CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	0 crisprs	csa3	0	0	2	0
CP027402	Enterococcus faecium strain FDAARGOS_323 chromosome, complete genome	1 crisprs	DinG,cas3,csa3,DEDDh,cas14j	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027402_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027402_1

2349535-2349644

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027402_1

>merge|CP027402|1|2349535-2349644|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>CP027402|1|1|2349535-2349644|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
CP027402.1\|AVL46047.1\|2350272_2350641_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
CP027402.1\|AVL46051.1\|2354676_2355378_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
CP027402.1\|AVL46036.1\|2341656_2342160_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
CP027402.1\|AVL46049.1\|2351517_2352720_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP027402.1\|AVL46038.1\|2343021_2343174_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
CP027402.1\|AVL46053.1\|2356653_2357793_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
CP027402.1\|AVL46048.1\|2350746_2351436_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
CP027402.1\|AVL46042.1\|2346195_2347068_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
CP027402.1\|AVL46043.1\|2347080_2347749_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
CP027402.1\|AVL46041.1\|2344090_2344978_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|283645
CP027402.1\|AVL46045.1\|2348617_2349307_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
CP027402.1\|AVL46040.1\|2343468_2344014_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
CP027402.1\|AVL46050.1\|2352910_2354443_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223562
CP027402.1\|AVL46054.1\|2357881_2358847_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
CP027402.1\|AVL46052.1\|2355631_2356345_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP027402.1\|AVL46055.1\|2358896_2361056_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
CP027402.1\|AVL46044.1\|2348091_2348514_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
CP027402.1\|AVL46037.1\|2342215_2342860_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
CP027402.1\|AVL46046.1\|2349716_2350220_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
CP027402.1\|AVL46039.1\|2343197_2343368_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355

Protein	Function_ID	Function_description	E-value
CP027402.1\|AVL46047.1\|2350272_2350641_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
CP027402.1\|AVL46051.1\|2354676_2355378_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
CP027402.1\|AVL46036.1\|2341656_2342160_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	1.05399e-35
CP027402.1\|AVL46049.1\|2351517_2352720_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
CP027402.1\|AVL46038.1\|2343021_2343174_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
CP027402.1\|AVL46053.1\|2356653_2357793_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
CP027402.1\|AVL46048.1\|2350746_2351436_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
CP027402.1\|AVL46042.1\|2346195_2347068_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
CP027402.1\|AVL46043.1\|2347080_2347749_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
CP027402.1\|AVL46041.1\|2344090_2344978_+\|alpha/beta-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
CP027402.1\|AVL46045.1\|2348617_2349307_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
CP027402.1\|AVL46040.1\|2343468_2344014_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
CP027402.1\|AVL46050.1\|2352910_2354443_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.76931e-169
CP027402.1\|AVL46054.1\|2357881_2358847_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
CP027402.1\|AVL46052.1\|2355631_2356345_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
CP027402.1\|AVL46055.1\|2358896_2361056_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
CP027402.1\|AVL46044.1\|2348091_2348514_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
CP027402.1\|AVL46037.1\|2342215_2342860_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
CP027402.1\|AVL46046.1\|2349716_2350220_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
CP027402.1\|AVL46039.1\|2343197_2343368_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13

>CP027402.1|AVL46045.1|2348617_2349307_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>CP027402.1|AVL46044.1|2348091_2348514_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>CP027402.1|AVL46043.1|2347080_2347749_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>CP027402.1|AVL46042.1|2346195_2347068_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>CP027402.1|AVL46041.1|2344090_2344978_+|alpha/beta-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>CP027402.1|AVL46040.1|2343468_2344014_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>CP027402.1|AVL46039.1|2343197_2343368_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>CP027402.1|AVL46038.1|2343021_2343174_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>CP027402.1|AVL46037.1|2342215_2342860_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>CP027402.1|AVL46036.1|2341656_2342160_+|QueT-transporter-family-protein
MQKTKSRQRLSVIVVNGIIMALYLALTILVAPVSSGPIQFRISESLNHLVVFNRKLLWGVLGGVIVYNAFFGFGIMDVVFGGGQTLLSLGLTALLQNKVKNVKMRLVLNTIFFTISMGLIAYMLVPTGGQAFWTTYGTLALSEFIVMAVSAPLMYYLDRALDFEKRV
>CP027402.1|AVL46046.1|2349716_2350220_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>CP027402.1|AVL46047.1|2350272_2350641_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>CP027402.1|AVL46048.1|2350746_2351436_+|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>CP027402.1|AVL46049.1|2351517_2352720_+|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>CP027402.1|AVL46050.1|2352910_2354443_-|ABC-transporter-ATP-binding-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIDEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>CP027402.1|AVL46051.1|2354676_2355378_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>CP027402.1|AVL46052.1|2355631_2356345_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>CP027402.1|AVL46053.1|2356653_2357793_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>CP027402.1|AVL46054.1|2357881_2358847_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>CP027402.1|AVL46055.1|2358896_2361056_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

112332 : 120804

Streptococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL44019.1\|112332_112977_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
AVL44020.1\|112991_113321_+	hypothetical protein	NA	NA	NA	NA
AVL44021.1\|113334_114273_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
AVL44022.1\|114308_115133_+	signal peptidase	NA	NA	NA	NA
AVL44023.1\|115125_115473_+	DUF972 domain-containing protein	M1PFV3	Streptococcus_phage	5.1e-18	41.1
AVL44024.1\|115541_116414_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
AVL44025.1\|116522_117644_+	DNA polymerase IV	NA	NA	NA	NA
AVL44026.1\|117697_118300_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
AVL44027.1\|118614_120804_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_2

502072 : 511133

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL44382.1\|502072_503368_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
AVL44383.1\|503547_503925_-	hypothetical protein	NA	NA	NA	NA
AVL44384.1\|504180_504909_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
AVL44385.1\|504908_505163_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AVL44386.1\|505164_505836_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AVL44387.1\|505836_508059_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.2e-150	41.3
AVL44388.1\|508043_509483_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
AVL46264.1\|509514_510558_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
AVL44389.1\|510554_511133_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_3

960751 : 1074784

122

Enterococcus_phage(26.92%)

transposase,tail,integrase,portal,head,protease,tRNA,terminase,capsid,holin

attL 1014986:1015009|attR 1053571:1053594

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL44795.1\|960751_961675_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AVL44796.1\|962043_964407_-	phosphoketolase family protein	NA	NA	NA	NA
AVL44797.1\|964854_965028_+	sugar ABC transporter permease	NA	NA	NA	NA
AVL44798.1\|965184_965532_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
AVL44799.1\|965558_967865_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
AVL44800.1\|967877_968189_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
AVL44801.1\|968185_968479_-	DUF448 domain-containing protein	NA	NA	NA	NA
AVL44802.1\|968500_969676_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AVL44803.1\|969698_970172_-	ribosome maturation factor RimP	NA	NA	NA	NA
AVL44804.1\|970315_974668_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	3.9e-22	41.4
AVL44805.1\|974879_976589_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AVL44806.1\|976656_977925_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AVL44807.1\|978085_978886_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AVL44808.1\|978882_979695_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
AVL44809.1\|979889_980447_-	ribosome recycling factor	NA	NA	NA	NA
AVL44810.1\|980449_981172_-	UMP kinase	NA	NA	NA	NA
AVL44811.1\|981307_982189_-	elongation factor Ts	NA	NA	NA	NA
AVL44812.1\|982287_983070_-	30S ribosomal protein S2	NA	NA	NA	NA
AVL44813.1\|983428_983908_+	ArgR family transcriptional regulator	NA	NA	NA	NA
AVL46276.1\|984124_985216_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
AVL44814.1\|986337_988029_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.3e-74	32.8
AVL44815.1\|988448_989396_-	carbamate kinase	NA	NA	NA	NA
AVL44816.1\|989510_990530_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AVL44817.1\|990620_991850_-	arginine deiminase	NA	NA	NA	NA
AVL44818.1\|992310_993012_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AVL44819.1\|993620_994637_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.4
AVL44820.1\|994633_995098_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AVL44821.1\|995104_995647_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AVL46277.1\|995630_996455_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AVL44822.1\|996543_997524_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
AVL44823.1\|997547_999032_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AVL44824.1\|999043_1000033_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
AVL44825.1\|1000281_1000449_+	DUF3042 domain-containing protein	NA	NA	NA	NA
AVL44826.1\|1000510_1002322_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AVL44827.1\|1002318_1002684_-	DUF488 domain-containing protein	NA	NA	NA	NA
AVL44828.1\|1002846_1003242_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AVL44829.1\|1003259_1004222_-	glucokinase	NA	NA	NA	NA
AVL44830.1\|1004221_1004434_-	DUF910 domain-containing protein	NA	NA	NA	NA
AVL44831.1\|1004454_1005153_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AVL44832.1\|1005172_1005715_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AVL44833.1\|1005846_1006851_-	iron ABC transporter permease	NA	NA	NA	NA
AVL44834.1\|1006847_1007837_-	iron ABC transporter permease	NA	NA	NA	NA
AVL44835.1\|1007833_1008640_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
AVL44836.1\|1008805_1009762_+	ferrichrome ABC transporter substrate-binding protein	NA	NA	NA	NA
AVL44837.1\|1009838_1010357_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
AVL44838.1\|1010444_1010594_-	50S ribosomal protein L33	NA	NA	NA	NA
AVL44839.1\|1010821_1011268_+	DUF2188 domain-containing protein	NA	NA	NA	NA
AVL44840.1\|1011462_1013358_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
AVL44841.1\|1013682_1014657_-	linear amide C-N hydrolase	M1H001	Paramecium_bursaria_Chlorella_virus	6.6e-23	29.7
1014986:1015009	attL	NA	NA	NA	NA
AVL44842.1\|1015216_1016236_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	5.4e-60	66.1
AVL44843.1\|1016246_1016444_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
AVL44844.1\|1016459_1016702_-\|holin	holin	D2J075	Enterococcus_phage	2.1e-23	68.4
AVL44845.1\|1016771_1017581_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	1.7e-08	23.1
AVL44846.1\|1017623_1018346_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	3.9e-12	30.6
AVL44847.1\|1018345_1020622_-	hypothetical protein	A0A096XSZ6	Enterococcus_phage	1.1e-60	33.7
AVL44848.1\|1020645_1022937_-	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	2.3e-90	30.2
AVL44849.1\|1022946_1023684_-\|tail	phage tail protein	NA	NA	NA	NA
AVL44850.1\|1023720_1024674_-\|transposase	IS30 family transposase	NA	NA	NA	NA
AVL44851.1\|1024801_1028221_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
AVL44852.1\|1028237_1028420_-	hypothetical protein	NA	NA	NA	NA
AVL44853.1\|1028422_1028785_-	hypothetical protein	NA	NA	NA	NA
AVL44854.1\|1028806_1029412_-\|tail	phage tail protein	Q8W5Z9	Listeria_phage	6.7e-34	41.2
AVL44855.1\|1029423_1029828_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
AVL44856.1\|1029820_1030222_-	hypothetical protein	A0A1B1P759	Bacillus_phage	3.0e-14	34.1
AVL44857.1\|1030211_1030565_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AVL44858.1\|1030554_1030866_-	hypothetical protein	A0A1B1P751	Bacillus_phage	1.8e-11	43.5
AVL44859.1\|1030862_1031738_-	hypothetical protein	D2IYX3	Enterococcus_phage	2.5e-130	73.9
AVL44860.1\|1031747_1032908_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.7e-100	50.4
AVL44861.1\|1032907_1033594_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	6.1e-31	40.2
AVL44862.1\|1033556_1034735_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.9e-80	40.2
AVL44863.1\|1034754_1036449_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
AVL44864.1\|1036426_1036741_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
AVL44865.1\|1036842_1037124_-	hypothetical protein	NA	NA	NA	NA
AVL44866.1\|1037128_1037473_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
AVL44867.1\|1037975_1038200_+	hypothetical protein	NA	NA	NA	NA
AVL44868.1\|1038473_1038890_-	autolysin	C9E2P5	Enterococcus_phage	1.8e-46	67.4
AVL44869.1\|1038966_1039263_-	hypothetical protein	NA	NA	NA	NA
AVL44870.1\|1039259_1039463_-	toxin PIN	NA	NA	NA	NA
AVL44871.1\|1039469_1039700_-	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	3.0e-11	50.7
AVL44872.1\|1041171_1041474_-	hypothetical protein	D2IZY1	Enterococcus_phage	1.7e-33	71.7
AVL44873.1\|1041598_1041913_-	hypothetical protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	1.6e-10	37.4
AVL44874.1\|1041912_1042203_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.4e-13	43.4
AVL44875.1\|1042196_1042508_-	hypothetical protein	NA	NA	NA	NA
AVL44876.1\|1042504_1042666_-	antitoxin	NA	NA	NA	NA
AVL44877.1\|1042680_1043040_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	1.1e-18	48.3
AVL44878.1\|1043036_1043888_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.2e-25	28.7
AVL44879.1\|1043904_1044744_-	phage replisome organizer	J7KBV5	Streptococcus_phage	1.8e-48	75.4
AVL44880.1\|1044750_1045437_-	hypothetical protein	C9E2N1	Enterococcus_phage	4.1e-88	69.1
AVL44881.1\|1045442_1046114_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
AVL44882.1\|1046106_1046448_-	hypothetical protein	NA	NA	NA	NA
AVL44883.1\|1046594_1047002_+	hypothetical protein	NA	NA	NA	NA
AVL44884.1\|1047115_1047301_-	hypothetical protein	NA	NA	NA	NA
AVL44885.1\|1047380_1047725_+	hypothetical protein	NA	NA	NA	NA
AVL44886.1\|1047707_1047890_-	hypothetical protein	NA	NA	NA	NA
AVL46278.1\|1048152_1048413_-	MerR family transcriptional regulator	NA	NA	NA	NA
AVL44887.1\|1048552_1048756_-	hypothetical protein	NA	NA	NA	NA
AVL44888.1\|1048770_1049547_-	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	1.9e-73	54.5
AVL44889.1\|1049846_1050167_+	XRE family transcriptional regulator	A0A1B0Y3N1	Lactobacillus_phage	5.0e-12	35.1
AVL44890.1\|1050184_1050607_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AVL44891.1\|1050689_1051325_+	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	5.1e-32	52.6
AVL44892.1\|1051512_1052169_-	hypothetical protein	NA	NA	NA	NA
AVL44893.1\|1052322_1053471_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	1.2e-68	38.9
AVL44894.1\|1053809_1054376_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1053571:1053594	attR	NA	NA	NA	NA
AVL44895.1\|1055928_1056279_+	hypothetical protein	NA	NA	NA	NA
AVL44896.1\|1056370_1056790_-	cupin domain-containing protein	NA	NA	NA	NA
AVL44897.1\|1056790_1057135_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AVL44898.1\|1057484_1058081_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
AVL44899.1\|1058204_1060004_+	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
AVL46279.1\|1060281_1060494_-	hypothetical protein	NA	NA	NA	NA
AVL44900.1\|1061350_1061737_+	DUF1093 domain-containing protein	NA	NA	NA	NA
AVL44901.1\|1062044_1063391_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
AVL44902.1\|1063502_1064852_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
AVL44903.1\|1064968_1066222_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
AVL44904.1\|1066292_1066778_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AVL44905.1\|1066800_1067559_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	8.5e-26	36.9
AVL44906.1\|1067574_1068753_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.1e-102	48.9
AVL44907.1\|1068982_1071103_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.8e-220	58.1
AVL44908.1\|1071038_1071314_+	hypothetical protein	NA	NA	NA	NA
AVL44909.1\|1071325_1072051_+	hypothetical protein	NA	NA	NA	NA
AVL44910.1\|1072040_1072550_+	hypothetical protein	NA	NA	NA	NA
AVL44911.1\|1072619_1074068_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
AVL44912.1\|1074067_1074784_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.0e-33	35.7

DBSCAN-SWA_4

2369008 : 2431329

Enterococcus_phage(38.1%)

tail,integrase,portal,head,protease,bacteriocin,terminase,capsid,holin

attL 2391846:2391864|attR 2432997:2433015

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL46065.1\|2369008_2369320_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AVL46066.1\|2369423_2369570_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
AVL46322.1\|2369645_2370893_+	GHKL domain-containing protein	NA	NA	NA	NA
AVL46067.1\|2370907_2371660_+	DNA-binding response regulator	NA	NA	NA	NA
AVL46068.1\|2372178_2372370_-	hypothetical protein	NA	NA	NA	NA
AVL46069.1\|2372362_2372578_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AVL46070.1\|2372596_2372833_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AVL46071.1\|2373090_2375244_+	peptide ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-41	27.8
AVL46323.1\|2375212_2376628_+	HlyD family secretion protein	NA	NA	NA	NA
AVL46072.1\|2376660_2377695_+	signal peptide peptidase SppA	A0A1C9LW82	Vibrio_phage	6.6e-13	29.2
AVL46073.1\|2377696_2378218_+	RDD family protein	NA	NA	NA	NA
AVL46074.1\|2378214_2378601_+	DUF4064 domain-containing protein	NA	NA	NA	NA
AVL46075.1\|2379550_2380120_+	DUF1836 domain-containing protein	NA	NA	NA	NA
AVL46076.1\|2380106_2380967_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	4.6e-12	24.4
AVL46077.1\|2381156_2381861_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.8e-45	41.6
AVL46078.1\|2381865_2383701_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.2e-37	37.7
AVL46079.1\|2383697_2385014_+	hypothetical protein	NA	NA	NA	NA
AVL46080.1\|2385014_2385884_+	hypothetical protein	NA	NA	NA	NA
AVL46081.1\|2385938_2386748_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
AVL46082.1\|2386850_2387480_-	flavin reductase	NA	NA	NA	NA
AVL46083.1\|2387649_2388942_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AVL46084.1\|2389017_2389680_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AVL46085.1\|2389904_2390189_+	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
AVL46086.1\|2390239_2391865_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
2391846:2391864	attL	NA	NA	NA	NA
AVL46087.1\|2391953_2393102_-\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	5.1e-91	48.4
AVL46088.1\|2393196_2393898_-	hypothetical protein	NA	NA	NA	NA
AVL46089.1\|2394022_2394454_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AVL46090.1\|2394471_2394795_-	XRE family transcriptional regulator	Q9AZJ7	Lactococcus_phage	1.2e-13	51.9
AVL46091.1\|2395086_2395278_+	hypothetical protein	NA	NA	NA	NA
AVL46092.1\|2395292_2396048_+	oxidoreductase	A0A1S5SE89	Streptococcus_phage	1.8e-92	70.1
AVL46093.1\|2396007_2396307_+	hypothetical protein	NA	NA	NA	NA
AVL46094.1\|2396354_2396639_+	hypothetical protein	NA	NA	NA	NA
AVL46095.1\|2396659_2396848_+	hypothetical protein	D2IZW5	Enterococcus_phage	1.7e-07	58.6
AVL46096.1\|2396844_2397030_+	hypothetical protein	NA	NA	NA	NA
AVL46097.1\|2397172_2397514_+	hypothetical protein	NA	NA	NA	NA
AVL46098.1\|2397506_2398253_+	DUF1071 domain-containing protein	A0A2I7RDU5	Vibrio_phage	4.4e-43	52.2
AVL46099.1\|2398258_2398945_+	hypothetical protein	C9E2N1	Enterococcus_phage	6.4e-89	70.0
AVL46100.1\|2398947_2399697_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.3e-31	54.0
AVL46101.1\|2399708_2399978_+	hypothetical protein	NA	NA	NA	NA
AVL46102.1\|2400140_2400446_+	hypothetical protein	NA	NA	NA	NA
AVL46103.1\|2400439_2400730_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.8e-13	43.4
AVL46104.1\|2400729_2401191_+	hypothetical protein	NA	NA	NA	NA
AVL46105.1\|2401356_2401638_+	hypothetical protein	NA	NA	NA	NA
AVL46106.1\|2401634_2402057_+	hypothetical protein	Q4ZD40	Staphylococcus_phage	4.6e-13	37.0
AVL46107.1\|2402049_2402553_+	DUF1642 domain-containing protein	A0A0E3T929	Enterococcus_phage	5.4e-37	60.7
AVL46108.1\|2402549_2402852_+	hypothetical protein	NA	NA	NA	NA
AVL46109.1\|2402848_2403034_+	hypothetical protein	NA	NA	NA	NA
AVL46110.1\|2403030_2403240_+	hypothetical protein	NA	NA	NA	NA
AVL46111.1\|2403236_2403524_+	hypothetical protein	NA	NA	NA	NA
AVL46112.1\|2403556_2403808_-	hypothetical protein	NA	NA	NA	NA
AVL46113.1\|2404115_2404583_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	3.2e-07	28.5
AVL46114.1\|2405359_2405590_+	hypothetical protein	NA	NA	NA	NA
AVL46115.1\|2405733_2406396_+	hypothetical protein	NA	NA	NA	NA
AVL46116.1\|2406442_2407291_+\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	1.2e-84	63.8
AVL46117.1\|2407277_2408522_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	4.3e-200	81.2
AVL46118.1\|2408534_2410034_+\|portal	phage portal protein	A0A097BY86	Enterococcus_phage	2.1e-222	78.9
AVL46119.1\|2410038_2410947_+\|head	phage head morphogenesis protein	A0A1L2JXH2	Streptococcus_phage	4.8e-92	59.1
AVL46120.1\|2411055_2411292_+	hypothetical protein	NA	NA	NA	NA
AVL46121.1\|2411440_2412043_+	DUF4355 domain-containing protein	A0A097BY91	Enterococcus_phage	1.1e-36	52.5
AVL46122.1\|2412055_2412979_+\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	1.8e-139	77.5
AVL46123.1\|2412996_2413260_+	hypothetical protein	D2J062	Enterococcus_phage	5.0e-10	72.9
AVL46124.1\|2413271_2413601_+	hypothetical protein	A0A0S2MYD5	Enterococcus_phage	3.8e-39	76.4
AVL46125.1\|2413597_2413924_+	hypothetical protein	C9E2J7	Enterococcus_phage	9.2e-38	70.2
AVL46126.1\|2413907_2414246_+	hypothetical protein	Q77K21	Lactococcus_phage	7.3e-30	58.9
AVL46127.1\|2414245_2414638_+\|capsid	phage capsid protein	Q77K20	Lactococcus_phage	2.2e-49	76.2
AVL46128.1\|2414648_2415161_+\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	7.4e-58	66.3
AVL46129.1\|2415206_2415575_+	hypothetical protein	Q77RZ7	Lactococcus_phage	8.6e-24	54.8
AVL46130.1\|2415628_2415916_+	hypothetical protein	D7RWD7	Brochothrix_phage	2.4e-13	44.3
AVL46131.1\|2415932_2419052_+\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	1.4e-167	79.5
AVL46324.1\|2419084_2419852_+\|tail	phage tail protein	D7RWD9	Brochothrix_phage	2.6e-59	45.1
AVL46132.1\|2419848_2422680_+	peptidase M23	A0A1P8BMB8	Lactococcus_phage	0.0e+00	60.7
AVL46133.1\|2422654_2424439_+	hypothetical protein	Q9AZX4	Lactococcus_phage	8.3e-40	41.4
AVL46134.1\|2424451_2425210_+	hypothetical protein	A0A067XGT4	Enterococcus_phage	1.5e-27	32.5
AVL46135.1\|2425225_2427451_+	hypothetical protein	A0A060AI60	Enterococcus_phage	7.4e-62	40.2
AVL46136.1\|2427462_2427909_+	hypothetical protein	NA	NA	NA	NA
AVL46137.1\|2427910_2428048_+	XkdX family protein	NA	NA	NA	NA
AVL46138.1\|2428085_2428379_+	hypothetical protein	NA	NA	NA	NA
AVL46139.1\|2428401_2428599_+\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
AVL46140.1\|2428609_2429629_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	1.9e-60	66.7
AVL46141.1\|2429727_2431329_+	hypothetical protein	A0A1S5SA14	Streptococcus_phage	1.0e-76	41.5
2432997:2433015	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP027401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

393 : 64688

Streptococcus_phage(58.82%)

transposase,integrase

attL 28332:28355|attR 52378:52401

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL43773.1\|393_993_+	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	7.4e-33	41.9
AVL43774.1\|1920_2121_+	XRE family transcriptional regulator	A0A2K5B261	Erysipelothrix_phage	1.8e-12	55.6
AVL43775.1\|2169_5427_+	helicase	A0A2K5B2B9	Erysipelothrix_phage	0.0e+00	81.0
AVL43776.1\|5427_6150_+	DUF4391 domain-containing protein	A0A2K5B2C0	Erysipelothrix_phage	1.7e-68	50.9
AVL43777.1\|6177_8157_+	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	1.8e-139	42.9
AVL43778.1\|8177_11168_+	restriction endonuclease subunit R	A0A2K5B2C2	Erysipelothrix_phage	0.0e+00	70.6
AVL43909.1\|11334_11649_+	hypothetical protein	NA	NA	NA	NA
AVL43779.1\|12291_13454_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AVL43780.1\|13556_13817_+	hypothetical protein	NA	NA	NA	NA
AVL43781.1\|15069_16257_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AVL43782.1\|16927_17836_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AVL43783.1\|17891_18389_+	N-acetyltransferase	NA	NA	NA	NA
AVL43784.1\|18385_19120_-	hypothetical protein	NA	NA	NA	NA
AVL43785.1\|19862_20417_+\|integrase	integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
AVL43786.1\|21480_22434_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	35.9
AVL43787.1\|24495_25581_-	tyrosine recombinase XerS	NA	NA	NA	NA
AVL43788.1\|25913_26147_+	addiction module antitoxin	NA	NA	NA	NA
AVL43789.1\|26143_26551_+	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	2.3e-14	39.1
AVL43790.1\|28208_28394_-	hypothetical protein	NA	NA	NA	NA
28332:28355	attL	NA	NA	NA	NA
AVL43791.1\|28390_28741_-	hypothetical protein	NA	NA	NA	NA
AVL43792.1\|28733_30059_-	type VI secretion protein ImpB	M1Q231	Streptococcus_phage	1.7e-98	43.2
AVL43793.1\|32120_33338_-\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	1.1e-232	99.8
AVL43794.1\|33419_33623_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
AVL43795.1\|33606_33858_+	hypothetical protein	NA	NA	NA	NA
AVL43796.1\|34083_34314_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
AVL43797.1\|34310_34733_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
AVL43910.1\|34961_35033_-	hypothetical protein	NA	NA	NA	NA
AVL43798.1\|35237_35591_+	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
AVL43799.1\|35650_35836_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
AVL43800.1\|35936_37856_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.4
AVL43801.1\|37871_37958_-	tetracycline resistance protein	NA	NA	NA	NA
AVL43802.1\|38232_39165_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
AVL43803.1\|39161_40163_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
AVL43804.1\|40159_42337_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
AVL43805.1\|42339_44787_-	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	99.4
AVL43806.1\|44770_45277_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
AVL43807.1\|45251_45749_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
AVL43808.1\|45865_46087_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
AVL43809.1\|46129_47335_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
AVL43810.1\|47357_47510_-	conjugal transfer protein	NA	NA	NA	NA
AVL43811.1\|47512_48898_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
AVL43812.1\|48926_49313_-	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
AVL43813.1\|49328_49643_-	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
AVL43814.1\|49880_51043_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AVL43815.1\|52451_53084_-	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	7.8e-09	28.4
52378:52401	attR	NA	NA	NA	NA
AVL43816.1\|53096_55820_-	PRD domain-containing protein	NA	NA	NA	NA
AVL43817.1\|55956_56922_-	SIS domain-containing protein	NA	NA	NA	NA
AVL43818.1\|56975_57788_-	PTS mannose transporter subunit IID	NA	NA	NA	NA
AVL43819.1\|57801_58575_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AVL43820.1\|58588_59059_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AVL43821.1\|59055_59472_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AVL43822.1\|59796_60639_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AVL43823.1\|60942_62457_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-45	38.3
AVL43824.1\|63482_64688_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.5e-35	30.7

DBSCAN-SWA_2

69524 : 135290

Streptococcus_phage(20.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVL43832.1\|69524_69647_+\|holin	putative holin-like toxin	NA	NA	NA	NA
AVL43833.1\|69805_70063_-	hypothetical protein	NA	NA	NA	NA
AVL43834.1\|70084_70570_-	single-stranded DNA-binding protein	Q938M7	Temperate_phage	2.9e-43	59.9
AVL43835.1\|70572_71472_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
AVL43836.1\|71484_72081_-	transcriptional regulator	NA	NA	NA	NA
AVL43837.1\|72325_74530_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.2e-118	51.5
AVL43838.1\|74540_76010_-	hypothetical protein	NA	NA	NA	NA
AVL43911.1\|76070_77882_-	hypothetical protein	NA	NA	NA	NA
AVL43839.1\|78454_78649_-	hypothetical protein	NA	NA	NA	NA
AVL43840.1\|78789_79125_-	hypothetical protein	NA	NA	NA	NA
AVL43841.1\|79136_80729_-	hypothetical protein	NA	NA	NA	NA
AVL43842.1\|80747_81170_-	hypothetical protein	NA	NA	NA	NA
AVL43843.1\|81403_82363_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.0e-31	35.5
AVL43844.1\|82326_82533_-	hypothetical protein	NA	NA	NA	NA
AVL43845.1\|83040_84072_-	hypothetical protein	NA	NA	NA	NA
AVL43846.1\|84091_84322_-	hypothetical protein	NA	NA	NA	NA
AVL43847.1\|84344_85151_-	hypothetical protein	NA	NA	NA	NA
AVL43848.1\|85161_85806_-	hypothetical protein	NA	NA	NA	NA
AVL43849.1\|85821_87027_-	peptidase M23	Q6SEC2	Lactobacillus_prophage	4.8e-31	41.8
AVL43850.1\|87026_89051_-	ATPase	NA	NA	NA	NA
AVL43851.1\|89213_89807_-	hypothetical protein	NA	NA	NA	NA
AVL43852.1\|89807_90140_-	hypothetical protein	NA	NA	NA	NA
AVL43853.1\|90191_92570_-	hypothetical protein	NA	NA	NA	NA
AVL43854.1\|92566_95176_-	type IV secretory protein	NA	NA	NA	NA
AVL43855.1\|95175_97251_-	hypothetical protein	NA	NA	NA	NA
AVL43856.1\|97320_97623_-	hypothetical protein	NA	NA	NA	NA
AVL43857.1\|97640_97883_-	hypothetical protein	NA	NA	NA	NA
AVL43858.1\|97879_98344_-	hypothetical protein	NA	NA	NA	NA
AVL43859.1\|98370_100461_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AVL43860.1\|100457_100718_-	hypothetical protein	NA	NA	NA	NA
AVL43861.1\|100730_101486_-	hypothetical protein	NA	NA	NA	NA
AVL43862.1\|101501_102254_-	class C sortase	NA	NA	NA	NA
AVL43863.1\|102268_104245_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AVL43864.1\|104297_104969_-	class A sortase	NA	NA	NA	NA
AVL43865.1\|105325_105928_-	hypothetical protein	NA	NA	NA	NA
AVL43866.1\|106054_106294_-	hypothetical protein	NA	NA	NA	NA
AVL43867.1\|106359_106599_-	hypothetical protein	NA	NA	NA	NA
AVL43868.1\|106765_106948_-	hypothetical protein	F0PIH7	Enterococcus_phage	7.7e-10	57.9
AVL43869.1\|107725_108058_-	conjugal transfer protein TraE	NA	NA	NA	NA
AVL43870.1\|108897_109938_-	replication protein RepA	NA	NA	NA	NA
AVL43871.1\|110816_111995_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
AVL43872.1\|113470_113725_+	AbrB family transcriptional regulator	NA	NA	NA	NA
AVL43873.1\|113725_114043_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AVL43874.1\|114751_115705_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	35.9
AVL43875.1\|116514_117483_+	SIS domain-containing protein	NA	NA	NA	NA
AVL43876.1\|117493_118309_+	fructoselysine 6-kinase	NA	NA	NA	NA
AVL43877.1\|118376_119087_+	GntR family transcriptional regulator	NA	NA	NA	NA
AVL43878.1\|119122_120364_+	hydrolase	NA	NA	NA	NA
AVL43879.1\|120421_121609_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AVL43880.1\|122143_123544_+	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
AVL43881.1\|124752_125082_+	AbrB family transcriptional regulator	NA	NA	NA	NA
AVL43882.1\|125071_125359_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AVL43883.1\|125644_126502_+	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
AVL43884.1\|126502_127051_+	hypothetical protein	NA	NA	NA	NA
AVL43885.1\|127310_127772_+	thermophilic serine proteinase	NA	NA	NA	NA
AVL43886.1\|127988_128939_-	transcriptional regulator	NA	NA	NA	NA
AVL43887.1\|129540_131385_+	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
AVL43888.1\|131440_132907_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
AVL43889.1\|132943_133786_+	transcription antiterminator BglG	NA	NA	NA	NA
AVL43890.1\|133997_135290_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP027402

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP027401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection