-|ATP-dependent-helicase
MIMIVERSSDWQEGFLNRLNNAEKWHSWTLYKMNYEIVKMNLIPEFTGLQAPKFLPKLTPLAHQLEAAQTVIERMNGKAILADEVGLGKTIEAGLILKEYLIRGLVKKALILAPASLINQWIEELNQKFHIPAMAYKKNCPIERYDIVIMSMDTAKKSPHKELIYAQDYDMIIIDEAHKLKNHKTQIYDFVQGLKKKFCLLLTATPIQNDVFELYYLISLLKPGHLGNYETFQSAFSASKHDLQHDDYLKELVNQVMVRNRREDTGIEWTNRRVQIVPIHFSPEEMEVYHLLGTLTSTASFSLITLQKEMCSSKEATALTLSKMLENSAEREALEEILAKVMALEVNSKAQKTLEIIEQAKDKVIIFTEYRATQIYLQWYLHSHGITSVLFNGKFNKNKRDYMKHVFKEKAQVLIATEAGGEGINLQFCHHVINYDLPWNPMKLEQRIGRVHRLGQEHDVHIYNLAVEDTIEIDILALLHTKIDVFEKVVGDLDAILTNFKKTV
>CP019980.1|AVK98704.1|4391479_4392259_-|hypothetical-protein
MYPQQVHNYLRQFFLENECDMIFEDEHYLTVQLTIAMDKRIMNRPFYWQYVEATNGEPNPAQVTFITEQNAMSGKVIGEVVHFGSPRLNQIFQATRELGAFVQMFQKVDAEIGQVLLTPWLGVNYKVSYCCDRTKEMLYSFGINLLTGTINNNFHEAINSIDWDSTQSENAFYVQHIIKPERALQRLDKAIDAIIQQDDHTWAEQAKKRWQRDQRVLDYFYEDVEEKPECYEVEKKALEEQYDAKIKIEIVNGGLFYMR
>CP019980.1|AVK98715.1|4403736_4404357_+|hypothetical-protein
MMMKPRKDTYNGIDCNFFDMNSDKICFMFSGTGYNYDKPLLHYATSLMLDLGYDVVQVCYTFEQQLFHKPPNVISEKVFNSVDSIVTYYLQTKAYKEVVYIGKSLGTLPIIDFYMQQETVLPSRYILFTPLLSLEHTMQNLINRHSFLAIGTADPHFSVERLNQLTSHQLTIVETANHSLEIANNTLESINTCHTILTALKAYLQK
>CP019980.1|AVK98716.1|4404637_4404901_-|hypothetical-protein
MRRIRIIVVLLFIFLAVGFSIFTYSRFNPIININTEIIKIREKNLSKFDIENTQKHIYRKLNFTLNIKYSNKIDDIKIDIPIHFVNY
>CP019980.1|AVK98717.1|4405252_4405852_+|hypothetical-protein
MLKKFIFLFTLLLSLSTAFAIDSKAAEVVDLAEVVDLAEVVDLAEVVDLAEVVDSAEVVDSAEVVDSAEISPFFINDFRYRKTNVRTYFEWSDFKRVSDNLTTGAAGGSITSSNTVSFQTEVSGIIDGLGYSRSKSITSSIGYTLHANPNTTVYMGYRAYYKVETGTRELYDIVTGKVLRRNTYTIKIPQYGDYKLITT
>CP019980.1|AVK98718.1|4405877_4406093_-|hypothetical-protein
MDNKYKLLGVLCIIIPILSTIYILLNSEILVPKGYNLAIDGYVISRNLLIIFLLYSLSKLGYFLYSQLKQD
>CP019980.1|AVK98719.1|4406510_4407695_-|FAD-dependent-oxidoreductase
MSKEIVILGAGYAGVLTALTARKYLSADEAKITVVNQFPTHQIITELHRLAGGTIAEGAVALPLKKIFKGLDIDLQIAKVTKFNVDTKKVDLDTGYTLSYDTLVVSLGSQTGFFGIPGLEENSMVLKSVNDANKINRHIEDRIKAYAQSKDEADATIVIGGGGLTGVELVGEIVDNFPKIAAQHGVNFADLKIKLVEAGPKILPVLPDVLIERATESLTKRGVEFITGTPVTGVDGNVISLKDRESIVANTFIWTGGVAALPIVAESGLAADRGKATINEFLQSTSHEDVFVIGDASVALPADGGRPLYAPTAQVAWQMGECAGYNLFAQYKNQEMKTFSAVNSGTLASLGRKDAVATIGASNTQLKGLPATLMKEASNIRYLTHIKALFGLAY
>CP019980.1|AVK98720.1|4407740_4408169_-|hypothetical-protein
MSETNNQAQSEQLTVSQEQLDVLDQLLKPEVQESLTTLVEQLPKLTEMMTLLTKSYEFAQAVATDEVLKSDTVGAVTEMAGPVVGSAKQLAATAIEAKDRASESQEVIGLFGLVKMLKDPQVQNVFRFVNAFLQVNAERKSK
>CP019980.1|AVK98721.1|4408572_4409190_-|TetR-family-transcriptional-regulator
MKQSPRVLGRPRHDDKAKPTKDIVLETATMLFIKDGYKNVSMDDVAKACNVTKATIYYYYPTKGDLYTSALVEMMHRIRHHIERILEQPIPFRDRLEQLIEVHLSATVDIDMKNFMREATINLSQTQLKEVHASENEMYKTIERAMQSEMEKGTIRKGNAEFFAHTFMALMSVGYFKDGEGKRLFDTVSLASKEIIAFFWLSIEK
>CP019980.1|AVK98722.1|4409313_4411500_+|hypothetical-protein
MKKHPLEQWGSMVASKKGRFLALGCWVLLVLVLSFAWPQINSIESETGKNLPDTEMSEQAAAIIAEEFPNDAGTPLLLVWHRESGLTPADFGAIQKVYAELNSNPLEHQTLVPPYDKMPPQALSASASDNGSTIVTPVFFEKDVATDVLQESLDTLSKTMDSNNVQLDQDLSSDALHVRYSGPVGIATDAVSLFSQADVKLMIATVLLVLVLLILIYRSPLLAIIPLIVVGLAYGVISPTLGFFAEQGWIDKDSQAVSIMTVLLFGAGTDYCLFLISKYREILLDVEDKATAMKLAVKESGGAIMMSALTVVIGLATLSLAHYGSFQRFAVPFSFGVLVMGIAALVVLPAILVIIGRVAFFPFTPRTEEMAKAKGKKQHKPSHKVSHKIGHFVTHKPWIVIAVTVLLLGGLAAFVPRIQYTFDLLSSFPEDMPSREGFTLIEENFSPGELAPVQLVIDTQGSDVNLQQQLTKIPYIDNVSDVQIGTKNNSIQLYELSLNANPYAQESLEHIPELKAEVVKLLKDSGIKDADSHVWLGGETASQYDTKQITERDESVIMPTMIALIALLLFVYLRSVTATVYLLATVIISYFGALGAGWLILHHVMGAEAISGSIPLYAFVFLVALGEDYNIFMISEIWKKRKTKDHLTAVEEGVVHTGSVITSAGLILAGTFAVLATLPIQVLVQFGVVTAIGILLDTFIVRPLLVPAITTVLGKYAFWPGALFKKGH
>CP019980.1|AVK98723.1|4411576_4413091_-|MFS-transporter
MNNDLTMKKPPYGMIAILFVGAFVAFLNNTLLNVALPTIMKDFGITYAKVQWLATGYMLVSGILVPASAFFVTRFKNRHLFITAMSIFTIGTIMAGFAPNFGMLLAGRMVQAAGAASMSPLLMNVMLTSFPKEKRGAAMGIFGLVMIAAPAIGPTLSGYIVEHHDWRMLFQMIIPFAIISLLFGIWKLDNVMETREVHLDVPSVLLSTVAFGGILYGFSTAGDKGWSSPWVYGTIIVGFAALIIFIFKQLRMDQPLLELRIYKYPMFALSSAISVIVSMAMFSGMILTPAYVQSIRGIEPFEAGLMMLPGALAMGIMSPITGKLFDKFGPRILAIIGLTITTMATFGLTKLAMDSSYTFIVSMYTIRMFGMSMVMMPIMTNGLNQLPQMMNPHGTAINNTLQQVAGAIGSAVLVTFMNNRTKSTAEDLIAEAKAHAAQSGVAPTAEQMQQMKEQIMQTALLDGITHSFLIATFVTVLALILAFFLKRVKVESAAATMDLKKPTN
>CP019980.1|AVK98724.1|4413248_4414154_+|TetR-family-transcriptional-regulator
MNKRKRQIITAARELFIEKGFLDTSINDIISAAKVSKGTFYNHFVSKNECLIAILDEGREEASNRRHELLYGKDPTDLEILTQQVAVLMHVNREHNLVQIFESIFHSRDSELKKILLNYHLQELEWLANRLVQVFGEEIRPMSYECAVQTLGMVNLSLRAVLIADYKYINREAIVRVALRNISVIIPTMLESNEVLISAEMFNAIQNVINYQQVSKDVVIDQLAGFTKGLSEDDTLEGFEYATFLLEELQQQKPKLFIIESLLTPFRKAFVGTEHAAEARDIANSLWRYVKMQQPSEQCKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP019980_2	2.3\|2465550\|21\|CP019980\|CRT	2465550-2465570	21	CP019980.1	563924-563944	2	0.905

1. spacer 2.3|2465550|21|CP019980|CRT matches to position: 563924-563944, mismatch: 2, identity: 0.905

aaaaagtagggaattatctta	CRISPR spacer
aaaaagttaggaattatctta	Protospacer
******* .************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP028373	Campylobacter jejuni subsp. jejuni strain huA17 plasmid unnamed1, complete sequence	22811-22834	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP017230	Campylobacter jejuni strain FORC_046 isolate Not reported plasmid pFORC46.1, complete sequence	9213-9236	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP010073	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj1, complete sequence	47850-47873	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP017026	Campylobacter coli plasmid pCC14983A-1, complete sequence	86702-86725	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP017877	Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence	2901-2924	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	31549-31572	1	0.958
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP031220	Arcobacter mytili LMG 24559 plasmid pAMYT, complete sequence	64645-64668	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_006872	Clostridium perfringens plasmid pBCNF5603 DNA, complete sequence	23814-23837	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP054046	Yersinia massiliensis strain 2011N-4075 plasmid unnamed1, complete sequence	90514-90537	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_006128	Borreliella bavariensis PBi plasmid cp26, complete sequence	27062-27085	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP013044	Clostridium perfringens strain JP55 plasmid pJFP55J, complete sequence	30792-30815	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP029793	Psychrobacter sp. YP14 plasmid pYP14d, complete sequence	3533-3556	2	0.917
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	561299-561322	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	877520-877543	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_031034	Bacillus phage SalinJah, complete genome	132105-132128	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_016042	Lactococcus lactis subsp. lactis plasmid pKP1, complete sequence	294-317	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP054658	Lactobacillus reuteri strain AN417 plasmid pAN417A, complete sequence	30459-30482	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_KT717888	Enterococcus faecalis strain 5ZG10E plasmid pE30, complete sequence	11965-11988	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP030090	Lactobacillus reuteri strain YSJL-12 plasmid unnamed1, complete sequence	1097-1120	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP016704	Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8A, complete sequence	7395-7418	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP037428	Myroides odoratimimus strain G13 plasmid pFM-G13, complete sequence	42934-42957	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP016751	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1E, complete sequence	10703-10726	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_015864	Lactococcus lactis subsp. lactis plasmid pIL7, complete sequence	28267-28290	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014926	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence	33137-33160	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024448	Moraxella osloensis strain NP7 plasmid pNP7-5, complete sequence	43746-43769	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP032741	Acinetobacter baumannii strain C25 plasmid unnamed1	90-113	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014875	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-2, complete sequence	7476-7499	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_003383	Listeria innocua Clip11262 plasmid pLI100, complete sequence	72669-72692	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP013700	Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence	98516-98539	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP016710	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109D, complete sequence	11030-11053	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_LR135375	Enterococcus faecium isolate E8172 plasmid 4	15902-15925	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP007180	Campylobacter coli RM5611 plasmid pRM5611_48kb, complete sequence	13037-13060	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024188	Moraxella osloensis strain TT16 plasmid p3, complete sequence	18218-18241	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP028840	Enterococcus faecalis strain FC plasmid unnamed5, complete sequence	5658-5681	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_004959	Lactococcus lactis W-37 plasmid pSRQ900, complete sequence	10801-10824	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_004960	Lactococcus lactis W-1 plasmid pSRQ800, complete sequence	7824-7847	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	CP034583	Lactococcus lactis subsp. lactis strain C10 plasmid pC10C, complete sequence	7347-7370	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014218	Clostridium botulinum strain B515 plasmid pRSJ21_3, complete sequence	46929-46952	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014147	Clostridium botulinum strain CDC_67190 plasmid pNPD12_2, complete sequence	51476-51499	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP034576	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109G, complete sequence	12828-12851	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024179	Moraxella osloensis strain YHS plasmid pYHS3, complete sequence	18566-18589	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_023917	Clostridium perfringens plasmid pCP-OS1 DNA, complete sequence, strain: OS1	18021-18044	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_023918	Clostridium perfringens plasmid pCP-TS1 DNA, complete sequence, strain: TS1	18003-18026	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_016971	Lactococcus garvieae 21881 plasmid pGL4 complete sequence	468-491	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_AP017399	Lactococcus garvieae plasmid pNALG-1 DNA, complete sequence, strain: 122061	1331-1354	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_MF807212	Streptococcus thermophilus strain CS17 plasmid pCS17-A, complete sequence	128-151	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	230643-230666	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	MK448481	Streptococcus satellite phage Javan412, complete genome	7799-7822	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	HQ906665	Wolbachia endosymbiont wVitB of Nasonia vitripennis phage WOVitB segment 1, partial genome	11737-11760	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	MH617073	Microviridae sp. isolate ctcj960, complete genome	1901-1924	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	MH617746	Microviridae sp. isolate ctcg947, complete genome	1893-1916	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	HQ906662	Wolbachia endosymbiont wVitA of Nasonia vitripennis phage WOVitA1, complete sequence	19818-19841	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_014508	Enterococcus faecalis plasmid pEF-01, complete sequence	27478-27501	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP031100	Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence	43368-43391	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024449	Moraxella osloensis strain NP7 plasmid pNP7-6, complete sequence	12033-12056	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	LR134207	Klebsiella aerogenes strain NCTC9667 genome assembly, plasmid: 2	135132-135155	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP031543	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107E, complete sequence	13265-13288	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_023913	Enterococcus faecalis strain CPPF5 plasmid pCPPF5, complete sequence	10192-10215	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024187	Moraxella osloensis strain TT16 plasmid p2, complete sequence	2342-2365	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	HG796412	Uncultured bacterium plasmid pRGI00992	69-92	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_002137	Lactococcus lactis cremoris NIZO B40 plasmid pNZ4000, complete sequence	10542-10565	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014236	Moraxella osloensis strain CCUG 350 plasmid unnamed3, complete sequence	28018-28041	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP043764	Campylobacter jejuni strain BfR-CA-14430 plasmid pBfR-CA-14430, complete sequence	36948-36971	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP007750	Campylobacter jejuni subsp. jejuni M129 plasmid pTet-M129, complete sequence	12512-12535	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP024178	Moraxella osloensis strain YHS plasmid pYHS2, complete sequence	2342-2365	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	779905-779928	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP014901	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-2, complete sequence	4139-4162	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP025421	Streptococcus parauberis strain SPOF3K plasmid unnamed, complete sequence	3901-3924	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP025421	Streptococcus parauberis strain SPOF3K plasmid unnamed, complete sequence	16561-16584	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_MF477836	Macrococcus canis strain KM0218 plasmid pKM0218, complete sequence	58488-58511	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	KX522565	Wolbachia phage WO, complete genome	62885-62908	3	0.875
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	JN638751	Bacillus phage G, complete genome	432819-432842	3	0.875
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	LN681539	Clostridium phage phiCD505, complete genome	38983-39007	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	NC_028996	Clostridium phage phiCDHM19, complete genome	41246-41270	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	LN681542	Clostridium phage phiMMP03, complete genome	40226-40250	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	HG531805	Clostridium phage CDMH1 complete genome	40470-40494	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	NC_009231	Clostridium phage phiC2, complete genome	43763-43787	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	JX145341	Clostridium phage phiMMP02, complete genome	38408-38432	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	LN681541	Clostridium phage phiMMP01, complete genome	36544-36568	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	NC_011398	Clostridium phage phiCD27, complete genome	39233-39257	3	0.88
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	KX228400	Clostridium phage CDKM15, complete genome	40748-40772	3	0.88
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_011781	Borreliella burgdorferi ZS7 plasmid ZS7_lp28-3, complete sequence	20919-20942	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP015111	Acinetobacter sp. TGL-Y2 plasmid unnamed1, complete sequence	24612-24635	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP015807	Borrelia mayonii strain MN14-1539 plasmid lp28-4	28163-28186	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	CP040046	Acinetobacter baumannii strain VB958 plasmid unnamed6, complete sequence	3678-3701	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP015792	Borrelia mayonii strain MN14-1420 plasmid lp28-4, complete sequence	28188-28211	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP040049	Acinetobacter baumannii strain VB1190 plasmid unnamed2, complete sequence	13202-13225	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	MT430910	Streptococcus phage smHBZ8, complete genome	24-47	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_018989	Borrelia burgdorferi 297 plasmid 297_lp28-5, complete sequence	10800-10823	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_018990	Borrelia burgdorferi 297 plasmid 297_lp28-3, complete sequence	5609-5632	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_017406	Borreliella burgdorferi JD1 plasmid JD1 lp28-5, complete sequence	10817-10840	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_017405	Borreliella burgdorferi JD1 plasmid JD1 lp28-3, complete sequence	7584-7607	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_017409	Borreliella burgdorferi JD1 plasmid JD1 lp25, complete sequence	3123-3146	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	597055-597078	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP031402	Borreliella burgdorferi strain MM1 plasmid plsm_lp28-3, complete sequence	6907-6930	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_001853	Borreliella burgdorferi B31 plasmid lp28-3, complete sequence	7580-7603	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP045297	Paenibacillus brasilensis strain KACC 13842 plasmid unnamed1, complete sequence	21316-21339	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_CP017213	Borreliella burgdorferi strain B331 plasmid B331_lp28_3, complete sequence	6230-6253	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NC_021277	Fusobacterium nucleatum subsp. animalis 4_8 plasmid unnamed, complete sequence	9775-9798	4	0.833
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	DQ386162	Streptococcus phage M102AD, complete genome	30595-30618	4	0.833
CP019980_2	2.2\|2465506\|25\|CP019980\|CRT	2465506-2465530	25	MT601271	Bacillus phage vB_BsuM-Goe10, complete genome	118157-118181	5	0.8
CP019980_5	5.1\|4402633\|27\|CP019980\|CRISPRCasFinder	4402633-4402659	27	KY887560	Enterococcus sp. strain BCCO 40_GJ1 plasmid pGJTET1, complete sequence	2877-2903	5	0.815
CP019980_5	5.1\|4402633\|27\|CP019980\|CRISPRCasFinder	4402633-4402659	27	NZ_AP022824	Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence	4281-4307	5	0.815
CP019980_5	5.1\|4402633\|27\|CP019980\|CRISPRCasFinder	4402633-4402659	27	NZ_AP022824	Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence	12721-12747	5	0.815
CP019980_5	5.1\|4402633\|27\|CP019980\|CRISPRCasFinder	4402633-4402659	27	NZ_AP022824	Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence	21161-21187	5	0.815
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	MH622943	Myoviridae sp. isolate ctbc_4, complete genome	109375-109398	7	0.708
CP019980_2	2.1\|2465463\|24\|CP019980\|CRT	2465463-2465486	24	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	911855-911878	9	0.625

1. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP028373 (Campylobacter jejuni subsp. jejuni strain huA17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

2. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP017230 (Campylobacter jejuni strain FORC_046 isolate Not reported plasmid pFORC46.1, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

3. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP010073 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj1, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

4. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP017026 (Campylobacter coli plasmid pCC14983A-1, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

5. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP017877 (Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

6. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 1, identity: 0.958

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaatgtat	Protospacer
***********************.

7. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP031220 (Arcobacter mytili LMG 24559 plasmid pAMYT, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaatgtaa	Protospacer
 **********************

8. spacer 2.1|2465463|24|CP019980|CRT matches to NC_006872 (Clostridium perfringens plasmid pBCNF5603 DNA, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaataaaatgttc	Protospacer
************** ******* *

9. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP054046 (Yersinia massiliensis strain 2011N-4075 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttattaaaaagatgtac	Protospacer
********* *******.******

10. spacer 2.1|2465463|24|CP019980|CRT matches to NC_006128 (Borreliella bavariensis PBi plasmid cp26, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
tttatattttttaaaaaaatttac	Protospacer
*** **************** ***

11. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP013044 (Clostridium perfringens strain JP55 plasmid pJFP55J, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaataaaatgttc	Protospacer
************** ******* *

12. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP029793 (Psychrobacter sp. YP14 plasmid pYP14d, complete sequence) position: , mismatch: 2, identity: 0.917

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttcttaaaaaaatatac	Protospacer
*********.**********.***

13. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
gttttattttttaaaaaaatgaat	Protospacer
 ******************** *.

14. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttttttttttttaacaaaatgtaa	Protospacer
***** ******** ********

15. spacer 2.1|2465463|24|CP019980|CRT matches to NC_031034 (Bacillus phage SalinJah, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttgtaaaaaaatgttg	Protospacer
********** ***********

16. spacer 2.1|2465463|24|CP019980|CRT matches to NC_016042 (Lactococcus lactis subsp. lactis plasmid pKP1, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

17. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP054658 (Lactobacillus reuteri strain AN417 plasmid pAN417A, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaataagtat	Protospacer
***************** * ***.

18. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_KT717888 (Enterococcus faecalis strain 5ZG10E plasmid pE30, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

19. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP030090 (Lactobacillus reuteri strain YSJL-12 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaataagtat	Protospacer
***************** * ***.

20. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP016704 (Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8A, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

21. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP037428 (Myroides odoratimimus strain G13 plasmid pFM-G13, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaataaatatat	Protospacer
*************** ****.**.

22. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP016751 (Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1E, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

23. spacer 2.1|2465463|24|CP019980|CRT matches to NC_015864 (Lactococcus lactis subsp. lactis plasmid pIL7, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

24. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014926 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatattttaaaaaaatgcat	Protospacer
******* *************.*.

25. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024448 (Moraxella osloensis strain NP7 plasmid pNP7-5, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

26. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP032741 (Acinetobacter baumannii strain C25 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac-	CRISPR spacer
gttttattttttaaaaaaat-tgca	Protospacer
 ******************* *.*

27. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014875 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

28. spacer 2.1|2465463|24|CP019980|CRT matches to NC_003383 (Listeria innocua Clip11262 plasmid pLI100, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
attctattttttaaaaaaatatac	Protospacer
 **.****************.***

29. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP013700 (Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttcaaaacaatgtat	Protospacer
***********.**** ******.

30. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP016710 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109D, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

31. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_LR135375 (Enterococcus faecium isolate E8172 plasmid 4) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

32. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP007180 (Campylobacter coli RM5611 plasmid pRM5611_48kb, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaataaggtag	Protospacer
**************** ** ***

33. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024188 (Moraxella osloensis strain TT16 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

34. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP028840 (Enterococcus faecalis strain FC plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

35. spacer 2.1|2465463|24|CP019980|CRT matches to NC_004959 (Lactococcus lactis W-37 plasmid pSRQ900, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

36. spacer 2.1|2465463|24|CP019980|CRT matches to NC_004960 (Lactococcus lactis W-1 plasmid pSRQ800, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

37. spacer 2.1|2465463|24|CP019980|CRT matches to CP034583 (Lactococcus lactis subsp. lactis strain C10 plasmid pC10C, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

38. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014218 (Clostridium botulinum strain B515 plasmid pRSJ21_3, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ctttcatattttaaaaaaatgtac	Protospacer
.***.** ****************

39. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014147 (Clostridium botulinum strain CDC_67190 plasmid pNPD12_2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ctttcatattttaaaaaaatgtac	Protospacer
.***.** ****************

40. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP034576 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109G, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

41. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024179 (Moraxella osloensis strain YHS plasmid pYHS3, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

42. spacer 2.1|2465463|24|CP019980|CRT matches to NC_023917 (Clostridium perfringens plasmid pCP-OS1 DNA, complete sequence, strain: OS1) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaaattat	Protospacer
*******************  **.

43. spacer 2.1|2465463|24|CP019980|CRT matches to NC_023918 (Clostridium perfringens plasmid pCP-TS1 DNA, complete sequence, strain: TS1) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaaaattat	Protospacer
*******************  **.

44. spacer 2.1|2465463|24|CP019980|CRT matches to NC_016971 (Lactococcus garvieae 21881 plasmid pGL4 complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

45. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_AP017399 (Lactococcus garvieae plasmid pNALG-1 DNA, complete sequence, strain: 122061) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

46. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_MF807212 (Streptococcus thermophilus strain CS17 plasmid pCS17-A, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

47. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaagaaaggtat	Protospacer
***************.*** ***.

48. spacer 2.1|2465463|24|CP019980|CRT matches to MK448481 (Streptococcus satellite phage Javan412, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttaaataatgtat	Protospacer
************ *** ******.

49. spacer 2.1|2465463|24|CP019980|CRT matches to HQ906665 (Wolbachia endosymbiont wVitB of Nasonia vitripennis phage WOVitB segment 1, partial genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttattaaaaaactgtag	Protospacer
********* ******** ****

50. spacer 2.1|2465463|24|CP019980|CRT matches to MH617073 (Microviridae sp. isolate ctcj960, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaataatttat	Protospacer
**************** *** **.

51. spacer 2.1|2465463|24|CP019980|CRT matches to MH617746 (Microviridae sp. isolate ctcg947, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttattaaaaaaatttat	Protospacer
********* ********** **.

52. spacer 2.1|2465463|24|CP019980|CRT matches to HQ906662 (Wolbachia endosymbiont wVitA of Nasonia vitripennis phage WOVitA1, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttattaaaaaactgtag	Protospacer
********* ******** ****

53. spacer 2.1|2465463|24|CP019980|CRT matches to NC_014508 (Enterococcus faecalis plasmid pEF-01, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

54. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP031100 (Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ctttcatattttaaaaaaatgtac	Protospacer
.***.** ****************

55. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024449 (Moraxella osloensis strain NP7 plasmid pNP7-6, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

56. spacer 2.1|2465463|24|CP019980|CRT matches to LR134207 (Klebsiella aerogenes strain NCTC9667 genome assembly, plasmid: 2) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatatattaaaaaaatgtaa	Protospacer
******* * *************

57. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP031543 (Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107E, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

58. spacer 2.1|2465463|24|CP019980|CRT matches to NC_023913 (Enterococcus faecalis strain CPPF5 plasmid pCPPF5, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

59. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024187 (Moraxella osloensis strain TT16 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

60. spacer 2.1|2465463|24|CP019980|CRT matches to HG796412 (Uncultured bacterium plasmid pRGI00992) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaaaactttag	Protospacer
****************** * **

61. spacer 2.1|2465463|24|CP019980|CRT matches to NC_002137 (Lactococcus lactis cremoris NIZO B40 plasmid pNZ4000, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

62. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014236 (Moraxella osloensis strain CCUG 350 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

63. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP043764 (Campylobacter jejuni strain BfR-CA-14430 plasmid pBfR-CA-14430, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaataaggtag	Protospacer
**************** ** ***

64. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP007750 (Campylobacter jejuni subsp. jejuni M129 plasmid pTet-M129, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttattttttaaaataaggtag	Protospacer
**************** ** ***

65. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP024178 (Moraxella osloensis strain YHS plasmid pYHS2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
ttgttattttttacaaaaatgtat	Protospacer
** ********** *********.

66. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttaaaaaatgaat	Protospacer
************ ******** *.

67. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP014901 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-2, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

68. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP025421 (Streptococcus parauberis strain SPOF3K plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

69. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP025421 (Streptococcus parauberis strain SPOF3K plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttttcaaaaatgtaa	Protospacer
************  *********

70. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_MF477836 (Macrococcus canis strain KM0218 plasmid pKM0218, complete sequence) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttaaaaaaaatctat	Protospacer
*********** ******** **.

71. spacer 2.1|2465463|24|CP019980|CRT matches to KX522565 (Wolbachia phage WO, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttattaaaaaactgtag	Protospacer
********* ******** ****

72. spacer 2.1|2465463|24|CP019980|CRT matches to JN638751 (Bacillus phage G, complete genome) position: , mismatch: 3, identity: 0.875

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttaaaaaaaatctaa	Protospacer
*********** ******** **

73. spacer 2.2|2465506|25|CP019980|CRT matches to LN681539 (Clostridium phage phiCD505, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

74. spacer 2.2|2465506|25|CP019980|CRT matches to NC_028996 (Clostridium phage phiCDHM19, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

75. spacer 2.2|2465506|25|CP019980|CRT matches to LN681542 (Clostridium phage phiMMP03, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

76. spacer 2.2|2465506|25|CP019980|CRT matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

77. spacer 2.2|2465506|25|CP019980|CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

78. spacer 2.2|2465506|25|CP019980|CRT matches to JX145341 (Clostridium phage phiMMP02, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

79. spacer 2.2|2465506|25|CP019980|CRT matches to LN681541 (Clostridium phage phiMMP01, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

80. spacer 2.2|2465506|25|CP019980|CRT matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

81. spacer 2.2|2465506|25|CP019980|CRT matches to KX228400 (Clostridium phage CDKM15, complete genome) position: , mismatch: 3, identity: 0.88

tttttagcttttgaaattgtgagtt	CRISPR spacer
tttttagcttttggaattgttagtg	Protospacer
*************.****** ***

82. spacer 2.1|2465463|24|CP019980|CRT matches to NC_011781 (Borreliella burgdorferi ZS7 plasmid ZS7_lp28-3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

83. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP015111 (Acinetobacter sp. TGL-Y2 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
ggcttattttttaaaaaaatgttc	Protospacer
  .******************* *

84. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP015807 (Borrelia mayonii strain MN14-1539 plasmid lp28-4) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

85. spacer 2.1|2465463|24|CP019980|CRT matches to CP040046 (Acinetobacter baumannii strain VB958 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
ttttttttttttaaaaaaatgatt	Protospacer
***** ***************  .

86. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP015792 (Borrelia mayonii strain MN14-1420 plasmid lp28-4, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

87. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP040049 (Acinetobacter baumannii strain VB1190 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
ttttttttttttaaaaaaatgatt	Protospacer
***** ***************  .

88. spacer 2.1|2465463|24|CP019980|CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaatattt	Protospacer
 *******************.* .

89. spacer 2.1|2465463|24|CP019980|CRT matches to NC_018989 (Borrelia burgdorferi 297 plasmid 297_lp28-5, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

90. spacer 2.1|2465463|24|CP019980|CRT matches to NC_018990 (Borrelia burgdorferi 297 plasmid 297_lp28-3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

91. spacer 2.1|2465463|24|CP019980|CRT matches to NC_017406 (Borreliella burgdorferi JD1 plasmid JD1 lp28-5, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

92. spacer 2.1|2465463|24|CP019980|CRT matches to NC_017405 (Borreliella burgdorferi JD1 plasmid JD1 lp28-3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

93. spacer 2.1|2465463|24|CP019980|CRT matches to NC_017409 (Borreliella burgdorferi JD1 plasmid JD1 lp25, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

94. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
tttttatttttgaaaaaaatggtt	Protospacer
*********** *********  .

95. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP031402 (Borreliella burgdorferi strain MM1 plasmid plsm_lp28-3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

96. spacer 2.1|2465463|24|CP019980|CRT matches to NC_001853 (Borreliella burgdorferi B31 plasmid lp28-3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

97. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP045297 (Paenibacillus brasilensis strain KACC 13842 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
cttttattttttaaaaatatgtgt	Protospacer
.**************** ****..

98. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_CP017213 (Borreliella burgdorferi strain B331 plasmid B331_lp28_3, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaaa	Protospacer
 *******************. *

99. spacer 2.1|2465463|24|CP019980|CRT matches to NC_021277 (Fusobacterium nucleatum subsp. animalis 4_8 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaataaag	Protospacer
 *******************. *

100. spacer 2.1|2465463|24|CP019980|CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 4, identity: 0.833

tttttattttttaaaaaaatgtac	CRISPR spacer
attttattttttaaaaaaattttt	Protospacer
 ******************* * .

101. spacer 2.2|2465506|25|CP019980|CRT matches to MT601271 (Bacillus phage vB_BsuM-Goe10, complete genome) position: , mismatch: 5, identity: 0.8

tttttagcttttgaaattgtgagtt	CRISPR spacer
attttagcttttgaatttgtgacac	Protospacer
 ************** ******  .

102. spacer 5.1|4402633|27|CP019980|CRISPRCasFinder matches to KY887560 (Enterococcus sp. strain BCCO 40_GJ1 plasmid pGJTET1, complete sequence) position: , mismatch: 5, identity: 0.815

agcaagagccagggaaaggctcttgcg	CRISPR spacer
agggagagccagggaaaggcttttgga	Protospacer
** .*****************.*** .

103. spacer 5.1|4402633|27|CP019980|CRISPRCasFinder matches to NZ_AP022824 (Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence) position: , mismatch: 5, identity: 0.815

agcaagagccagggaaaggctcttgcg	CRISPR spacer
agggagagccagggaaaggcttttgga	Protospacer
** .*****************.*** .

104. spacer 5.1|4402633|27|CP019980|CRISPRCasFinder matches to NZ_AP022824 (Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence) position: , mismatch: 5, identity: 0.815

agcaagagccagggaaaggctcttgcg	CRISPR spacer
agggagagccagggaaaggcttttgga	Protospacer
** .*****************.*** .

105. spacer 5.1|4402633|27|CP019980|CRISPRCasFinder matches to NZ_AP022824 (Enterococcus saigonensis strain VE80 plasmid pVE80-2, complete sequence) position: , mismatch: 5, identity: 0.815

agcaagagccagggaaaggctcttgcg	CRISPR spacer
agggagagccagggaaaggcttttgga	Protospacer
** .*****************.*** .

106. spacer 2.1|2465463|24|CP019980|CRT matches to MH622943 (Myoviridae sp. isolate ctbc_4, complete genome) position: , mismatch: 7, identity: 0.708

tttttattttttaaaaaaatgtac-	CRISPR spacer
-atatatttttttaaaaaattaaaa	Protospacer
  * ******** *******  *

107. spacer 2.1|2465463|24|CP019980|CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 9, identity: 0.625

tttttattttttaaaaaaatgtac-	CRISPR spacer
-ttacattttattaaaaaaaaaaaa	Protospacer
 ** .***** * ****** . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35386 : 46646

Enterococcus_phage(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK94821.1\|35386_35917_-	Rossman fold protein, TIGR00730 family	A0A1G5S9X4	Enterococcus_phage	5.2e-22	38.0
AVK94822.1\|36117_36786_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.1e-24	35.8
AVK94823.1\|36782_37421_-	deoxynucleoside kinase	A0A1G5SAJ8	Enterococcus_phage	3.2e-10	22.9
AVK94824.1\|37802_40214_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.7e-126	40.3
AVK94825.1\|40295_40502_-	copper resistance protein CopZ	NA	NA	NA	NA
AVK94826.1\|40559_40892_-	CsoR family transcriptional regulator	NA	NA	NA	NA
AVK94827.1\|40968_41919_-	cation transporter	NA	NA	NA	NA
AVK94828.1\|41950_42286_-	transcriptional regulator	A0A218MNF3	uncultured_virus	4.7e-05	39.7
AVK98955.1\|42455_42941_+\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
AVK94829.1\|43133_46646_+	peptidase S8	A0A1B0T6A2	Bacillus_phage	1.8e-49	36.9

DBSCAN-SWA_2

595119 : 603664

Bacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK95311.1\|595119_595836_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	9.1e-46	77.0
AVK95312.1\|596148_597123_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	6.9e-89	51.5
AVK95313.1\|597198_597951_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AVK95314.1\|597947_598679_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.7e-19	33.7
AVK95315.1\|598798_599299_+	cysteine methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	3.2e-21	48.7
AVK95316.1\|599392_600688_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	2.8e-69	40.3
AVK95317.1\|600701_601043_-	transcriptional regulator	NA	NA	NA	NA
AVK95318.1\|601354_602824_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	7.2e-114	46.1
AVK95319.1\|602839_603664_+	NAD(+) synthetase	G3MA24	Bacillus_virus	5.9e-73	54.2

DBSCAN-SWA_3

627620 : 636126

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK95336.1\|627620_628916_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.1e-17	24.6
AVK95337.1\|629044_629755_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	6.9e-46	41.5
AVK95338.1\|629757_630006_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AVK95339.1\|630008_630692_+	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
AVK95340.1\|630678_632913_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.6e-157	43.1
AVK95341.1\|632888_634313_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.8e-52	34.6
AVK95342.1\|634501_635557_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.5e-60	43.3
AVK95343.1\|635556_636126_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.2e-21	36.0

DBSCAN-SWA_4

882023 : 946352

Bacillus_phage(20.0%)

tail,portal,integrase,holin,protease,capsid,head,terminase,coat

attL 912968:912983|attR 948035:948050

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK95555.1\|882023_882611_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.3e-55	59.3
AVK95556.1\|883500_884295_+	basic amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AVK95557.1\|884389_885094_+	amino acid ABC transporter permease	NA	NA	NA	NA
AVK95558.1\|885090_885813_+	peptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.9e-33	39.5
AVK95559.1\|885869_886484_-\|coat	spore coat protein	NA	NA	NA	NA
AVK95560.1\|886641_887223_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	3.3e-22	37.9
AVK95561.1\|887222_887981_+	hypothetical protein	NA	NA	NA	NA
AVK95562.1\|887988_888246_-	hypothetical protein	NA	NA	NA	NA
AVK95563.1\|888208_890485_+	S9 family peptidase	NA	NA	NA	NA
AVK95564.1\|890651_890879_+	thioredoxin family protein	NA	NA	NA	NA
AVK95565.1\|891617_892646_+	hypothetical protein	NA	NA	NA	NA
AVK95566.1\|892683_893700_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AVK95567.1\|894121_895306_+	phosphoglycerate kinase	NA	NA	NA	NA
AVK95568.1\|895361_896123_+	triose-phosphate isomerase	NA	NA	NA	NA
AVK95569.1\|896115_897657_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AVK95570.1\|897659_898952_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	5.8e-168	70.1
AVK95571.1\|899210_899438_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AVK95572.1\|899642_900389_+	carboxylesterase	NA	NA	NA	NA
AVK95573.1\|900426_902874_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.9e-83	37.9
AVK95574.1\|902935_903403_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.5e-44	56.9
AVK95575.1\|903672_904212_+	hypothetical protein	NA	NA	NA	NA
AVK95576.1\|904192_905557_+	hypothetical protein	NA	NA	NA	NA
AVK95577.1\|906226_907309_-\|integrase	site-specific integrase	H0UST3	Bacillus_phage	5.3e-98	53.4
AVK95578.1\|907390_907846_-	hypothetical protein	Q0H245	Geobacillus_phage	3.9e-34	50.7
AVK95579.1\|907860_908316_-	transcriptional regulator	A0A0S2SXM8	Bacillus_phage	5.4e-44	65.2
AVK95580.1\|908493_908739_+	transcriptional regulator	A0A0S2SXX9	Bacillus_phage	2.5e-32	83.5
AVK95581.1\|908791_908980_+	transcriptional regulator	NA	NA	NA	NA
AVK95582.1\|909338_909575_+	hypothetical protein	A0A2H4J246	uncultured_Caudovirales_phage	3.1e-11	61.5
AVK95583.1\|909571_909796_+	hypothetical protein	NA	NA	NA	NA
AVK95584.1\|909814_910075_+	hypothetical protein	NA	NA	NA	NA
AVK95585.1\|910086_910344_+	hypothetical protein	A0A2I7SC16	Paenibacillus_phage	4.3e-14	72.0
AVK95586.1\|910356_910620_+	hypothetical protein	A0A0A7S062	Clostridium_phage	6.1e-08	41.5
AVK95587.1\|910860_911331_+	hypothetical protein	NA	NA	NA	NA
AVK95588.1\|911327_912503_+	hypothetical protein	H7BVP9	unidentified_phage	2.8e-100	50.5
AVK95589.1\|912529_913342_+	hypothetical protein	I1TLG4	Bacillus_phage	1.1e-26	39.6
912968:912983	attL	NA	NA	NA	NA
AVK95590.1\|913338_915309_+	hypothetical protein	H7BVQ1	unidentified_phage	9.4e-218	58.4
AVK95591.1\|915321_915747_+	hypothetical protein	NA	NA	NA	NA
AVK98991.1\|915765_918180_+	virulence-associated protein E	A0A1S7FZ15	Listeria_phage	6.6e-189	42.7
AVK95592.1\|918493_918769_+	nuclease	A0A1B0RXC4	Streptococcus_phage	4.9e-16	44.4
AVK95593.1\|918771_920148_+	DEAD/DEAH box helicase	S5MA26	Brevibacillus_phage	3.0e-146	54.3
AVK95594.1\|920161_920692_+	hypothetical protein	S5MNT8	Brevibacillus_phage	3.2e-11	32.0
AVK95595.1\|920913_921834_+	DUF4868 domain-containing protein	Q24LC1	Clostridium_phage	2.3e-65	47.1
AVK95596.1\|921852_922410_+	hypothetical protein	A0A1Q1PW40	Staphylococcus_phage	1.8e-12	26.2
AVK95597.1\|922492_922882_+	hypothetical protein	U3PD10	Staphylococcus_phage	7.0e-08	40.7
AVK95598.1\|922966_923428_+\|terminase	terminase	A0A0A7RUQ4	Clostridium_phage	2.1e-48	64.2
AVK95599.1\|923424_925104_+\|terminase	terminase	A0A0A7RUM0	Clostridium_phage	4.3e-123	43.3
AVK98992.1\|925185_926370_+\|portal	phage portal protein	U3PFW0	Lactobacillus_phage	4.8e-100	48.7
AVK95600.1\|926359_926965_+	peptidase U35	A0A2H4J861	uncultured_Caudovirales_phage	1.3e-64	68.5
AVK95601.1\|926966_928136_+\|capsid	phage capsid protein	F7V9A6	Lactobacillus_virus	5.0e-102	50.6
AVK95602.1\|928319_928610_+	hypothetical protein	F7V9A8	Lactobacillus_virus	1.4e-08	38.9
AVK95603.1\|928619_928949_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AVK95604.1\|928945_929374_+	hypothetical protein	NA	NA	NA	NA
AVK95605.1\|929370_929868_+	hypothetical protein	NA	NA	NA	NA
AVK95606.1\|929871_930930_+\|tail	phage tail sheath protein	A0A0A7S0D2	Clostridium_phage	4.6e-70	44.5
AVK95607.1\|930944_931379_+\|terminase	terminase	A0A0A8WF55	Clostridium_phage	7.7e-16	41.0
AVK95608.1\|931403_931799_+	hypothetical protein	NA	NA	NA	NA
AVK95609.1\|931798_931978_+	hypothetical protein	NA	NA	NA	NA
AVK95610.1\|932008_934132_+	hypothetical protein	A0A0S2SXL7	Bacillus_phage	4.0e-73	44.8
AVK95611.1\|934145_934568_+	hypothetical protein	A0A0N7ACL7	Bacillus_phage	4.6e-05	27.2
AVK95612.1\|934567_935545_+	hypothetical protein	NA	NA	NA	NA
AVK95613.1\|935546_935906_+	hypothetical protein	NA	NA	NA	NA
AVK95614.1\|935905_936352_+	hypothetical protein	NA	NA	NA	NA
AVK95615.1\|936352_937393_+	hypothetical protein	A0A0A7RUN3	Clostridium_phage	1.0e-50	35.2
AVK95616.1\|937389_937737_+	hypothetical protein	A0A1B1INQ1	uncultured_Mediterranean_phage	2.0e-06	34.2
AVK95617.1\|937747_938566_+	hypothetical protein	NA	NA	NA	NA
AVK95618.1\|938565_938898_+	hypothetical protein	NA	NA	NA	NA
AVK95619.1\|938898_939504_+	hypothetical protein	NA	NA	NA	NA
AVK95620.1\|939500_939725_+	hypothetical protein	NA	NA	NA	NA
AVK95621.1\|939968_940268_+	hypothetical protein	NA	NA	NA	NA
AVK95622.1\|940339_940654_+	hypothetical protein	A0A0S2GM64	Bacillus_phage	1.7e-12	41.3
AVK95623.1\|940643_940904_+\|holin	phage holin	A0A1Q1PW49	Staphylococcus_phage	2.4e-20	54.7
AVK95624.1\|940900_941569_+	peptidoglycan L-alanyl-D-glutamate endopeptidase	A0A2D1GQ84	Lysinibacillus_phage	2.5e-58	53.4
AVK95625.1\|941613_942075_-	hypothetical protein	NA	NA	NA	NA
AVK98993.1\|942094_942247_-	hypothetical protein	NA	NA	NA	NA
AVK95626.1\|942709_943201_-	hypothetical protein	NA	NA	NA	NA
AVK95627.1\|943218_943431_-	transcriptional regulator	NA	NA	NA	NA
AVK95628.1\|943801_944692_+	helix-turn-helix domain-containing protein	A0A288WFZ2	Bacillus_phage	6.1e-07	27.1
AVK95629.1\|945188_946352_-\|integrase	site-specific integrase	A5GYP9	Lactococcus_phage	4.6e-55	35.9
948035:948050	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2103716 : 2149274

uncultured_Caudovirales_phage(14.29%)

tail,portal,holin,head,terminase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK99046.1\|2103716_2104133_+\|holin	holin	S6AVT9	Thermus_phage	2.1e-31	55.9
AVK96677.1\|2104129_2104819_+	peptidoglycan L-alanyl-D-glutamate endopeptidase	A0A2D1GQ84	Lysinibacillus_phage	2.0e-50	47.2
AVK99047.1\|2104948_2105137_-	hypothetical protein	NA	NA	NA	NA
AVK99048.1\|2105340_2106345_-	hypothetical protein	A0A1P8BL30	Lactococcus_phage	8.9e-07	32.0
AVK96678.1\|2107125_2108364_-	hypothetical protein	S6C485	Thermus_phage	5.8e-56	37.9
AVK96679.1\|2108332_2108824_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.9e-27	41.9
AVK96680.1\|2108880_2109615_-	hypothetical protein	A0A088F7U1	Mycobacterium_phage	7.6e-56	46.0
AVK96681.1\|2109662_2110835_-	hypothetical protein	NA	NA	NA	NA
AVK96682.1\|2111046_2112150_-	endonuclease	A0A1S5SAB0	Streptococcus_phage	3.4e-100	50.5
AVK96683.1\|2112278_2112641_-	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.1e-19	52.5
AVK96684.1\|2112750_2113122_-	transcriptional regulator	A0A1L2BY72	Clostridium_phage	1.3e-08	39.0
AVK96685.1\|2113211_2113574_-	transcriptional regulator	O03970	Lactobacillus_phage	2.8e-11	52.1
AVK96686.1\|2113734_2113929_+	transcriptional regulator	NA	NA	NA	NA
AVK96687.1\|2114069_2114801_+	hypothetical protein	A0A2I7SCV5	Paenibacillus_phage	2.2e-39	60.4
AVK96688.1\|2114816_2115161_+	hypothetical protein	NA	NA	NA	NA
AVK96689.1\|2115273_2115540_+	transcriptional regulator	S5MNZ7	Brevibacillus_phage	8.4e-13	50.7
AVK96690.1\|2115527_2115755_+	hypothetical protein	NA	NA	NA	NA
AVK96691.1\|2115758_2115950_+	hypothetical protein	NA	NA	NA	NA
AVK96692.1\|2116142_2116367_+	hypothetical protein	NA	NA	NA	NA
AVK96693.1\|2116436_2117366_+	hypothetical protein	A0A0A7RWR9	Clostridium_phage	6.2e-79	46.7
AVK96694.1\|2117368_2118175_+	recombinase RecT	S6AVW6	Thermus_phage	6.2e-59	48.4
AVK96695.1\|2118110_2118341_+	hypothetical protein	A0A290G4G7	Caldibacillus_phage	1.8e-11	59.2
AVK96696.1\|2118384_2118789_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AVK96697.1\|2118915_2119731_+	hypothetical protein	A0A1C8E9B4	Bacillus_phage	8.5e-32	64.3
AVK99049.1\|2119660_2120497_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.6e-49	42.9
AVK96698.1\|2120531_2120867_+	hypothetical protein	NA	NA	NA	NA
AVK96699.1\|2120935_2121127_+	hypothetical protein	NA	NA	NA	NA
AVK96700.1\|2121119_2121344_+	hypothetical protein	A0A2D1GQB9	Lysinibacillus_phage	1.2e-12	58.0
AVK96701.1\|2121325_2121514_+	hypothetical protein	NA	NA	NA	NA
AVK96702.1\|2121756_2122176_-	ATPase	NA	NA	NA	NA
AVK96703.1\|2122294_2122531_-	hypothetical protein	NA	NA	NA	NA
AVK96704.1\|2122614_2122806_-	hypothetical protein	NA	NA	NA	NA
AVK96705.1\|2122944_2123382_+	hypothetical protein	A0A2P1JTX0	Anoxybacillus_phage	3.7e-10	28.6
AVK96706.1\|2123564_2125094_+	hypothetical protein	NA	NA	NA	NA
AVK96707.1\|2125918_2126656_+	hypothetical protein	NA	NA	NA	NA
AVK96708.1\|2126822_2127005_+	DUF2758 domain-containing protein	NA	NA	NA	NA
AVK96709.1\|2127078_2127402_+	hypothetical protein	NA	NA	NA	NA
AVK96710.1\|2127432_2127963_+	transcriptional regulator	A0A1B1P7B5	Bacillus_phage	4.1e-43	50.6
AVK96711.1\|2127959_2128985_+	DNA (cytosine-5-)-methyltransferase	A0A1B1P7C6	Bacillus_phage	3.1e-132	65.5
AVK96712.1\|2129116_2129350_+	hypothetical protein	NA	NA	NA	NA
AVK96713.1\|2129395_2130244_+	hypothetical protein	C9E2I6	Enterococcus_phage	6.8e-24	34.8
AVK96714.1\|2130243_2131452_+\|terminase	terminase	A0A2H4J8B0	uncultured_Caudovirales_phage	3.6e-172	70.5
AVK96715.1\|2131464_2132868_+\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	1.0e-133	52.6
AVK96716.1\|2132864_2133875_+\|head	phage head morphogenesis protein	A0A1Q1PVS0	Bacillus_phage	9.2e-52	41.1
AVK96717.1\|2134096_2134552_+	hypothetical protein	NA	NA	NA	NA
AVK96718.1\|2134836_2135361_+	hypothetical protein	NA	NA	NA	NA
AVK96719.1\|2135541_2136027_+	NUDIX hydrolase	NA	NA	NA	NA
AVK96720.1\|2136192_2136564_-	transcriptional regulator	A0A290GJU0	Caldibacillus_phage	5.4e-18	43.6
AVK96721.1\|2136756_2136966_+	transcriptional regulator	NA	NA	NA	NA
AVK96722.1\|2136962_2137745_+	hypothetical protein	A0A0N7BS22	Escherichia_phage	1.1e-12	37.8
AVK96723.1\|2137891_2138179_+	hypothetical protein	NA	NA	NA	NA
AVK96724.1\|2138462_2139983_+	hypothetical protein	NA	NA	NA	NA
AVK96725.1\|2140276_2140942_+	hypothetical protein	A0A1L2K2N1	Aeribacillus_phage	2.1e-52	53.0
AVK96726.1\|2140971_2141838_+\|coat	P22 coat protein - protein 5 domain protein	A0A1L2JY55	Aeribacillus_phage	1.2e-121	73.7
AVK96727.1\|2142014_2142341_+	hypothetical protein	A0A2H4JHC4	uncultured_Caudovirales_phage	3.4e-08	33.3
AVK96728.1\|2142327_2142651_+	hypothetical protein	NA	NA	NA	NA
AVK96729.1\|2142650_2143076_+	hypothetical protein	Q4ZCE4	Staphylococcus_virus	6.6e-28	44.4
AVK96730.1\|2143072_2143516_+	hypothetical protein	NA	NA	NA	NA
AVK96731.1\|2143558_2144338_+\|tail	phage major tail protein, TP901-1 family	B8QTT6	Erwinia_phage	9.3e-12	54.7
AVK96732.1\|2144398_2144869_+	hypothetical protein	Q4ZBQ7	Staphylococcus_phage	3.4e-17	34.3
AVK96733.1\|2144919_2145213_+	hypothetical protein	NA	NA	NA	NA
AVK96734.1\|2145212_2148362_+	hypothetical protein	Q4ZC60	Staphylococcus_virus	5.6e-47	26.1
AVK96735.1\|2148365_2149274_+	hypothetical protein	A0A0U4B037	Exiguobacterium_phage	2.0e-26	31.7

DBSCAN-SWA_6

4325415 : 4358764

uncultured_Caudovirales_phage(30.77%)

tail,portal,integrase,holin,head,capsid,terminase

attL 4321533:4321592|attR 4358922:4359060

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4321533:4321592	attL	NA	NA	NA	NA
AVK98628.1\|4325415_4325676_-\|holin	phage holin	A0A1Q1PW49	Staphylococcus_phage	2.0e-19	51.2
AVK98629.1\|4325665_4325935_-	hypothetical protein	NA	NA	NA	NA
AVK98630.1\|4326005_4326188_-	hypothetical protein	NA	NA	NA	NA
AVK98631.1\|4326200_4326476_-	hypothetical protein	NA	NA	NA	NA
AVK98632.1\|4326488_4327319_-	hypothetical protein	NA	NA	NA	NA
AVK98633.1\|4327318_4327651_-	hypothetical protein	NA	NA	NA	NA
AVK98634.1\|4327650_4328469_-	hypothetical protein	NA	NA	NA	NA
AVK98635.1\|4328479_4328827_-	hypothetical protein	A0A1B1INQ1	uncultured_Mediterranean_phage	9.0e-07	35.1
AVK98636.1\|4328823_4329864_-	hypothetical protein	A0A0A7RUN3	Clostridium_phage	4.0e-50	34.9
AVK98637.1\|4329864_4330311_-	hypothetical protein	NA	NA	NA	NA
AVK98638.1\|4330310_4330670_-	hypothetical protein	NA	NA	NA	NA
AVK98639.1\|4330670_4331648_-	hypothetical protein	NA	NA	NA	NA
AVK98640.1\|4331647_4332070_-	hypothetical protein	A0A0N7ACL7	Bacillus_phage	2.7e-05	28.1
AVK98641.1\|4332083_4334207_-	hypothetical protein	A0A0S2SXL7	Bacillus_phage	5.2e-73	45.1
AVK98642.1\|4334237_4334417_-	hypothetical protein	NA	NA	NA	NA
AVK98643.1\|4334416_4334812_-	hypothetical protein	NA	NA	NA	NA
AVK98644.1\|4334840_4335275_-\|terminase	terminase	A0A0A8WF55	Clostridium_phage	1.0e-15	41.5
AVK98645.1\|4335291_4336350_-\|tail	phage tail sheath protein	A0A0A7S0D2	Clostridium_phage	2.3e-69	44.2
AVK98646.1\|4336353_4336851_-	hypothetical protein	NA	NA	NA	NA
AVK98647.1\|4336847_4337276_-	hypothetical protein	NA	NA	NA	NA
AVK98648.1\|4337272_4337602_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AVK98649.1\|4337611_4337902_-	hypothetical protein	F7V9A8	Lactobacillus_virus	1.4e-08	38.9
AVK98650.1\|4338086_4339256_-\|capsid	phage capsid protein	F7V9A6	Lactobacillus_virus	6.6e-102	50.6
AVK98651.1\|4339257_4339863_-	peptidase U35	A0A2H4J861	uncultured_Caudovirales_phage	6.9e-63	71.5
AVK98652.1\|4339852_4341106_-\|portal	phage portal protein	U3PFW0	Lactobacillus_phage	3.0e-100	48.7
AVK98653.1\|4341118_4342798_-\|terminase	terminase	A0A0A7RUM0	Clostridium_phage	2.4e-121	42.8
AVK98654.1\|4342794_4343256_-\|terminase	terminase	A0A0A7RUQ4	Clostridium_phage	3.3e-49	64.7
AVK98655.1\|4343340_4343730_-	HNH endonuclease	NA	NA	NA	NA
AVK98656.1\|4343797_4345087_-	hypothetical protein	NA	NA	NA	NA
AVK98657.1\|4345656_4346091_-	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	1.4e-36	57.6
AVK99140.1\|4346444_4348316_-	DNA primase	A0A060ADU2	Enterococcus_phage	1.8e-08	29.0
AVK99141.1\|4348558_4348921_-	hypothetical protein	A0A2H4JBP0	uncultured_Caudovirales_phage	1.4e-31	57.5
AVK98658.1\|4348991_4350710_-	DNA polymerase B	A0A1B1P7M5	Bacillus_phage	3.8e-74	31.8
AVK98659.1\|4350711_4351509_-	hypothetical protein	E5KY11	Escherichia_phage	3.3e-20	44.1
AVK98660.1\|4351505_4352582_-	alpha/beta hydrolase	A0A1B0YEB5	Lactobacillus_phage	1.1e-58	46.3
AVK98661.1\|4352584_4353496_-	endonuclease	A0A2H4JA52	uncultured_Caudovirales_phage	9.9e-05	22.8
AVK98662.1\|4353496_4353796_-	hypothetical protein	NA	NA	NA	NA
AVK98663.1\|4353801_4355010_-	DNA helicase	A0A2H4J064	uncultured_Caudovirales_phage	3.3e-40	30.5
AVK98664.1\|4354999_4355296_-	recombinase RecB	A0A2H4J095	uncultured_Caudovirales_phage	3.8e-14	51.3
AVK98665.1\|4355524_4355788_-	hypothetical protein	NA	NA	NA	NA
AVK98666.1\|4355788_4356019_-	hypothetical protein	A0A2H4J246	uncultured_Caudovirales_phage	4.0e-11	61.5
AVK98667.1\|4356015_4356198_-	excisionase	U5P0W4	Brevibacillus_phage	1.2e-07	48.2
AVK98668.1\|4356215_4356431_-	transcriptional regulator	NA	NA	NA	NA
AVK98669.1\|4356615_4357017_+	hypothetical protein	A0A2H4JDE4	uncultured_Caudovirales_phage	4.6e-15	58.0
AVK98670.1\|4357153_4357372_+	transcriptional regulator	NA	NA	NA	NA
AVK98671.1\|4357570_4358764_+\|integrase	site-specific integrase	S5MNZ2	Brevibacillus_phage	7.0e-75	41.6
4358922:4359060	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4566217 : 4613149

uncultured_Caudovirales_phage(25.58%)

portal,tRNA,integrase,capsid,terminase

attL 4567733:4567751|attR 4610059:4610077

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVK98823.1\|4566217_4567711_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	3.9e-91	39.3
4567733:4567751	attL	NA	NA	NA	NA
AVK98824.1\|4567964_4568615_+	hypothetical protein	NA	NA	NA	NA
AVK98825.1\|4568675_4568954_-	hypothetical protein	NA	NA	NA	NA
AVK98826.1\|4568934_4569303_-	aconitate hydratase	NA	NA	NA	NA
AVK99151.1\|4569295_4569634_-	hypothetical protein	A0A2H4JAP8	uncultured_Caudovirales_phage	6.2e-05	35.9
AVK98827.1\|4569652_4569922_-	hypothetical protein	A0A2I7SCS8	Paenibacillus_phage	1.2e-11	43.2
AVK98828.1\|4570041_4570725_-	XlyB	A0A2H4IZS3	uncultured_Caudovirales_phage	8.3e-81	85.8
AVK98829.1\|4570721_4571195_-	hypothetical protein	A0A2K5B2A2	Erysipelothrix_phage	5.9e-09	32.6
AVK98830.1\|4571421_4571646_-	hypothetical protein	NA	NA	NA	NA
AVK98831.1\|4571642_4572248_-	hypothetical protein	NA	NA	NA	NA
AVK98832.1\|4572248_4572572_-	hypothetical protein	NA	NA	NA	NA
AVK98833.1\|4572587_4573229_-	hypothetical protein	A0A1L2JZ80	Aeribacillus_phage	3.6e-54	50.2
AVK98834.1\|4573221_4574403_-	hypothetical protein	E5DV64	Deep-sea_thermophilic_phage	1.4e-96	49.1
AVK98835.1\|4574389_4574743_-	hypothetical protein	A0A2H4J4S8	uncultured_Caudovirales_phage	6.1e-11	36.2
AVK98836.1\|4574742_4575207_-	hypothetical protein	A0A1L2JY64	Aeribacillus_phage	7.3e-12	30.7
AVK98837.1\|4575203_4576004_-	hypothetical protein	E5DV61	Deep-sea_thermophilic_phage	8.6e-61	45.6
AVK98838.1\|4575996_4576320_-	hypothetical protein	E5DV60	Deep-sea_thermophilic_phage	1.6e-21	53.1
AVK98839.1\|4576322_4576919_-	hypothetical protein	A0A2H4JD33	uncultured_Caudovirales_phage	2.1e-27	38.9
AVK98840.1\|4576922_4579058_-	hypothetical protein	A0A2P1JUK2	Bacillus_phage	3.7e-26	29.9
AVK98841.1\|4579238_4579580_-	hypothetical protein	NA	NA	NA	NA
AVK98842.1\|4579623_4580028_-	DUF3277 domain-containing protein	A0A1L2K2P1	Aeribacillus_phage	4.1e-27	50.0
AVK98843.1\|4580041_4581052_-	hypothetical protein	A0A2H4J8B9	uncultured_Caudovirales_phage	1.1e-81	50.6
AVK98844.1\|4581051_4581558_-	hypothetical protein	NA	NA	NA	NA
AVK98845.1\|4581550_4581898_-	hypothetical protein	NA	NA	NA	NA
AVK98846.1\|4581894_4582404_-	hypothetical protein	A0A2H4J4S5	uncultured_Caudovirales_phage	1.2e-39	49.1
AVK98847.1\|4582407_4582767_-	hypothetical protein	A0A1L2JY52	Aeribacillus_phage	6.6e-05	37.0
AVK98848.1\|4582705_4583011_-	hypothetical protein	NA	NA	NA	NA
AVK99152.1\|4583067_4583988_-\|capsid	major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	3.3e-101	62.0
AVK98849.1\|4584072_4584663_-	hypothetical protein	A0A1L2K2N1	Aeribacillus_phage	2.4e-12	38.8
AVK98850.1\|4584802_4585723_-	hypothetical protein	E5DV54	Deep-sea_thermophilic_phage	3.8e-52	40.8
AVK98851.1\|4585646_4587083_-\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	3.0e-133	53.9
AVK99153.1\|4587093_4588260_-\|terminase	terminase	A0A2H4J8B0	uncultured_Caudovirales_phage	6.0e-180	75.6
AVK98852.1\|4588292_4589081_-	hypothetical protein	A0A2H4J4R0	uncultured_Caudovirales_phage	2.4e-31	36.8
AVK98853.1\|4589391_4589679_-	hypothetical protein	A0A1X9HVT2	Ruegeria_phage	5.5e-18	50.0
AVK98854.1\|4590599_4591370_-	hypothetical protein	A0A0A7S0U2	Clostridium_phage	3.6e-16	29.0
AVK98855.1\|4591371_4591665_-	hypothetical protein	NA	NA	NA	NA
AVK98856.1\|4591648_4592785_-	hypothetical protein	NA	NA	NA	NA
AVK98857.1\|4592921_4593335_-	hypothetical protein	A0A290FZR5	Caldibacillus_phage	9.3e-27	48.4
AVK98858.1\|4593635_4593848_-	hypothetical protein	NA	NA	NA	NA
AVK98859.1\|4594042_4594297_-	hypothetical protein	NA	NA	NA	NA
AVK98860.1\|4594281_4594704_-	hypothetical protein	S6B1L9	Thermus_phage	7.5e-32	51.1
AVK98861.1\|4594700_4595351_-	hypothetical protein	NA	NA	NA	NA
AVK98862.1\|4595428_4595668_-	hypothetical protein	NA	NA	NA	NA
AVK98863.1\|4595701_4595881_-	hypothetical protein	NA	NA	NA	NA
AVK98864.1\|4595903_4596413_-	single-stranded DNA-binding protein	A0A059T5E0	Listeria_phage	7.4e-42	51.7
AVK98865.1\|4596409_4596685_-	hypothetical protein	NA	NA	NA	NA
AVK98866.1\|4596681_4596978_-	hypothetical protein	R4JMS5	Bacillus_phage	1.6e-17	55.7
AVK98867.1\|4597057_4597246_-	hypothetical protein	NA	NA	NA	NA
AVK98868.1\|4597238_4597664_-	hypothetical protein	NA	NA	NA	NA
AVK98869.1\|4597670_4598228_-	hypothetical protein	A0A0A7AR03	Bacillus_phage	6.2e-10	55.2
AVK98870.1\|4598244_4598430_-	hypothetical protein	NA	NA	NA	NA
AVK98871.1\|4598465_4599284_-	hypothetical protein	A6XMI1	Bacillus_virus	5.2e-45	43.9
AVK98872.1\|4599219_4600011_-	hypothetical protein	A0A1C8E9B4	Bacillus_phage	1.9e-28	60.8
AVK98873.1\|4600026_4600395_-	hypothetical protein	A0A2H4J4P5	uncultured_Caudovirales_phage	2.5e-15	48.8
AVK98874.1\|4600444_4600972_-	hypothetical protein	NA	NA	NA	NA
AVK98875.1\|4601027_4601231_-	XRE family transcriptional regulator	NA	NA	NA	NA
AVK98876.1\|4601406_4602219_-	recombinase RecT	S6AVW6	Thermus_phage	1.5e-52	45.3
AVK98877.1\|4602221_4602401_-	hypothetical protein	NA	NA	NA	NA
AVK98878.1\|4602403_4603345_-	hypothetical protein	A8ATY5	Listeria_phage	3.0e-81	50.8
AVK98879.1\|4603414_4603693_-	hypothetical protein	A0A2D1GQ57	Lysinibacillus_phage	9.3e-15	57.7
AVK98880.1\|4603704_4604010_-	hypothetical protein	NA	NA	NA	NA
AVK98881.1\|4604296_4604548_-	hypothetical protein	NA	NA	NA	NA
AVK98882.1\|4604544_4605063_-	transcriptional regulator	NA	NA	NA	NA
AVK98883.1\|4605229_4605526_-	hypothetical protein	A0A0B5CYM2	Listeria_phage	2.8e-09	45.9
AVK98884.1\|4605548_4605788_-	hypothetical protein	NA	NA	NA	NA
AVK98885.1\|4605787_4606543_-	hypothetical protein	A0A2I7SDG8	Paenibacillus_phage	1.4e-44	44.6
AVK98886.1\|4606613_4606859_-	hypothetical protein	NA	NA	NA	NA
AVK98887.1\|4606909_4607215_+	hypothetical protein	S6B1N1	Thermus_phage	2.4e-11	39.4
AVK98888.1\|4607411_4607633_-	transcriptional regulator	NA	NA	NA	NA
AVK98889.1\|4607797_4608262_+	transcriptional regulator	Q786F1	Bacillus_phage	3.0e-18	38.2
AVK98890.1\|4608287_4608728_+	ImmA/IrrE family metallo-endopeptidase	S6B1N5	Thermus_phage	8.9e-28	47.5
AVK98891.1\|4608772_4609972_+\|integrase	site-specific integrase	S6C485	Thermus_phage	2.9e-81	42.9
AVK98892.1\|4610261_4611302_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
4610059:4610077	attR	NA	NA	NA	NA
AVK98893.1\|4611408_4611930_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AVK98894.1\|4611929_4612295_-	dihydroneopterin aldolase	NA	NA	NA	NA
AVK98895.1\|4612294_4613149_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.1e-24	30.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP019980

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection