CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	1 crisprs	NA	1	1	0	0
CP020023	Bacillus subtilis strain ATCC 21228 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	0	1	14	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020024_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020024_1

20196-20364

Orphan

Consensus_repeat	Method
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP020024_1

>merge|CP020024|1|20196-20364|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGGTGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCGAACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

>CP020024|1|1|20196-20364|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	TGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCG
AACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP020024.1\|AVL07000.1\|13680_13971_-\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07003.1\|15681_16323_+\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07004.1\|16457_16790_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370161
CP020024.1\|AVL07010.1\|21876_22149_+\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07001.1\|13967_14420_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227664
CP020024.1\|AVL07014.1\|25417_26524_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220
CP020024.1\|AVL07017.1\|28808_29981_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240271
CP020024.1\|AVL07006.1\|19160_19778_-\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07002.1\|14728_14959_+\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07008.1\|20492_21119_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377417
CP020024.1\|AVL07005.1\|16782_18048_+\|UV-damage-repair-protein-UvrX	unknown	unknown	gnl\|CDD\|235104
CP020024.1\|AVL07015.1\|26825_27311_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
CP020024.1\|AVL07011.1\|22441_22846_-\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL06998.1\|12803_13106_+\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07012.1\|22856_24032_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212669
CP020024.1\|AVL06999.1\|13396_13651_-\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07088.1\|18977_19124_+\|phage-coat-protein	unknown	unknown	unknown
CP020024.1\|AVL07016.1\|27906_28425_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
CP020024.1\|AVL07009.1\|21151_21541_-\|hypothetical-protein	unknown	unknown	unknown
CP020024.1\|AVL07013.1\|24697_24946_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP020024.1\|AVL07008.1\|20492_21119_-\|hypothetical-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	5.85001e-26
CP020024.1\|AVL07012.1\|22856_24032_-\|hypothetical-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	1.37571e-19
CP020024.1\|AVL07016.1\|27906_28425_+\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	0.00149194
CP020024.1\|AVL07004.1\|16457_16790_+\|hypothetical-protein	gnl\|CDD\|370161	pfam08863, YolD, YolD-like protein. Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily.	9.89407e-18
CP020024.1\|AVL07001.1\|13967_14420_-\|hypothetical-protein	gnl\|CDD\|227664	COG5371, COG5371, Golgi nucleoside diphosphatase [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones].	0.00285974
CP020024.1\|AVL07014.1\|25417_26524_+\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.62343e-11
CP020024.1\|AVL07017.1\|28808_29981_+\|hypothetical-protein	gnl\|CDD\|240271	PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional.	1.08138e-09
CP020024.1\|AVL07005.1\|16782_18048_+\|UV-damage-repair-protein-UvrX	gnl\|CDD\|235104	PRK03103, PRK03103, DNA polymerase IV; Reviewed.	6.39022e-135
CP020024.1\|AVL07015.1\|26825_27311_-\|transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.84971e-09

>CP020024.1|AVL07006.1|19160_19778_-|hypothetical-protein
MKANFKYWSIAAVLGISLFDFMGTSKVEAAEVKESLPIEEKILSQDEIEAKKEEIASQIKIFDENNKEIHPYTTEQLKSMIRLTEEQPTDNPIKVLKKTYSSGYFDFYYNIWLGKGTYGKTFKDPSTLIVTYKGTARKFSVSAFYDDGRGGAKGRAQKVTLPGGWKGQFHMNWNLKKGKSYHIKFENEGNTDKLITINQATLWYN
>CP020024.1|AVL07088.1|18977_19124_+|phage-coat-protein
MDQTKSESKLREYLDDNLSEEAKKKYEIYIFKEDIDKLKQEHQKSLQE
>CP020024.1|AVL07005.1|16782_18048_+|UV-damage-repair-protein-UvrX
MIDYDSLPKRTFLTVDMRSFYASASAVMLGLDPMKCYLAVVGDTERSGSVVLAASPALKKRFGIKTGSRLYEIPDHPQIHIVNPQMRMFIKLSTNITHLFYQFASPEDILTYSVDESIIRFDFLKRLWGTPMDLAKRIQNAIYRDFGVPATVGIGPNMLMSKLALDLEAKKSPSGIAEWTYEDVQTKLWPVHPLSKMWGIGRRMERNLNRMGIATVGQLANYPLELLENRFGIMGNQIYYHAHGVDLSELGTPIRQEQISFGKSQILLRDYNEEAEIKSVILEMCEEVASRARKAKKAGRTIHLGVGYSQTVGGGGFHRSLTIDQPTNITMKLYKACIALFKKFYQGQTVRSLSVTLGNVVDDNQFQMSLFEENSEKERQLGHVMDSIREKYGSDAILRAISYTTAGTALKRAKLVGGHQA
>CP020024.1|AVL07004.1|16457_16790_+|hypothetical-protein
MKWATSMMLPEHNEMLKQLNLEMEKMKRPENDEQKIEAMALIINEAKQGNQLLSISYFENGHISSLTGFVRSFKYIEREMLIKTNEGHIKAVSVDDLIEVELAEGEKFYD
>CP020024.1|AVL07003.1|15681_16323_+|hypothetical-protein
MKNIKHIKKMRNSILFSVVWRLLFLVLYPVILGAGLPLIGLNLPSATLFILSFIGCMMVCLTIATHISNLVNIREVLKQYASIERELVGTYSIDAKVLDDMLDNTMKKYHHQRSFDRDYNLADLHAIEELVQEERNGKYFDKYLAHDDSIKDEIRMAVVPKRVAEDLLYSVFNSKTTFGITGRKYYHKWHMARLDEQLLPFLQEKQEKMHKTN
>CP020024.1|AVL07002.1|14728_14959_+|hypothetical-protein
MAGQKQKRRLKKRFNHAGACRQSFCGNATGVTGAFLLLLNLCPRSLVKKWPGTMQLLLRDPPQAIRKLTDACYRAF
>CP020024.1|AVL07001.1|13967_14420_-|hypothetical-protein
MFFTSIVWHKEDLKSALESKGFLGTEKNIEACITNGFEQTLKERSVEEGWTILDDLIGSIESQLDKTQSKAYCSFWTYKASANEYPETQVRFCVYEDWLEEVLNRRFTDIPDISTFTSEYTYDQTKLIFEIATENKSESGLTILKEDEGE
>CP020024.1|AVL07000.1|13680_13971_-|hypothetical-protein
MNMNAAQAIQRKIKKEHVTPTKESLLKSIRESKYTTISKLLKYGDSNKVMTHIAELESQGEIIVFDDKIIAVSPRISLSLIGLLFFGTVIFGNLIA
>CP020024.1|AVL06999.1|13396_13651_-|hypothetical-protein
MILVRLDNSVTIYKPITADSGRIISSRYKDLPAHLEAASEIKVDYPFGMKKRLRYVEKLGFRLKETLHFDDTAPYSRNRQIWSK
>CP020024.1|AVL06998.1|12803_13106_+|hypothetical-protein
MAGQKQKRRLKKDLIMPAAAGILFAEMRPGLYGSLSAFFDLPSSFTREEMTRNNAAVASGSAAGNPEAYRCMLSGILEGSEMPRNVGRRFWPAYSPGADP
>CP020024.1|AVL07008.1|20492_21119_-|hypothetical-protein
MLLNSFIIPYVVYAYVLFVVYRLFAVFVQKKPRYTIEKSIYILATFVYLTGVICMTLFPIPTDPLLIHDRAAEGFQETNNLIPFNTMKDALTGSSLSVTVYQLGGNIILLFPLGCFLPLLFNRMRQAKRVIIAGFIASLIIETSQFTISSAIGLTYRSFDVDDLILNTLGSALGYLFYKFVYPMVRQELFEVDSTNKTSRKQKVRKHI
>CP020024.1|AVL07009.1|21151_21541_-|hypothetical-protein
MKKIKKVLVSSALSFTLLLPVTAPAALAASKHDFWFEFKHQVTSKTYSRGASNIKIYTHADTGGSGGTFNIELYRKQKKGKAKYLGSKKFSQNGSTTNSYGNKTKGKFYFIMKKKNNGASTGGYGDIYN
>CP020024.1|AVL07010.1|21876_22149_+|hypothetical-protein
MKKKTTNQVEERKVRSDKKTRVNPSLDANTHEKLKKLAISCDMTKTQLAAEILKMALNNESVIDWYQKKYNKDDSYRIILARINGELHYS
>CP020024.1|AVL07011.1|22441_22846_-|hypothetical-protein
MGKNKRIPLFNVRTTQMSDEMYDFVLEQISTFSKGKSKGTFREYAFQLIERDMQQQKEEQQNREKDRHVHDELIAMREEMKKEFRDLRKKIDQGSIYVEHKTADPKSASETIEEGQLITEKITGTIEEEYDYDF
>CP020024.1|AVL07012.1|22856_24032_-|hypothetical-protein
MNISRMNVDFGNSMYMNLIDGYFFELPTNVVEISKEAAEGKFTSIVEDPADLKDRLLVSTVIDETERYFLVGELAEPEVLGNQHIKKLHNKVESHIPYVTFLAATAYYQALKGKREDNEVTIEYFQTMLPIWLLKKLDKFSEMQKRMASKFLGTHQVKVLTLGLEKELTIKVEDAACRIESEVARWAIKKNFDLEDKDYAEQFKNYDVVFCDLGGGTDDLVLLPAGLKPPKSRDSFVSNTEAPFLAHLEKLRKEKLLEHFDSVRELEKFIYSNIGKTKMERRDGNTGQKFDLTDIIKKSLKEYTEIKIAQAENTFPAPKDKVYKYLYFGGVGEVLEESISVVTEERYGRDISESNHIVAEDARLLNLYGLEVLSRAEQVKKQANEKEAQSI
>CP020024.1|AVL07013.1|24697_24946_+|hypothetical-protein
MARTAINGPENVDKPLGCLAHYGAGNYGQASMQRHTIECDRVREHETNPIEVAYRTSIVCKKVMAGESLAIARQSWKPQTSL
>CP020024.1|AVL07014.1|25417_26524_+|hypothetical-protein
MLSKVKKVPSPYVGNLLNKWHDYIMQEKVHESIEKRTEIKQLLSQAEDNKDLVDYFILLDHRHSLCFDQEASMGDVVNMLSKGSHDLLINFYFELFAGDYEFFKKNYVKAISFYEKAEQKLSSIPNIEETKFAEFHYKIGVAYYEIDQHLVSVNKVTKARDIYKKSDMWNLEAIQCSLVVGINLYDMGRLDDADAYFRDALTEALDHGYDKPITKIYHNLGLVHWQKGSLELALHYFREAYSHEWLRDSPKGQQTVYMLSRVLYTMGQNEEAYHWYELGIEMARKFDDHEYKAKHDILYHLYEQPSIDEVKQSLAFLEERNLWPDVSKIAKGISELYEKKGDLVTSHEFLKRAFYAKEQIQRITEALG
>CP020024.1|AVL07015.1|26825_27311_-|transcriptional-regulator
MGNREQFDLSKYLLEKRKQKGLSQTQVANDTGLSSAYISMLEKGERKRPTQAVIKKLATALSIPNIEMLQIMEYIASMEEDHVKEKDKDTSKQIKLFDLTGLTEASINQIQNQIDQLKSSENNSVIRFFDVTGLSEKDIERVKEEIELLKIRNEYMKLKKD
>CP020024.1|AVL07016.1|27906_28425_+|hypothetical-protein
MAKVKLLEKKMTEKDVLEYGSSLRLFDGSTHVLIGKDCLHTHTKNKRPISQCYSDIRNVKNVEGVIVGKRVSPHSSLLFTTEAFQPARKVTQVYKAPKMPRRSTQVRPRNTSGRAKKVSVLLSETGYANVHQLKQVLLDAGAKKVQTYNTSRGIAIVCHPNPNYLLQKVISE
>CP020024.1|AVL07017.1|28808_29981_+|hypothetical-protein
MRKKLAAGIVAGAIILGVPGYTIFHSYQANAEEARVLDNATDAVNSLYASKKYNYLADGVSKNDIQKAQKLVSDVADSKKQKSLAEKASNAAIMLEASNAVKEDIVDGVIVDDLTKSILSVTKESVDKVKPISKDLYKDLSKDLSKAYDQIEQIDKTKKLLKDAKKDWNSYKKIEKEVNKISNQTAKKSLKKQLETLKKRIEDQESISKKAKEKLNEIEKTSQKDSDSKAANDSSQVSTNDNENATSSAASSNTSATQNKSGSSSNSSSSSGSSNSGYSSYSNGSSKSSSNTKSYSNSSSSRSYTSKSNSGSTSHSESKKSRTGSSSAGSSNKSSSSKSSSSTSKSKQSQNNTMKNANDFVNDFNSGNYNHVGSGNNGTGNNYDVYERGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	CP020024.1	84850-84908	0	1.0

1. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to position: 84850-84908, mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP018185	Bacillus subtilis strain KH2 plasmid, complete sequence	60755-60813	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP017764	Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence	37952-38010	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP032868	Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence	33414-33472	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP032864	Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence	47417-47475	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP032866	Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence	31651-31709	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	5175-5233	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	71103-71161	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP041370	Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence	57654-57712	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	20251-20309	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	84850-84908	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP032862	Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence	1870-1928	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NC_015148	Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335	60682-60740	1.0
CP020024_1	1.1\|20251\|59\|CP020024\|CRISPRCasFinder	20251-20309	59	NZ_CP014473	Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence	60682-60740	1.0

1. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP018185 (Bacillus subtilis strain KH2 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

2. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP017764 (Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

3. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP032868 (Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

4. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP032864 (Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

5. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP032866 (Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

6. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

7. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

8. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP041370 (Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

9. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

10. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

11. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP032862 (Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

12. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NC_015148 (Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

13. spacer 1.1|20251|59|CP020024|CRISPRCasFinder matches to NZ_CP014473 (Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020023_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020023_1

1107631-1107738

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP020023_1

>merge|CP020023|1|1107631-1107738|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP020023|1|1|1107631-1107738|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP020023.1\|AVL06863.1\|1119248_1120457_-\|alcohol-dehydrogenase-EutG	unknown	unknown	gnl\|CDD\|341481
CP020023.1\|AVL03991.1\|1103997_1105140_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP020023.1\|AVL03987.1\|1098610_1099078_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226007
CP020023.1\|AVL03995.1\|1115846_1117376_-\|flotillin	unknown	unknown	gnl\|CDD\|225177
CP020023.1\|AVL03985.1\|1096134_1097268_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|340831
CP020023.1\|AVL03997.1\|1118582_1119161_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP020023.1\|AVL03998.1\|1120473_1121946_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP020023.1\|AVL03989.1\|1101491_1102946_-\|starch-synthase	unknown	unknown	gnl\|CDD\|234809
CP020023.1\|AVL03988.1\|1099108_1101505_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP020023.1\|AVL03993.1\|1114687_1115266_+\|thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP020023.1\|AVL03990.1\|1102942_1103974_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|273966
CP020023.1\|AVL03986.1\|1097457_1098531_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP020023.1\|AVL04000.1\|1122883_1123429_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP020023.1\|AVL03992.1\|1105136_1107020_-\|glycogen-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP020023.1\|AVL06862.1\|1117396_1117921_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP020023.1\|AVL03984.1\|1095064_1096120_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP020023.1\|AVL03983.1\|1094634_1095063_-\|hypothetical-protein	unknown	unknown	unknown
CP020023.1\|AVL03994.1\|1115307_1115829_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP020023.1\|AVL03999.1\|1122144_1122687_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP020023.1\|AVL03996.1\|1118088_1118577_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378981

Protein	Function_ID	Function_description	E-value
CP020023.1\|AVL03991.1\|1103997_1105140_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP020023.1\|AVL03987.1\|1098610_1099078_+\|hypothetical-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	2.06085e-39
CP020023.1\|AVL03995.1\|1115846_1117376_-\|flotillin	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.34239e-122
CP020023.1\|AVL03985.1\|1096134_1097268_-\|glycosyl-transferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.38164e-74
CP020023.1\|AVL03997.1\|1118582_1119161_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	4.89511e-05
CP020023.1\|AVL03998.1\|1120473_1121946_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP020023.1\|AVL03989.1\|1101491_1102946_-\|starch-synthase	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP020023.1\|AVL03988.1\|1099108_1101505_-\|glycogen-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP020023.1\|AVL03993.1\|1114687_1115266_+\|thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
CP020023.1\|AVL03990.1\|1102942_1103974_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP020023.1\|AVL03986.1\|1097457_1098531_+\|spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	4.64632e-132
CP020023.1\|AVL04000.1\|1122883_1123429_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP020023.1\|AVL03992.1\|1105136_1107020_-\|glycogen-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP020023.1\|AVL06862.1\|1117396_1117921_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000254791
CP020023.1\|AVL03984.1\|1095064_1096120_-\|spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9211e-130
CP020023.1\|AVL06863.1\|1119248_1120457_-\|alcohol-dehydrogenase-EutG	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP020023.1\|AVL03994.1\|1115307_1115829_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.65478e-10
CP020023.1\|AVL03999.1\|1122144_1122687_+\|transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP020023.1\|AVL03996.1\|1118088_1118577_+\|hypothetical-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.35984e-17

>CP020023.1|AVL03992.1|1105136_1107020_-|glycogen-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYIELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPYVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP020023.1|AVL03991.1|1103997_1105140_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP020023.1|AVL03990.1|1102942_1103974_-|glucose-1-phosphate-adenylyltransferase
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>CP020023.1|AVL03989.1|1101491_1102946_-|starch-synthase
MKILLAVSECTPFVKSGGLADVAGALPKALARLGNAVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAYFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNSFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALAFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP020023.1|AVL03988.1|1099108_1101505_-|glycogen-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSVKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKEVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFTASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP020023.1|AVL03987.1|1098610_1099078_+|hypothetical-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSVTAIGIIWATLFALISLSAAIVYAAFSFKGAKSFRFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYNRAASYLLLPYYLWSAFATFLSFTINSMNL
>CP020023.1|AVL03986.1|1097457_1098531_+|spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGALCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>CP020023.1|AVL03985.1|1096134_1097268_-|glycosyl-transferase
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKKAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>CP020023.1|AVL03984.1|1095064_1096120_-|spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEQGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEGSKDSFLDNLPELYKKIKAYREAN
>CP020023.1|AVL03983.1|1094634_1095063_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSIPAEKGEEEKHLDMGSIRELPHINASKEYQEETKEKETDHKIVDDEEETKFETTPEPEEERDSKRSAPPYEEEDEEEPDVAEEARVEIIILPSESKPAPWFSQTVKRKA
>CP020023.1|AVL03993.1|1114687_1115266_+|thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP020023.1|AVL03994.1|1115307_1115829_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP020023.1|AVL03995.1|1115846_1117376_-|flotillin
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP020023.1|AVL06862.1|1117396_1117921_-|hypothetical-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP020023.1|AVL03996.1|1118088_1118577_+|hypothetical-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKSLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP020023.1|AVL03997.1|1118582_1119161_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIAETESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP020023.1|AVL06863.1|1119248_1120457_-|alcohol-dehydrogenase-EutG
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP020023.1|AVL03998.1|1120473_1121946_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIVSSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP020023.1|AVL03999.1|1122144_1122687_+|transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP020023.1|AVL04000.1|1122883_1123429_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP020023_1	1.1\|1107655\|60\|CP020023\|CRISPRCasFinder	1107655-1107714	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 1.1|1107655|60|CP020023|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6905 : 53217

Bacillus_phage(62.5%)

protease,coat,holin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL02931.1\|6905_8483_+	hypothetical protein	M4ZSB3	Bacillus_phage	4.2e-261	85.1
AVL02932.1\|8519_9641_+	hypothetical protein	M4ZRP1	Bacillus_phage	9.8e-196	92.5
AVL02933.1\|9656_9956_+	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
AVL02934.1\|9952_10123_+	hypothetical protein	NA	NA	NA	NA
AVL02935.1\|10174_10387_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
AVL02936.1\|10401_10665_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
AVL02937.1\|10720_11698_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.0e-64	71.4
AVL06807.1\|12225_13989_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3
AVL06808.1\|14158_14230_+	hypothetical protein	NA	NA	NA	NA
AVL02938.1\|14245_15331_-	DUF4917 domain-containing protein	NA	NA	NA	NA
AVL02939.1\|15367_15568_-	hypothetical protein	NA	NA	NA	NA
AVL02940.1\|16164_16455_+	hypothetical protein	NA	NA	NA	NA
AVL02941.1\|16693_17185_+	hypothetical protein	NA	NA	NA	NA
AVL02942.1\|17365_18217_+	toxin	O64021	Bacillus_phage	1.4e-85	60.3
AVL02943.1\|18515_18767_+	hypothetical protein	NA	NA	NA	NA
AVL06809.1\|18950_19385_+	hypothetical protein	NA	NA	NA	NA
AVL02944.1\|20427_21186_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
AVL02945.1\|21182_22745_-\|transposase	transposase	NA	NA	NA	NA
AVL02946.1\|24043_24943_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVL02947.1\|25020_25401_+	hypothetical protein	NA	NA	NA	NA
AVL02948.1\|25942_26173_+	XRE family transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
AVL06810.1\|27075_27258_+	hypothetical protein	NA	NA	NA	NA
AVL02949.1\|27684_27849_+	hypothetical protein	NA	NA	NA	NA
AVL02950.1\|27988_28459_+	hypothetical protein	NA	NA	NA	NA
AVL02951.1\|29255_30647_+	MFS transporter	NA	NA	NA	NA
AVL02952.1\|30719_31037_+\|transposase	transposase	NA	NA	NA	NA
AVL02953.1\|31225_31948_+\|transposase	transposase	A0A1B3AZE5	Gordonia_phage	2.7e-05	24.4
AVL02954.1\|32086_33688_+	glycoside hydrolase 43 family protein	NA	NA	NA	NA
AVL02955.1\|33825_34980_-	XylR family transcriptional regulator	NA	NA	NA	NA
AVL02956.1\|35217_36555_+	xylose isomerase	NA	NA	NA	NA
AVL02957.1\|36705_38205_+	xylulokinase	NA	NA	NA	NA
AVL02958.1\|38689_39937_+\|transposase	IS256 family transposase ISBsu2	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AVL02959.1\|40066_40702_-	endonuclease	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
AVL02960.1\|41114_42530_+	MFS transporter	NA	NA	NA	NA
AVL02961.1\|42631_43816_-	alanine racemase 2	NA	NA	NA	NA
AVL02962.1\|44226_44652_-	endonuclease	NA	NA	NA	NA
AVL02963.1\|45570_46005_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
AVL02964.1\|46605_46869_-	hypothetical protein	NA	NA	NA	NA
AVL02965.1\|46920_47145_+	hypothetical protein	NA	NA	NA	NA
AVL02966.1\|47714_48554_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
AVL02967.1\|48676_48889_-	hypothetical protein	NA	NA	NA	NA
AVL02968.1\|49006_49756_-	hypothetical protein	NA	NA	NA	NA
AVL02969.1\|49885_50242_-	hypothetical protein	NA	NA	NA	NA
AVL02970.1\|50487_50688_-\|coat	spore coat protein C	NA	NA	NA	NA
AVL02971.1\|50862_51051_-	protein translocase TatA	NA	NA	NA	NA
AVL02972.1\|51304_51703_+	hypothetical protein	NA	NA	NA	NA
AVL02973.1\|51864_53217_+\|transposase	IS5/IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

DBSCAN-SWA_2

161726 : 170858

Bacillus_phage(85.71%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL03068.1\|161726_162974_+\|transposase	IS256 family transposase ISBsu2	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AVL03069.1\|165180_165540_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
AVL03070.1\|166171_166705_-	GNAT family N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
AVL03071.1\|166764_167319_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
AVL03072.1\|167374_167833_-	SMI1 / KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
AVL03073.1\|167925_168384_-	antitoxin YobK	NA	NA	NA	NA
AVL03074.1\|168393_170196_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
AVL03075.1\|170294_170858_-	hypothetical protein	O64022	Bacillus_phage	2.0e-101	95.1

DBSCAN-SWA_3

384857 : 390952

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL03301.1\|384857_385451_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
AVL06828.1\|385440_386196_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
AVL03302.1\|386475_387000_+	hypothetical protein	NA	NA	NA	NA
AVL03303.1\|387013_387388_-	protein RibT	NA	NA	NA	NA
AVL03304.1\|387500_387965_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AVL03305.1\|387997_389194_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
AVL03306.1\|389208_389856_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
AVL03307.1\|389866_390952_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1

DBSCAN-SWA_4

1416607 : 1440629

Bacillus_phage(100.0%)

portal,tail,holin,capsid,head,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL04276.1\|1416607_1418191_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7
AVL04277.1\|1418205_1418595_+	hypothetical protein	NA	NA	NA	NA
AVL04278.1\|1418784_1419540_+	hypothetical protein	NA	NA	NA	NA
AVL04279.1\|1419579_1420521_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
AVL04280.1\|1420562_1420985_-\|holin	holin	D6R405	Bacillus_phage	3.0e-57	85.7
AVL04281.1\|1421038_1421209_-	hypothetical protein	NA	NA	NA	NA
AVL04282.1\|1421205_1421505_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
AVL04283.1\|1421520_1422744_-	hypothetical protein	M4ZRP1	Bacillus_phage	6.5e-177	79.9
AVL04284.1\|1422780_1424355_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-264	88.7
AVL04285.1\|1424391_1426098_-	alkaline phosphatase	D6R400	Bacillus_phage	9.4e-267	81.8
AVL04286.1\|1426109_1426949_-\|tail	phage tail protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
AVL04287.1\|1426948_1430827_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
AVL04288.1\|1430839_1431019_-	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
AVL04289.1\|1431021_1431360_-	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
AVL04290.1\|1431414_1432026_-\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
AVL04291.1\|1432026_1432407_-	hypothetical protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
AVL04292.1\|1432403_1432787_-	hypothetical protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
AVL04293.1\|1432779_1433151_-\|head,tail	phage head-tail adapter protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
AVL04294.1\|1433083_1433431_-	DNA-packaging protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
AVL04295.1\|1433446_1433938_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
AVL04296.1\|1433966_1434281_-	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
AVL04297.1\|1434296_1435499_-\|capsid	capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
AVL04298.1\|1435535_1436162_-	peptidase U35	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
AVL04299.1\|1436151_1437399_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
AVL04300.1\|1437404_1437620_-	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
AVL04301.1\|1437632_1439342_-\|terminase	terminase	D6R3Y4	Bacillus_phage	0.0e+00	92.3
AVL04302.1\|1439341_1439875_-\|terminase	terminase	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
AVL06878.1\|1440254_1440629_-	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3

DBSCAN-SWA_5

1444313 : 1452678

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL04306.1\|1444313_1444766_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
AVL04307.1\|1444782_1444911_-	hypothetical protein	NA	NA	NA	NA
AVL04308.1\|1445019_1445220_-	hypothetical protein	NA	NA	NA	NA
AVL04309.1\|1445216_1445636_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
AVL04310.1\|1445632_1445965_-	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
AVL04311.1\|1445964_1446621_-	dUTPase	R9TQ23	Paenibacillus_phage	9.9e-39	46.0
AVL04312.1\|1446738_1446996_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
AVL04313.1\|1446992_1447400_-	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
AVL04314.1\|1447396_1447714_-	hypothetical protein	NA	NA	NA	NA
AVL04315.1\|1447710_1448073_-	hypothetical protein	NA	NA	NA	NA
AVL04316.1\|1448115_1448313_-	hypothetical protein	NA	NA	NA	NA
AVL04317.1\|1448807_1449356_-	hypothetical protein	NA	NA	NA	NA
AVL04318.1\|1449670_1450498_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
AVL04319.1\|1450481_1451363_-	replication protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
AVL04320.1\|1451355_1451574_-	hypothetical protein	NA	NA	NA	NA
AVL04321.1\|1451598_1451790_-	transcriptional regulator	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
AVL04322.1\|1451841_1452045_-	transcriptional regulator	NA	NA	NA	NA
AVL04323.1\|1452279_1452678_+	transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7

DBSCAN-SWA_6

1546761 : 1570433

Bacillus_phage(30.43%)

portal,tail,holin,capsid,integrase

attL 1553850:1553865|attR 1572192:1572207

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL06883.1\|1546761_1546995_-	transcriptional regulator	B3RH35	Bacillus_virus	4.3e-21	62.0
AVL04406.1\|1547273_1547552_+	hypothetical protein	NA	NA	NA	NA
AVL04407.1\|1547564_1548749_+	chromosome partitioning protein ParA	Q0H250	Geobacillus_phage	1.3e-108	53.4
AVL04408.1\|1548735_1549368_+	hypothetical protein	Q0H249	Geobacillus_phage	7.2e-63	57.1
AVL04409.1\|1549409_1549712_-	hypothetical protein	NA	NA	NA	NA
AVL04410.1\|1549833_1550091_-\|holin	holin	A0A0U4JE55	Bacillus_phage	5.6e-22	57.6
AVL04411.1\|1550110_1551058_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	2.5e-91	62.7
AVL04412.1\|1551130_1551334_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-09	46.5
AVL04413.1\|1551358_1551529_-\|portal	phage portal protein	M4ZS22	Bacillus_phage	1.1e-10	68.1
AVL04414.1\|1551529_1551823_-	hypothetical protein	M4ZR44	Bacillus_phage	1.6e-41	80.2
AVL04415.1\|1551838_1553062_-	hypothetical protein	M4ZRP1	Bacillus_phage	4.1e-163	74.9
AVL04416.1\|1553098_1554676_-	hypothetical protein	M4ZSB3	Bacillus_phage	3.3e-258	86.8
1553850:1553865	attL	NA	NA	NA	NA
AVL04417.1\|1554688_1556083_-	endopeptidase	A6M966	Geobacillus_virus	3.0e-37	30.3
AVL04418.1\|1556097_1557516_-\|tail	phage tail protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.3e-56	42.4
AVL04419.1\|1557519_1560342_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	6.7e-68	36.4
AVL04420.1\|1560346_1560568_-	hypothetical protein	NA	NA	NA	NA
AVL04421.1\|1560663_1561047_-	hypothetical protein	NA	NA	NA	NA
AVL04422.1\|1561106_1561676_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	1.0e-52	63.0
AVL04423.1\|1561716_1562091_-	hypothetical protein	NA	NA	NA	NA
AVL04424.1\|1562095_1562503_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	2.1e-31	55.5
AVL04425.1\|1562499_1562838_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	8.1e-21	47.3
AVL04426.1\|1562838_1563231_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	7.5e-18	39.5
AVL04427.1\|1563248_1563440_-	hypothetical protein	NA	NA	NA	NA
AVL04428.1\|1563496_1564405_-	hypothetical protein	A0A0N9S7T7	Paenibacillus_phage	1.4e-80	52.5
AVL04429.1\|1564436_1564997_-	ribonucleoside-triphosphate reductase	NA	NA	NA	NA
AVL04430.1\|1565102_1565915_-\|capsid	minor capsid protein	A0A0N9SJR1	Paenibacillus_phage	8.1e-75	52.7
AVL04431.1\|1565914_1567585_-\|portal	portal protein	A0A2H4J180	uncultured_Caudovirales_phage	1.5e-155	55.3
AVL04432.1\|1567589_1568024_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.5e-27	49.3
AVL04433.1\|1568040_1569801_-	hypothetical protein	A0A142F1L6	Bacillus_phage	8.3e-133	44.8
AVL04434.1\|1569884_1570433_+\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.0e-38	51.6
1572192:1572207	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1701800 : 1758760

Streptococcus_phage(16.67%)

coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL04560.1\|1701800_1702925_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AVL04561.1\|1703219_1704707_-	N-acetylmuramoyl-L-alanine amidase	A0A067ZJB6	Vibrio_phage	1.7e-25	40.6
AVL04562.1\|1704791_1706936_-	amidase	Q2XU88	Pseudomonas_phage	2.7e-16	28.9
AVL04563.1\|1706964_1707285_-	hypothetical protein	NA	NA	NA	NA
AVL04564.1\|1708525_1709878_+\|transposase	IS5/IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AVL04565.1\|1709882_1710065_+	hypothetical protein	NA	NA	NA	NA
AVL04566.1\|1710104_1711457_+\|transposase	IS5/IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AVL04567.1\|1711585_1712728_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A2P1ELS7	Moumouvirus	3.8e-30	29.9
AVL04568.1\|1713057_1713936_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	5.7e-82	53.4
AVL04569.1\|1715173_1716085_-	sugar ABC transporter ATP-binding protein	NA	NA	NA	NA
AVL04570.1\|1716105_1716933_-	Teichoic acid translocation permease TagG	NA	NA	NA	NA
AVL04571.1\|1718634_1721211_-\|coat	spore coat protein CotS	NA	NA	NA	NA
AVL04572.1\|1721522_1723658_-	CDP-glycerol--poly(glycerophosphate) glycerophosphotransferase	NA	NA	NA	NA
AVL04573.1\|1723801_1724191_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.4e-16	41.9
AVL04574.1\|1724553_1725336_+	N-acetylmannosaminyltransferase	NA	NA	NA	NA
AVL04575.1\|1725355_1726519_+	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
AVL04576.1\|1726547_1729190_-	beta-N-acetylglucosaminidase	Q4ZC50	Staphylococcus_virus	1.8e-38	44.9
AVL04577.1\|1729319_1730270_-	mannose-6-phosphate isomerase	NA	NA	NA	NA
AVL04578.1\|1730539_1731991_+	spore germination protein	NA	NA	NA	NA
AVL04579.1\|1731996_1733103_+	spore gernimation protein	NA	NA	NA	NA
AVL04580.1\|1733099_1734224_+	spore gernimation protein GerA	NA	NA	NA	NA
AVL04581.1\|1735908_1736895_+	LytR family transcriptional regulator	NA	NA	NA	NA
AVL04582.1\|1737042_1737903_+	hypothetical protein	NA	NA	NA	NA
AVL06888.1\|1737936_1739178_-	gamma-glutamyl hydrolase	S5MM68	Bacillus_phage	1.8e-17	41.1
AVL04583.1\|1739318_1739486_-	hypothetical protein	NA	NA	NA	NA
AVL04584.1\|1739500_1740643_-	PGA biosynthesis protein CapA	NA	NA	NA	NA
AVL04585.1\|1740661_1741111_-	poly-gamma-glutamate biosynthesis protein PgsC	NA	NA	NA	NA
AVL04586.1\|1741125_1742307_-	poly-gamma-glutamate synthase PgsB	NA	NA	NA	NA
AVL04587.1\|1742367_1742562_+	hypothetical protein	NA	NA	NA	NA
AVL04588.1\|1743088_1744078_+	LacI family transcriptional regulator	NA	NA	NA	NA
AVL04589.1\|1744070_1744952_+	ribokinase	NA	NA	NA	NA
AVL04590.1\|1744948_1745344_+	D-ribose pyranase	NA	NA	NA	NA
AVL04591.1\|1745359_1746841_+	D-xylose ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.5e-13	27.0
AVL04592.1\|1746842_1747811_+	ribose ABC transporter permease	NA	NA	NA	NA
AVL04593.1\|1747823_1748741_+	D-ribose ABC transporter substrate-binding protein	NA	NA	NA	NA
AVL04594.1\|1748822_1749359_+	cell wall-binding protein	NA	NA	NA	NA
AVL04595.1\|1749514_1749811_+	hypothetical protein	NA	NA	NA	NA
AVL04596.1\|1749850_1750378_-	general stress protein	NA	NA	NA	NA
AVL04597.1\|1750475_1751243_-	alpha-acetolactate decarboxylase	NA	NA	NA	NA
AVL04598.1\|1751304_1753017_-	acetolactate synthase	NA	NA	NA	NA
AVL04599.1\|1753174_1754083_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.8e-14	25.6
AVL04600.1\|1754293_1755622_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	6.4e-45	28.9
AVL04601.1\|1755678_1756356_-	DUF2642 domain-containing protein	NA	NA	NA	NA
AVL04602.1\|1756415_1757543_-\|coat	spore coat protein CotH	NA	NA	NA	NA
AVL04603.1\|1757671_1758760_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_8

1879058 : 1933468

Bacillus_phage(20.0%)

bacteriocin,protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL04729.1\|1879058_1880729_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AVL04730.1\|1880725_1881154_-	hypothetical protein	NA	NA	NA	NA
AVL04731.1\|1881466_1881598_+	subtilosin-A	NA	NA	NA	NA
AVL04732.1\|1881554_1881707_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
AVL04733.1\|1881731_1883078_+	subtilosin maturase AlbA	NA	NA	NA	NA
AVL04734.1\|1883090_1883252_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
AVL04735.1\|1883248_1883968_+	multidrug ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.2
AVL04736.1\|1883960_1885271_+	antibiotic biosynthesis protein AlbD	NA	NA	NA	NA
AVL06894.1\|1885260_1886421_+	peptidase M16	NA	NA	NA	NA
AVL04737.1\|1886425_1887706_+	peptidase M16	NA	NA	NA	NA
AVL04738.1\|1887702_1888404_+	antibiotic biosynthesis protein AlbG	NA	NA	NA	NA
AVL04739.1\|1888409_1889786_-	hypothetical protein	NA	NA	NA	NA
AVL04740.1\|1889824_1891180_-	hypothetical protein	NA	NA	NA	NA
AVL04741.1\|1891409_1892555_+	transcriptional regulator	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
AVL04742.1\|1892538_1892658_+	phosphatase RapF inhibitor	NA	NA	NA	NA
AVL04743.1\|1893247_1894120_-	agmatinase	NA	NA	NA	NA
AVL04744.1\|1894180_1895011_-	polyamine aminopropyltransferase	NA	NA	NA	NA
AVL04745.1\|1895212_1897288_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AVL04746.1\|1897315_1897750_-	hypothetical protein	NA	NA	NA	NA
AVL04747.1\|1897888_1898407_-	hypothetical protein	NA	NA	NA	NA
AVL04748.1\|1898420_1899080_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AVL04749.1\|1899188_1899377_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
AVL04750.1\|1899419_1899839_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVL04751.1\|1899958_1901875_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
AVL04752.1\|1902719_1904120_-	MFS transporter	NA	NA	NA	NA
AVL04753.1\|1904119_1904590_-	transcriptional regulator	NA	NA	NA	NA
AVL04754.1\|1904701_1905202_-	hypothetical protein	NA	NA	NA	NA
AVL04755.1\|1905237_1906539_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
AVL04756.1\|1906700_1906925_-	DUF1450 domain-containing protein	NA	NA	NA	NA
AVL04757.1\|1907139_1907916_+	Prespore-specific transcriptional regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
AVL04758.1\|1908059_1908950_-	EamA family transporter	NA	NA	NA	NA
AVL04759.1\|1909118_1909964_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
AVL04760.1\|1910012_1910912_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
AVL04761.1\|1911057_1912029_-	phosphate acetyltransferase	NA	NA	NA	NA
AVL06895.1\|1912313_1913063_+	heme-dependent peroxidase	NA	NA	NA	NA
AVL04762.1\|1913195_1913975_+	SDR family oxidoreductase	NA	NA	NA	NA
AVL04763.1\|1913990_1915205_-	aspartate aminotransferase	NA	NA	NA	NA
AVL04764.1\|1915205_1916390_-	MFS transporter	NA	NA	NA	NA
AVL04765.1\|1916386_1917805_-	alanine-anticapsin ligase BacD	NA	NA	NA	NA
AVL04766.1\|1917823_1918591_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-21	30.9
AVL04767.1\|1918587_1919295_-	bacilysin biosynthesis protein BacB	NA	NA	NA	NA
AVL04768.1\|1919284_1919899_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
AVL04769.1\|1920050_1921289_-	MFS transporter	NA	NA	NA	NA
AVL04770.1\|1921498_1922911_-	amino acid permease	NA	NA	NA	NA
AVL04771.1\|1922910_1924611_-	peptidase M20	NA	NA	NA	NA
AVL04772.1\|1924684_1926232_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AVL04773.1\|1926458_1927733_-	catabolic NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AVL04774.1\|1927910_1928375_-	hypothetical protein	NA	NA	NA	NA
AVL04775.1\|1928698_1929154_-\|coat	spore coat protein	NA	NA	NA	NA
AVL04776.1\|1929146_1929998_-	NAD(P)-dependent oxidoreductase	A0A291LA50	Escherichia_phage	1.3e-38	38.9
AVL04777.1\|1930011_1930959_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
AVL04778.1\|1930958_1931699_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
AVL04779.1\|1931723_1932743_-\|coat	spore coat protein	NA	NA	NA	NA
AVL04780.1\|1932745_1933468_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_9

2140517 : 2192486

Bacillus_phage(20.0%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL04968.1\|2140517_2141642_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AVL04969.1\|2141935_2142691_+	DeoR family transcriptional regulator	NA	NA	NA	NA
AVL04970.1\|2142744_2143677_+	oxidoreductase	NA	NA	NA	NA
AVL04971.1\|2143906_2144221_+	hypothetical protein	L7TIP7	Escherichia_phage	1.6e-10	47.0
AVL04972.1\|2144324_2144795_-	hypothetical protein	NA	NA	NA	NA
AVL04973.1\|2145551_2146064_+	HPP family protein	NA	NA	NA	NA
AVL04974.1\|2147609_2149490_-	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	1.1e-93	33.4
AVL04975.1\|2149657_2149909_-	hypothetical protein	NA	NA	NA	NA
AVL04976.1\|2151100_2151301_+	transcriptional regulator	NA	NA	NA	NA
AVL04977.1\|2151318_2151720_+	hypothetical protein	NA	NA	NA	NA
AVL04978.1\|2151923_2152142_-	hypothetical protein	NA	NA	NA	NA
AVL04979.1\|2152186_2152408_-	hypothetical protein	NA	NA	NA	NA
AVL04980.1\|2152729_2153854_+\|transposase	IS4 family transposase IS4Bsu1	NA	NA	NA	NA
AVL04981.1\|2154131_2154386_+	hypothetical protein	NA	NA	NA	NA
AVL04982.1\|2154549_2156733_+\|bacteriocin	bacteriocin cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.7e-50	30.8
AVL04983.1\|2156733_2158203_+\|bacteriocin	bacteriocin ABC transporter bacteriocin-binding protein	NA	NA	NA	NA
AVL04984.1\|2158304_2158493_+	hypothetical protein	NA	NA	NA	NA
AVL04985.1\|2158611_2159646_-	quercetin 2,3-dioxygenase	NA	NA	NA	NA
AVL04986.1\|2159739_2160315_-	TetR family transcriptional regulator	NA	NA	NA	NA
AVL04987.1\|2160445_2161516_+	oxidoreductase	NA	NA	NA	NA
AVL04988.1\|2161574_2162006_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVL04989.1\|2162232_2162637_+	hypothetical protein	NA	NA	NA	NA
AVL04990.1\|2162606_2163299_+	hypothetical protein	NA	NA	NA	NA
AVL04991.1\|2163338_2164370_-	general stress protein 30	NA	NA	NA	NA
AVL04992.1\|2164462_2165611_-	glycerate kinase	W6LM47	Streptococcus_phage	1.4e-48	42.3
AVL04993.1\|2165806_2166538_+	gluconate operon transcriptional regulator	NA	NA	NA	NA
AVL04994.1\|2166530_2168072_+	gluconate kinase	NA	NA	NA	NA
AVL04995.1\|2168100_2169447_+	gluconate permease	NA	NA	NA	NA
AVL04996.1\|2169469_2170876_+	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	E3SJC4	Synechococcus_phage	1.7e-32	30.6
AVL04997.1\|2171341_2171905_+	peroxiredoxin	NA	NA	NA	NA
AVL04998.1\|2171918_2173448_+	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.0e-33	29.3
AVL04999.1\|2173558_2174998_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AVL05000.1\|2175564_2176275_+	GntR family transcriptional regulator	NA	NA	NA	NA
AVL05001.1\|2176365_2177088_-	peptide ABC transporter permease	NA	NA	NA	NA
AVL05002.1\|2177108_2177738_-	peptide ABC transporter ATP-binding protein	NA	NA	NA	NA
AVL05003.1\|2178218_2180144_+	fructose-bisphosphatase class III	NA	NA	NA	NA
AVL05004.1\|2180594_2180945_-	hypothetical protein	NA	NA	NA	NA
AVL05005.1\|2181116_2181353_-	hypothetical protein	NA	NA	NA	NA
AVL05006.1\|2181425_2181866_+	heat-shock protein Hsp20	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
AVL05007.1\|2181866_2182046_+	hypothetical protein	NA	NA	NA	NA
AVL05008.1\|2182117_2182246_+	cell wall hydrolase	NA	NA	NA	NA
AVL05009.1\|2182285_2183044_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
AVL05010.1\|2183040_2184603_-\|transposase	transposase	NA	NA	NA	NA
AVL05011.1\|2184717_2185104_-	hypothetical protein	NA	NA	NA	NA
AVL05012.1\|2185515_2186979_+	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
AVL05013.1\|2187213_2189097_-	hypothetical protein	S5MMD7	Bacillus_phage	6.6e-19	21.8
AVL05014.1\|2189077_2191111_-	ATP-dependent endonuclease	NA	NA	NA	NA
AVL05015.1\|2192168_2192486_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

2799187 : 2806033

Streptococcus_phage(50.0%)

integrase

attL 2792096:2792111|attR 2814205:2814220

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2792096:2792111	attL	NA	NA	NA	NA
AVL05545.1\|2799187_2800294_-\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	4.8e-38	34.2
AVL05546.1\|2800306_2800816_-	metallopeptidase ImmA	NA	NA	NA	NA
AVL05547.1\|2800812_2801196_-	transcriptional regulator	A0A0B5CYL9	Listeria_phage	1.2e-12	36.9
AVL05548.1\|2801469_2801664_+	excisionase	NA	NA	NA	NA
AVL05549.1\|2801660_2801921_+	hypothetical protein	NA	NA	NA	NA
AVL05550.1\|2801974_2802235_+	hypothetical protein	NA	NA	NA	NA
AVL05551.1\|2802601_2802982_+	hypothetical protein	A0A1S5SF38	Streptococcus_phage	1.4e-05	36.1
AVL05552.1\|2803017_2804460_+	Ftsk domain-containing protein YdcQ	A0A1S5SFB5	Streptococcus_phage	4.3e-119	50.9
AVL05553.1\|2804452_2805511_+	DNA relaxase NicK	A0A1S5SEX3	Streptococcus_phage	1.6e-62	40.6
AVL05554.1\|2805781_2806033_+	RNA-binding protein	A0A059T699	Listeria_phage	6.9e-17	55.7
2814205:2814220	attR	NA	NA	NA	NA

DBSCAN-SWA_11

2970640 : 2979006

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL05702.1\|2970640_2971936_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
AVL05703.1\|2972009_2972735_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
AVL05704.1\|2972727_2972982_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AVL05705.1\|2972978_2973662_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AVL05706.1\|2973645_2975874_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	3.8e-159	40.1
AVL05707.1\|2975849_2977280_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AVL05708.1\|2977381_2978422_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
AVL05709.1\|2978418_2979006_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_12

3489075 : 3522936

Planktothrix_phage(20.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL06949.1\|3489075_3490068_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AVL06167.1\|3490811_3492449_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AVL06168.1\|3492556_3493492_+	peptide ABC transporter permease	NA	NA	NA	NA
AVL06169.1\|3493495_3494413_+	peptide ABC transporter permease	NA	NA	NA	NA
AVL06170.1\|3494417_3495494_+	peptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
AVL06171.1\|3495495_3496413_+	oligopeptide transport ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
AVL06950.1\|3496520_3497738_+	MFS transporter	NA	NA	NA	NA
AVL06172.1\|3497901_3498480_+	N-acetyltransferase	NA	NA	NA	NA
AVL06173.1\|3498660_3499056_+	regulatory protein Spx	NA	NA	NA	NA
AVL06174.1\|3499098_3499755_-	hypothetical protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
AVL06175.1\|3500031_3500688_+	adaptor protein MecA	NA	NA	NA	NA
AVL06176.1\|3500848_3502000_+	competence protein CoiA	NA	NA	NA	NA
AVL06177.1\|3502046_3504059_+	oligoendopeptidase F	NA	NA	NA	NA
AVL06178.1\|3504096_3504264_-	hypothetical protein	NA	NA	NA	NA
AVL06179.1\|3504359_3504560_-	hypothetical protein	NA	NA	NA	NA
AVL06180.1\|3504578_3505478_-	DsbA family protein	NA	NA	NA	NA
AVL06181.1\|3505474_3505873_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
AVL06951.1\|3506127_3506673_-	lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	5.1e-41	73.7
AVL06182.1\|3506876_3507449_-	CYTH domain-containing protein	NA	NA	NA	NA
AVL06183.1\|3507573_3507942_+	hypothetical protein	NA	NA	NA	NA
AVL06184.1\|3507970_3508606_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
AVL06185.1\|3508624_3509425_+	NAD(+) kinase	NA	NA	NA	NA
AVL06952.1\|3509487_3510339_+	RNA pseudouridine synthase	NA	NA	NA	NA
AVL06186.1\|3510351_3511086_-	bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical]	A8E2N0	Enterococcus_phage	7.2e-06	24.8
AVL06187.1\|3511320_3513165_+	sodium:proton antiporter	NA	NA	NA	NA
AVL06188.1\|3513413_3514124_+	thiaminase II	NA	NA	NA	NA
AVL06189.1\|3514098_3514716_+	thiamine phosphate synthase	NA	NA	NA	NA
AVL06190.1\|3514699_3515809_+	glycine oxidase ThiO	NA	NA	NA	NA
AVL06953.1\|3515808_3516009_+	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
AVL06191.1\|3516005_3516776_+	thiazole synthase	NA	NA	NA	NA
AVL06192.1\|3516772_3517783_+	thiamine biosynthesis protein MoeB	NA	NA	NA	NA
AVL06193.1\|3517801_3518617_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AVL06194.1\|3518752_3519529_+	enoyl-ACP reductase	NA	NA	NA	NA
AVL06195.1\|3519629_3520313_+\|coat	spore coat protein	NA	NA	NA	NA
AVL06196.1\|3520405_3520855_-\|coat	spore coat protein	NA	NA	NA	NA
AVL06197.1\|3520982_3521471_-\|coat	spore coat protein	NA	NA	NA	NA
AVL06198.1\|3521622_3522105_-\|coat	spore coat protein	NA	NA	NA	NA
AVL06199.1\|3522189_3522510_-\|coat	spore coat protein	NA	NA	NA	NA
AVL06200.1\|3522549_3522936_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_13

3568096 : 3675667

117

uncultured_Caudovirales_phage(24.44%)

tRNA,portal,tail,protease,holin,coat,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL06243.1\|3568096_3568576_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
AVL06244.1\|3568615_3568810_-	hypothetical protein	NA	NA	NA	NA
AVL06245.1\|3568941_3569271_-	hypothetical protein	NA	NA	NA	NA
AVL06246.1\|3569561_3569801_+	hypothetical protein	NA	NA	NA	NA
AVL06247.1\|3569819_3570800_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
AVL06248.1\|3570932_3571241_-\|coat	spore coat protein	NA	NA	NA	NA
AVL06249.1\|3571419_3572823_+	hypothetical protein	NA	NA	NA	NA
AVL06250.1\|3572862_3573336_-	hypothetical protein	NA	NA	NA	NA
AVL06251.1\|3573459_3573627_-	putative motility protein	NA	NA	NA	NA
AVL06252.1\|3573753_3574653_+	hypothetical protein	NA	NA	NA	NA
AVL06956.1\|3574662_3575061_-	hypothetical protein	NA	NA	NA	NA
AVL06253.1\|3575161_3575737_-	hypothetical protein	NA	NA	NA	NA
AVL06254.1\|3578832_3579393_+	hypothetical protein	NA	NA	NA	NA
AVL06255.1\|3579589_3580234_+	DUF4352 domain-containing protein	NA	NA	NA	NA
AVL06256.1\|3580308_3580935_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AVL06257.1\|3580965_3581244_-	hypothetical protein	NA	NA	NA	NA
AVL06258.1\|3581634_3582825_+	cytochrome P450	NA	NA	NA	NA
AVL06259.1\|3582847_3584026_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	9.5e-08	28.3
AVL06260.1\|3584066_3584255_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
AVL06261.1\|3584428_3585241_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
AVL06262.1\|3585286_3586039_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AVL06263.1\|3586038_3586791_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
AVL06264.1\|3586910_3587885_-	hypothetical protein	NA	NA	NA	NA
AVL06265.1\|3588900_3589323_+	hypothetical protein	NA	NA	NA	NA
AVL06266.1\|3589362_3590541_+	NADH dehydrogenase	NA	NA	NA	NA
AVL06267.1\|3590738_3592160_+	uronate isomerase	NA	NA	NA	NA
AVL06268.1\|3592227_3593607_+	MFS transporter	NA	NA	NA	NA
AVL06269.1\|3593711_3594725_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
AVL06270.1\|3594730_3595750_+	alcohol dehydrogenase	NA	NA	NA	NA
AVL06271.1\|3595774_3596854_+	mannonate dehydratase	NA	NA	NA	NA
AVL06272.1\|3596850_3597687_+	D-mannonate oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
AVL06273.1\|3597734_3599003_+	hexuronate transporter	NA	NA	NA	NA
AVL06274.1\|3599090_3600092_+	LacI family transcriptional regulator	NA	NA	NA	NA
AVL06275.1\|3600166_3601609_+	altronate oxidoreductase	NA	NA	NA	NA
AVL06276.1\|3601605_3603099_+	altronate hydrolase	NA	NA	NA	NA
AVL06277.1\|3603137_3603902_-	anion permease	NA	NA	NA	NA
AVL06278.1\|3604120_3604585_-	hypothetical protein	NA	NA	NA	NA
AVL06279.1\|3607078_3607294_+	hypothetical protein	NA	NA	NA	NA
AVL06280.1\|3607438_3608575_+	aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
AVL06281.1\|3608564_3608699_+	phosphatase RapA inhibitor	NA	NA	NA	NA
AVL06282.1\|3609096_3610050_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	1.6e-66	73.8
AVL06283.1\|3610089_3610467_-	helicase	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
AVL06284.1\|3610571_3611174_+	hypothetical protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
AVL06285.1\|3611250_3612087_+	manganese catalase	NA	NA	NA	NA
AVL06286.1\|3612130_3612727_-	phage-like element PBSX protein XkdA	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
AVL06287.1\|3612889_3613231_-	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
AVL06288.1\|3613409_3613589_+	hypothetical protein	NA	NA	NA	NA
AVL06289.1\|3613575_3614412_+\|portal	phage portal protein	S6BFM4	Thermus_phage	6.7e-24	27.8
AVL06290.1\|3614311_3615112_+	hypothetical protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
AVL06291.1\|3615111_3615279_+	hypothetical protein	NA	NA	NA	NA
AVL06292.1\|3615363_3615714_+\|portal	phage portal protein	NA	NA	NA	NA
AVL06293.1\|3615710_3615917_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
AVL06294.1\|3616032_3616542_+	Fis family transcriptional regulator	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
AVL06295.1\|3616657_3617455_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
AVL06296.1\|3617451_3618753_+\|terminase	terminase	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
AVL06297.1\|3618756_3620244_+	phage-like element PBSX protein XkdE	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
AVL06298.1\|3620263_3621091_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
AVL06299.1\|3621116_3622052_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AVL06300.1\|3622073_3622457_+	hypothetical protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
AVL06301.1\|3622453_3622810_+	phage-like element PBSX protein XkdH	NA	NA	NA	NA
AVL06302.1\|3622806_3623292_+	phage-like element PBSX protein XkdI	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
AVL06303.1\|3623304_3623745_+\|portal	phage portal protein	NA	NA	NA	NA
AVL06304.1\|3623748_3623967_+	hypothetical protein	NA	NA	NA	NA
AVL06305.1\|3623963_3625364_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
AVL06306.1\|3625365_3625809_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
AVL06307.1\|3625900_3626347_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
AVL06308.1\|3626388_3626529_+	hypothetical protein	NA	NA	NA	NA
AVL06309.1\|3626529_3631533_+\|portal	phage portal protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
AVL06310.1\|3631525_3632185_+\|portal	phage portal protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
AVL06311.1\|3632200_3633178_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
AVL06312.1\|3633177_3633444_+	phage-like element PBSX protein XkdR	S6C459	Thermus_phage	1.7e-05	36.4
AVL06313.1\|3633501_3633927_+\|portal	phage portal protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
AVL06314.1\|3633919_3634966_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.3e-72	44.3
AVL06315.1\|3634949_3635528_+	phage-like element PBSX protein XkdU	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
AVL06316.1\|3635524_3635797_+	hypothetical protein	NA	NA	NA	NA
AVL06317.1\|3635799_3637863_+\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
AVL06318.1\|3637874_3638204_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
AVL06319.1\|3638200_3638365_+\|portal	phage portal protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
AVL06320.1\|3638411_3639251_+\|portal	phage portal protein	NA	NA	NA	NA
AVL06321.1\|3639303_3639573_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
AVL06322.1\|3639585_3639849_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
AVL06323.1\|3639861_3640755_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	5.2e-83	69.2
AVL06324.1\|3641015_3641186_-	stage II sporulation protein SB	NA	NA	NA	NA
AVL06325.1\|3641185_3641932_-	stage II sporulation protein SA	NA	NA	NA	NA
AVL06326.1\|3642041_3643043_-	low-affinity inorganic phosphate transporter	NA	NA	NA	NA
AVL06327.1\|3643055_3643673_-	hypothetical protein	NA	NA	NA	NA
AVL06328.1\|3643948_3645265_-	serine/threonine protein kinase	NA	NA	NA	NA
AVL06329.1\|3645653_3646604_+	ring-cleaving dioxygenase	NA	NA	NA	NA
AVL06330.1\|3646820_3648971_+	mannosyltransferase	NA	NA	NA	NA
AVL06331.1\|3648982_3649954_+	glycosyltransferase	I1TED8	Salmonella_phage	2.5e-62	41.3
AVL06332.1\|3650453_3651803_-\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	3.4e-25	34.1
AVL06333.1\|3651971_3652790_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AVL06334.1\|3652919_3653744_+	aminopeptidase	NA	NA	NA	NA
AVL06335.1\|3653760_3654687_+	peptide ABC transporter permease	NA	NA	NA	NA
AVL06336.1\|3654692_3655655_+	diguanylate cyclase	NA	NA	NA	NA
AVL06337.1\|3655659_3656667_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	28.7
AVL06957.1\|3656669_3658319_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AVL06338.1\|3658406_3659366_+	LD-carboxypeptidase	NA	NA	NA	NA
AVL06339.1\|3659362_3660442_+	dipeptide epimerase	NA	NA	NA	NA
AVL06340.1\|3660458_3661349_+	peptidase	A0A0A8WIF2	Clostridium_phage	5.3e-19	45.8
AVL06341.1\|3661361_3662351_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5
AVL06342.1\|3662393_3663443_-	6-phosphogluconolactonase	NA	NA	NA	NA
AVL06958.1\|3664551_3665070_+	acyl-CoA thioesterase	NA	NA	NA	NA
AVL06343.1\|3665307_3666507_+	nitric oxide dioxygenase	NA	NA	NA	NA
AVL06344.1\|3666583_3666808_-	hypothetical protein	NA	NA	NA	NA
AVL06345.1\|3666956_3667688_+	DUF421 domain-containing protein	NA	NA	NA	NA
AVL06346.1\|3667779_3668307_+	hypothetical protein	NA	NA	NA	NA
AVL06347.1\|3668296_3668815_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AVL06348.1\|3669036_3669375_+	multidrug resistance protein YkkC	NA	NA	NA	NA
AVL06349.1\|3669374_3669692_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AVL06350.1\|3669762_3670665_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AVL06351.1\|3671015_3672113_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
AVL06352.1\|3672124_3673372_+	gamma-glutamyl-phosphate reductase	A0A1X9I5D4	Streptococcus_phage	4.2e-99	50.1
AVL06353.1\|3673497_3673923_+	organic hydroperoxide resistance protein OhrA	NA	NA	NA	NA
AVL06354.1\|3673953_3674397_-	MarR family transcriptional regulator	NA	NA	NA	NA
AVL06355.1\|3674538_3674949_+	Organic hydroperoxide resistance protein OhrA	NA	NA	NA	NA
AVL06356.1\|3675196_3675667_-\|tRNA	tRNA-specific adenosine deaminase	S4VYZ2	Pandoravirus	1.8e-26	45.8

DBSCAN-SWA_14

4078553 : 4138960

Bacillus_phage(60.0%)

tRNA,portal,tail,protease,holin,capsid,head,integrase,terminase

attL 4076933:4076948|attR 4107695:4107710

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4076933:4076948	attL	NA	NA	NA	NA
AVL06735.1\|4078553_4079087_+\|terminase	terminase	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
AVL06736.1\|4080955_4081201_-	hypothetical protein	NA	NA	NA	NA
AVL06737.1\|4081632_4082088_-	hypothetical protein	NA	NA	NA	NA
AVL06738.1\|4082242_4082800_-	hypothetical protein	NA	NA	NA	NA
AVL06739.1\|4082920_4083535_+	TetR family transcriptional regulator	NA	NA	NA	NA
AVL06740.1\|4083673_4084030_-	hypothetical protein	NA	NA	NA	NA
AVL06741.1\|4084108_4084933_-	hypothetical protein	NA	NA	NA	NA
AVL06742.1\|4085043_4086372_-\|protease	serine protease	A0A1B0T6A2	Bacillus_phage	1.2e-27	33.6
AVL06743.1\|4086596_4086830_+	hypothetical protein	NA	NA	NA	NA
AVL06744.1\|4087109_4087817_+	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
AVL06745.1\|4087886_4088339_+	hypothetical protein	NA	NA	NA	NA
AVL06746.1\|4088352_4088706_-	multidrug resistance protein EbrB	NA	NA	NA	NA
AVL06747.1\|4088719_4089037_-	multidrug resistance protein EbrA	NA	NA	NA	NA
AVL06748.1\|4089171_4089450_-	hypothetical protein	NA	NA	NA	NA
AVL06749.1\|4089538_4089952_+	hypothetical protein	NA	NA	NA	NA
AVL06750.1\|4090051_4090996_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AVL06751.1\|4091035_4091257_+	RNA-binding protein Hfq	NA	NA	NA	NA
AVL06752.1\|4091451_4091724_+	hypothetical protein	NA	NA	NA	NA
AVL06753.1\|4091805_4092036_+	hypothetical protein	NA	NA	NA	NA
AVL06754.1\|4092278_4092671_+	protein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
AVL06755.1\|4092630_4094733_+	ribonucleotide-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
AVL06756.1\|4094750_4095740_+	ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
AVL06757.1\|4095789_4096410_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
AVL06758.1\|4096473_4097241_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
AVL06759.1\|4097881_4098850_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
AVL06760.1\|4098982_4100245_+	GTPase HflX	NA	NA	NA	NA
AVL06761.1\|4100262_4101528_+	hypothetical protein	NA	NA	NA	NA
AVL06762.1\|4101637_4102045_+	MerR family transcriptional regulator	NA	NA	NA	NA
AVL06763.1\|4102103_4103438_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AVL06764.1\|4103550_4104705_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.3e-65	38.9
AVL06976.1\|4104723_4105773_-	hypothetical protein	A0A0F6N3H6	Staphylococcus_phage	1.4e-07	23.7
AVL06765.1\|4105762_4106149_-	transcriptional regulator	R9W020	Paenibacillus_phage	9.0e-08	31.4
AVL06766.1\|4106273_4106492_+	transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	2.1e-17	63.2
AVL06767.1\|4106606_4107371_+	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.0e-47	49.1
AVL06768.1\|4107386_4107698_+	DNA-binding protein	NA	NA	NA	NA
AVL06769.1\|4107710_4107950_+	hypothetical protein	Q9ZXD0	Bacillus_phage	8.9e-06	53.1
4107695:4107710	attR	NA	NA	NA	NA
AVL06770.1\|4107946_4108222_+	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	47.1
AVL06771.1\|4108417_4108972_+	hypothetical protein	Q9ZXC8	Bacillus_phage	3.1e-94	96.2
AVL06772.1\|4108975_4109911_+	hypothetical protein	Q9ZXC7	Bacillus_phage	2.0e-170	96.5
AVL06773.1\|4109900_4110215_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.5e-53	99.0
AVL06774.1\|4110235_4110673_+	hypothetical protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
AVL06775.1\|4110733_4113151_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.7
AVL06776.1\|4113350_4113788_+	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
AVL06777.1\|4113784_4114324_+	nuclease	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
AVL06778.1\|4114358_4114874_+	hypothetical protein	D6R425	Bacillus_phage	8.7e-91	93.0
AVL06977.1\|4115127_4115541_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	2.1e-63	97.0
AVL06978.1\|4115912_4116296_+	HNH endonuclease	A0A075M5R4	Enterococcus_phage	1.2e-17	43.3
AVL06779.1\|4116298_4116505_+	hypothetical protein	NA	NA	NA	NA
AVL06780.1\|4116743_4117229_+\|terminase	terminase	A0A1Q1PVW3	Staphylococcus_phage	4.2e-18	36.0
AVL06781.1\|4117218_4118952_+\|terminase	terminase	A0A2H4JCI4	uncultured_Caudovirales_phage	2.1e-144	48.9
AVL06782.1\|4118968_4119175_+	hypothetical protein	NA	NA	NA	NA
AVL06783.1\|4119179_4120406_+\|portal	phage portal protein	A0A1J0MFU3	Staphylococcus_phage	2.4e-70	39.4
AVL06784.1\|4120398_4120995_+	peptidase U35	A0A1J0MFL1	Staphylococcus_phage	3.3e-49	53.8
AVL06785.1\|4121042_4122251_+\|capsid	major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	4.9e-76	49.8
AVL06786.1\|4122278_4122662_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
AVL06787.1\|4122716_4123010_+	DNA-packaging protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
AVL06788.1\|4122999_4123326_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AVL06789.1\|4123325_4123718_+\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
AVL06790.1\|4123714_4124122_+	hypothetical protein	NA	NA	NA	NA
AVL06791.1\|4124127_4124712_+\|tail	major tail protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
AVL06792.1\|4124771_4125134_+	hypothetical protein	NA	NA	NA	NA
AVL06793.1\|4125145_4125328_+	hypothetical protein	NA	NA	NA	NA
AVL06794.1\|4125390_4129131_+	hypothetical protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
AVL06795.1\|4129143_4129977_+\|tail	phage tail protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
AVL06796.1\|4129990_4131865_+	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
AVL06797.1\|4131875_4133453_+	hypothetical protein	M4ZSB3	Bacillus_phage	4.2e-261	85.1
AVL06798.1\|4133489_4134611_+	hypothetical protein	M4ZRP1	Bacillus_phage	9.8e-196	92.5
AVL06799.1\|4134626_4134926_+	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
AVL06800.1\|4134922_4135093_+	hypothetical protein	NA	NA	NA	NA
AVL06801.1\|4135144_4135357_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
AVL06802.1\|4135371_4135635_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
AVL06803.1\|4135690_4136668_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.0e-64	71.4
AVL06804.1\|4136713_4137178_-	hypothetical protein	NA	NA	NA	NA
AVL06979.1\|4137196_4138960_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP020024

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP020023

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection