CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP022578	Mycobacterium tuberculosis strain WC059 chromosome, complete genome	4 crisprs	cas6,cas10,csm2gr11,csm3gr7,csm4gr5,c2c9_V-U4,csa3,DEDDh,cas4,WYL,DinG,cas3	14	37	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022578_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022578_1

431179-432326

TypeIII

II-B,III-A

Consensus_repeat	Method
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CRT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	PILER-CR
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CRISPRCasFinder

15 spacers

csm4gr5,csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of CP022578_1

>merge|CP022578|1|431179-432326|CRT,PILER-CR,CRISPRCasFinder
GGACATGCCGGGGCGGTTCAGAGAGGGGACGGAAACCTGCATCCGGAAAGTCCGTACGCTCGAAACGCTTCCAACGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGCGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCCTCATGGTGGGACATGGACGAGCGCGACTATCGGGGTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAACTGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCATGTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAACACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCAGTCGTCAGACCCAAAACCACGAGAGGGGACGGAAACTTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>CP022578|1|1|431179-432326|CRT
GGACATGCCGGGGCGGTTCAGAGAGGGGACGGAAAC	CTGCATCCGGAAAGTCCGTACGCTCGAAACGCTTCCAACGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>CP022578|1|1|431256-432326|PILER-CR
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>CP022578|1|1|431256-432326|CRISPRCasFinder
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP022578.1\|AVO06774.1\|438716_439082_-\|histone-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
CP022578.1\|AVO06765.1\|428811_429522_+\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
CP022578.1\|AVO06767.1\|429885_431147_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP022578.1\|AVO10069.1\|438239_438644_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO06763.1\|425992_428431_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
CP022578.1\|AVO06769.1\|433283_434693_-\|transposase	unknown	unknown	gnl\|CDD\|366234
CP022578.1\|AVO06772.1\|436698_437853_-\|transposase	unknown	unknown	gnl\|CDD\|366234
CP022578.1\|AVO06768.1\|432474_433287_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225806
CP022578.1\|AVO06770.1\|435791_436103_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO10068.1\|434763_435372_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO06762.1\|425051_425996_+\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838
CP022578.1\|AVO06761.1\|423172_424057_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225162
CP022578.1\|AVO06775.1\|439221_439689_-\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
CP022578.1\|AVO06773.1\|438051_438243_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO06764.1\|428427_428802_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
CP022578.1\|AVO06771.1\|436207_436465_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO10067.1\|424328_424874_+\|DUF1802-domain-containing-protein	unknown	unknown	gnl\|CDD\|226743
CP022578.1\|AVO06760.1\|421432_421978_+\|DUF1802-domain-containing-protein	unknown	unknown	gnl\|CDD\|226743
CP022578.1\|AVO06766.1\|429502_429859_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP022578.1\|AVO10066.1\|422282_423170_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370470

Protein	Function_ID	Function_description	E-value
CP022578.1\|AVO06765.1\|428811_429522_+\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP022578.1\|AVO06767.1\|429885_431147_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
CP022578.1\|AVO06763.1\|425992_428431_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
CP022578.1\|AVO06769.1\|433283_434693_-\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28
CP022578.1\|AVO06772.1\|436698_437853_-\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.94329e-16
CP022578.1\|AVO06768.1\|432474_433287_-\|AAA-family-ATPase	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP022578.1\|AVO06774.1\|438716_439082_-\|histone-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	0.00179041
CP022578.1\|AVO06762.1\|425051_425996_+\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	4.02032e-78
CP022578.1\|AVO06761.1\|423172_424057_+\|hypothetical-protein	gnl\|CDD\|225162	COG2253, COG2253, Uncharacterized conserved protein [Function unknown].	2.52052e-105
CP022578.1\|AVO06775.1\|439221_439689_-\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	1.07717e-28
CP022578.1\|AVO06764.1\|428427_428802_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
CP022578.1\|AVO10067.1\|424328_424874_+\|DUF1802-domain-containing-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	2.51205e-85
CP022578.1\|AVO06760.1\|421432_421978_+\|DUF1802-domain-containing-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	1.22881e-84
CP022578.1\|AVO06766.1\|429502_429859_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	3.77466e-44
CP022578.1\|AVO10066.1\|422282_423170_+\|hypothetical-protein	gnl\|CDD\|370470	pfam09407, AbiEi_1, AbiEi antitoxin C-terminal domain. AbiEi_1 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	2.43998e-38

>CP022578.1|AVO06767.1|429885_431147_-|IS3-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP022578.1|AVO06766.1|429502_429859_+|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLNEPPR
>CP022578.1|AVO06765.1|428811_429522_+|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>CP022578.1|AVO06764.1|428427_428802_+|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>CP022578.1|AVO06763.1|425992_428431_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYIADNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE
>CP022578.1|AVO06762.1|425051_425996_+|CRISPR-associated-endoribonuclease-Cas6
MAARRGGIRRTDLLRRSGQPRGRHRASAAESGLTWISPTLILVGFSHRGDRRMTEHLSRLTLTLEVDAPLERARVATLGPHLHGVLMESIPADYVQTLHTVPVNPYSQYALARSTTSLEWKISTLTNEARQQIVGPINDAAFAGFRLRASGIATQVTSRSLEQNPLSQFARIFYARPETRKFRVEFLTPTAFKQSGEYVFWPDPRLVFQSLAQKYGAIVDGEEPDPGLIAEFGQSVRLSAFRVASAPFAVGAARVPGFTGSATFTVRGVDTFASYIAALLWFGEFSGCGIKASMGMGAIRVQPLAPREKCVPKP
>CP022578.1|AVO10067.1|424328_424874_+|DUF1802-domain-containing-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHKLAVLVVCAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG
>CP022578.1|AVO06761.1|423172_424057_+|hypothetical-protein
MAGLTRALVARHALGRAEAYDAALLDVAQDHLLYLLSQTVQFGDNRLVFKGGTSLRKCRLGNVGRFSTDLDFSAPDDEVVLEVCELIDGARVGGFEFGVQSTRGDGRHWQLRVRHTELGEPRIVASVEFARRPLALPSELLAFIQLPIHKAYGFGLPTLPVVAEAEACAEKIARYRRVALARDLYDLNHFASRTIDEPLVRRLWVLKVWGDVVDDRRGTRPLRVEDVLAARSEHDFQPDSIGVLTRPVAMAAWEARVRKRFAFLTDLDADEQRWAACDERHRREVENALAVLRS
>CP022578.1|AVO10066.1|422282_423170_+|hypothetical-protein
MVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSRDRGESVWAPEYQLVDELVVPLLRVIGKA
>CP022578.1|AVO06760.1|421432_421978_+|DUF1802-domain-containing-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHRLAVLVVCAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG
>CP022578.1|AVO06768.1|432474_433287_-|AAA-family-ATPase
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP022578.1|AVO06769.1|433283_434693_-|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP022578.1|AVO10068.1|434763_435372_-|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP022578.1|AVO06770.1|435791_436103_-|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP022578.1|AVO06771.1|436207_436465_-|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP022578.1|AVO06772.1|436698_437853_-|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLVAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP022578.1|AVO06773.1|438051_438243_-|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>CP022578.1|AVO10069.1|438239_438644_-|hypothetical-protein
MGRDNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>CP022578.1|AVO06774.1|438716_439082_-|histone-acetyltransferase
MGALSRPAGSWVLRARHGEHRADPGAIAAGPGPTRPDPIPVLVLARLALDRQEQGTGLGGDLLLDALIRSVAGARHYGARALVVDAIDDRAAEFYGHHGFLPLEGRRLYRRISDIARALGV
>CP022578.1|AVO06775.1|439221_439689_-|DUF1778-domain-containing-protein
MTCPSLVGLRTEAAELSYSDQPDALGVAMRERREQQNLVRPPRRNASRRINTDQTSTKYVYITYMPETLTGRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIELSEAAFRRFVAALDEPDEAAPELVRLARRKSRIPPH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022578_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022578_9

3214234-3215281

Orphan

Consensus_repeat	Method
CGGNNCCGGCGGNNNCGGCGG	CRT

16 spacers

The CRISPR arrays of CP022578_9

>merge|CP022578|9|3214234-3215281|CRT
CGGCAACGGCGGTAACGGCGGGCACGGTGCGACCAACACCGCCGCCACGGCTACGGGCGGGGCCGGCGGGGCCGGCGGGATCTTGTTCGGTACCGGTGGCAATGGCGGGACCGGCGGGATAGCCACCGGTGCTGGAGGGATCGGCGGGGCCGGCGGCGCCGGTGGGGTCTCCTTGCTGATCGGCTCCGGCGGCACCGGCGGCAACGGTGGGAACTCCATAGGCGTCGCTGGCATCGGCGGGGCCGGCGGGCGCGGCGGCGACGCCGGTTTGCTCTTCGGCGCGGCCGGCACCGGCGGCCACGGCGCCGCTGGCGGTGTCCCGGCCGGCGTCGGCGGCGCCGGCGGCAACGGCGGACTGTTCGCCAACGGCGGAGCCGGAGGGGCCGGCGGGTTCAACGCAGCCGGCGGGAACGGCGGGAACGGCGGACTGTTCGGAACTGGCGGCACCGGCGGGGCCGGCACGAACTTCGGGGCCGGTGGGAACGGCGGGAACGGCGGACTGTTCGGAGCCGGCGGCACCGGCGGCGCCGCCGGCTCGGGAGGGTCCGGGATCACCACCGGCGGCGGCGGGCACGGCGGCAACGCCGGCCTACTCTCCCTCGGCGCCTCCGGTGGCGCCGGCGGCAGCGGTGGCGCCAGCTCCCTTGCCGGCGGGGCCGGCGGAACCGGCGGGAACGGCGCCTTACTCTTCGGCTTCGGCGGCGCCGGCGGCGCCGGCGGGCACGGCGGGGCAGCACTTACCAGCATCCAGCAAGGCGGCGCCGGCGGCGCCGGCGGGAACGGCGGCTTGCTCTTCGGCTCCGCCGGCGCCGGCGGCGCCGGCGGCAGCGGTGCCAACGCTCTAGGCGCCGGTACCGGCGGCACCGGCGGTGACGGTGGCCACGCCGGGGTGTTCGGCAACGGCGGTGACGGGGGTTGCCGGCGGGTTTGGCGCCGGTACCGGCGGCAGCGGTGGTGTCGGCGGCAACGCCGTGCTGATCGGCAACGGCGGCAACGGCGGCAACGCCGGCAAAGCCGGGGCCACGCCCGGTGCCGGCGGCACCGGCGG

>CP022578|9|4|3214234-3215281|CRT
CGGCAACGGCGGTAACGGCGG	GCACGGTGCGACCAACACCGCCGCCACGGCTACGGGCGGGGCCGGCGGGGCCGGCGGGATCTTGTT
CGGTACCGGTGGCAATGGCGG	GACCGGCGGGATAGCCACCGGTGCTGGAGGGATCGGCGGGGCCGGCGGCGCCGGTGGGGTCTCCTTGCTGATCGGCTCCGG
CGGCACCGGCGGCAACGGTGG	GAACTCCATAGGCGTCGCTGGCATCGGCGGGGCCGGCGGGCGCGGCGGCGACGCCGGTTTGCTCTT
CGGCGCGGCCGGCACCGGCGG	CCACGGCGCCGCTGGCGGTGTCCCGGCCGGCGTCGG
CGGCGCCGGCGGCAACGGCGG	ACTGTTCGCCAACGGCGGAGCCGGAGGGGCCGGCGGGTTCAA
CGCAGCCGGCGGGAACGGCGG	GAACGGCGGACTGTTCGGAACTGGCGGCACCGGCGGGGCCGGCACGAACTT
CGGGGCCGGTGGGAACGGCGG	GAACGGCGGACTGTTCGGAGCCGGCGGCACCGGCGGCGCCGCCGGCTCGGGAGGGTCCGGGATCACCAC
CGGCGGCGGCGGGCACGGCGG	CAACGCCGGCCTACTCTCCCTCGGCGCCTCCGGTGGCGCCGGCGGCAGCGGTGGCGCCAGCTC
CCTTGCCGGCGGGGCCGGCGG	AACCGGCGGGAACGGCGCCTTACTCTTCGGCTTCGG
CGGCGCCGGCGGCGCCGGCGG	GCACGGCGGGGCAGCACTTACCAGCATCCAGCAAGG
CGGCGCCGGCGGCGCCGGCGG	GAACGGCGGCTTGCTCTTCGGCTCCGC
CGGCGCCGGCGGCGCCGGCGG	CAGCGGTGCCAACGCTCTAGGCGC
CGGTACCGGCGGCACCGGCGG	TGACGGTGGCCACGCCGGGGTGTT
CGGCAACGGCGGTGACGGGGG	TTGCCGGCGGGTTTGGCGCCGGTACCGG
CGGCAGCGGTGGTGTCGGCGG	CAACGCCGTGCTGATCGGCAACGG
CGGCAACGGCGGCAACGCCGG	CAAAGCCGGGGCCACGCC
CGGTGCCGGCGGCACCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
CP022578.1\|AVO09094.1\|3206773_3207682_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
CP022578.1\|AVO09088.1\|3196861_3197155_-\|type-VII-secretion-protein-EsxS	unknown	unknown	gnl\|CDD\|274862
CP022578.1\|AVO09102.1\|3217819_3218401_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
CP022578.1\|AVO09092.1\|3203041_3204658_-\|ESX-3-secretion-system-protein-eccB3	unknown	unknown	gnl\|CDD\|368288
CP022578.1\|AVO09098.1\|3215489_3215663_+\|antitoxin	unknown	unknown	unknown
CP022578.1\|AVO09103.1\|3218497_3219118_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP022578.1\|AVO09099.1\|3215686_3216115_+\|ribonuclease-VapC25	unknown	unknown	gnl\|CDD\|350245
CP022578.1\|AVO09089.1\|3197203_3198745_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP022578.1\|AVO09096.1\|3209312_3209573_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO09093.1\|3204654_3206550_-\|type-VII-secretion-AAA-ATPase-EccA	unknown	unknown	gnl\|CDD\|188437
CP022578.1\|AVO09095.1\|3207705_3209316_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP022578.1\|AVO09106.1\|3222573_3224256_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236097
CP022578.1\|AVO09105.1\|3220361_3222557_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP022578.1\|AVO09107.1\|3224291_3225485_+\|DNA-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225823
CP022578.1\|AVO09100.1\|3216154_3217075_-\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|226188
CP022578.1\|AVO09097.1\|3209606_3212315_+\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP022578.1\|AVO09090.1\|3198747_3199056_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP022578.1\|AVO09101.1\|3217164_3217890_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP022578.1\|AVO09091.1\|3199052_3203045_-\|type-VII-secretion-protein-EccC	unknown	unknown	gnl\|CDD\|274858
CP022578.1\|AVO09104.1\|3219114_3220248_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378820

Protein	Function_ID	Function_description	E-value
CP022578.1\|AVO09094.1\|3206773_3207682_-\|SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.10201e-94
CP022578.1\|AVO09088.1\|3196861_3197155_-\|type-VII-secretion-protein-EsxS	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	0.00514324
CP022578.1\|AVO09102.1\|3217819_3218401_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	5.1808e-20
CP022578.1\|AVO09092.1\|3203041_3204658_-\|ESX-3-secretion-system-protein-eccB3	gnl\|CDD\|368288	pfam05108, T7SS_ESX1_EccB, Type VII secretion system ESX-1, transport TM domain B. EccB is a family of largely Gram-positive bacterial transmembrane componenets of the type VII secretion system characterized in Mycobacterium tuberculosis, systems ESX1-5. Translocation of virulent peptides through the membranes is thought to be mediated via a complex that includes EccB, EccC, EccD, EccE, and MycP. EccB, EccC, EccD, and EccE form a stable complex in the mycobacterial cell envelope.	0
CP022578.1\|AVO09103.1\|3218497_3219118_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.87158e-12
CP022578.1\|AVO09099.1\|3215686_3216115_+\|ribonuclease-VapC25	gnl\|CDD\|350245	cd18678, PIN_MtVapC25_VapC33-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC25, VapC33, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC25, VapC29, VapC33, VapC37, and VapC39 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.23805e-60
CP022578.1\|AVO09089.1\|3197203_3198745_-\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.09345e-59
CP022578.1\|AVO09093.1\|3204654_3206550_-\|type-VII-secretion-AAA-ATPase-EccA	gnl\|CDD\|188437	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA. This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking].	0
CP022578.1\|AVO09095.1\|3207705_3209316_-\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.75244e-73
CP022578.1\|AVO09106.1\|3222573_3224256_-\|acyl-CoA-synthetase	gnl\|CDD\|236097	PRK07788, PRK07788, acyl-CoA synthetase; Validated.	0
CP022578.1\|AVO09105.1\|3220361_3222557_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.76306e-158
CP022578.1\|AVO09107.1\|3224291_3225485_+\|DNA-polymerase-domain-containing-protein	gnl\|CDD\|225823	COG3285, COG3285, Predicted eukaryotic-type DNA primase [DNA replication, recombination, and repair].	2.78761e-127
CP022578.1\|AVO09100.1\|3216154_3217075_-\|DUF2236-domain-containing-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	2.89836e-118
CP022578.1\|AVO09097.1\|3209606_3212315_+\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	3.29853e-32
CP022578.1\|AVO09090.1\|3198747_3199056_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.41358e-11
CP022578.1\|AVO09101.1\|3217164_3217890_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.66172e-07
CP022578.1\|AVO09091.1\|3199052_3203045_-\|type-VII-secretion-protein-EccC	gnl\|CDD\|274858	TIGR03924, T7SS_EccC_a, type VII secretion protein EccCa. This model represents the N-terminal domain or EccCa subunit of the type VII secretion protein EccC as found in the Actinobacteria. Type VII secretion is defined more broadly as including secretion systems for ESAT-6-like proteins in the Firmicutes as well as in the Actinobacteria, but this family does not show close homologs in the Firmicutes. [Protein fate, Protein and peptide secretion and trafficking].	0
CP022578.1\|AVO09104.1\|3219114_3220248_+\|alpha/beta-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	0.00172554

>CP022578.1|AVO09097.1|3209606_3212315_+|PE-family-protein
MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQAQAFHAQFTQALTSGGGAYAAAEAAATSPLLAPINEFFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGAGGGVVALTGGAGGAGGAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGAGGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGGNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGGQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGNGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLNVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGGAGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGNAGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLFGAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSLGASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGMLSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP
>CP022578.1|AVO09096.1|3209312_3209573_-|hypothetical-protein
MPTRGTSPAKIGGLQNNSGPGKGFGISQNISHIYAVGASADGSWQHPWAGAERSLVSGWDLHCGAPWCGIVVMKIMFISPLWCLRL
>CP022578.1|AVO09095.1|3207705_3209316_-|PPE-family-protein
MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADELIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAAMPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAVASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGTMNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQKLFVNPVEAFQFYFELLLFDYPTHIVQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLPAVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGFGSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDPDWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVPGSWDPDRDAPGSAEPGDRG
>CP022578.1|AVO09094.1|3206773_3207682_-|SAM-dependent-methyltransferase
MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFCRAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILAAGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQALRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYAAKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVPGPESEAGPMFARNTLVSAARV
>CP022578.1|AVO09093.1|3204654_3206550_-|type-VII-secretion-AAA-ATPase-EccA
MAGVGAGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCCRALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTATTAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHVVSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTALARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQLAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTSHELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA
>CP022578.1|AVO09092.1|3203041_3204658_-|ESX-3-secretion-system-protein-eccB3
MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR
>CP022578.1|AVO09091.1|3199052_3203045_-|type-VII-secretion-protein-EccC
MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPYLIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRHTVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARNLSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSRWDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKLIATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFGDARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS
>CP022578.1|AVO09090.1|3198747_3199056_-|PE-family-protein
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
>CP022578.1|AVO09089.1|3197203_3198745_-|PPE-family-protein
MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK
>CP022578.1|AVO09088.1|3196861_3197155_-|type-VII-secretion-protein-EsxS
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
>CP022578.1|AVO09098.1|3215489_3215663_+|antitoxin
MIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSEVLDEGLELNSRK
>CP022578.1|AVO09099.1|3215686_3216115_+|ribonuclease-VapC25
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI
>CP022578.1|AVO09100.1|3216154_3217075_-|DUF2236-domain-containing-protein
MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMGVALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQKAAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEADHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRGIALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPRFVREFPFNLMLWDLDRRMRRGRPLV
>CP022578.1|AVO09101.1|3217164_3217890_+|TetR/AcrR-family-transcriptional-regulator
MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIRTICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANIVRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVAHFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDPQPPEVAGQPPSSARPARRS
>CP022578.1|AVO09102.1|3217819_3218401_-|VOC-family-protein
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR
>CP022578.1|AVO09103.1|3218497_3219118_+|TetR/AcrR-family-transcriptional-regulator
MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN
>CP022578.1|AVO09104.1|3219114_3220248_+|alpha/beta-hydrolase
MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPKVALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLREVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAHPGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTITDWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAHGIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLASSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR
>CP022578.1|AVO09105.1|3220361_3222557_+|acyl-CoA-dehydrogenase
MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQAAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQAKVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDEWVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDAGESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGWVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLLPPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
>CP022578.1|AVO09106.1|3222573_3224256_-|acyl-CoA-synthetase
MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLEPPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLLAKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVIIYDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRASIIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALAMFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIVFVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTVKILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVSGRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLDEDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL
>CP022578.1|AVO09107.1|3224291_3225485_+|DNA-polymerase-domain-containing-protein
MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYYLAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEAVIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVREVLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWKEEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRLADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWRDRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022578_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022578_10

3848103-3848191

Orphan

Consensus_repeat	Method
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022578_10

>merge|CP022578|10|3848103-3848191|CRISPRCasFinder
GGCCGTCATCCGGCCCGCATCGTCGCCGAGCTCGGTTCGATTGCTCGGCTCCTCCTCGGGCCGTCATCCGGCCCGCATCGTCGCCGAGC

>CP022578|10|7|3848103-3848191|CRISPRCasFinder
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC	TCGGTTCGATTGCTCGGCTCCTCCTCG
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP022578.1\|AVO09580.1\|3846539_3847523_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP022578.1\|AVO09584.1\|3851342_3851612_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO09587.1\|3856833_3857604_+\|oxidoreductase	unknown	unknown	unknown
CP022578.1\|AVO09583.1\|3849121_3851077_-\|acetyl-coenzyme-A-synthetase	unknown	unknown	gnl\|CDD\|234677
CP022578.1\|AVO09581.1\|3847523_3848042_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
CP022578.1\|AVO09582.1\|3848387_3849086_+\|protease	unknown	unknown	unknown
CP022578.1\|AVO09588.1\|3858358_3859222_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273654
CP022578.1\|AVO09578.1\|3843711_3844395_+\|thioredoxin	unknown	unknown	gnl\|CDD\|239264
CP022578.1\|AVO10472.1\|3855190_3856837_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
CP022578.1\|AVO09589.1\|3859304_3859499_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO10471.1\|3845353_3846547_+\|acid-resistance-periplasmic-serine-protease-MarP	unknown	unknown	gnl\|CDD\|379142
CP022578.1\|AVO09576.1\|3842489_3842867_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO09573.1\|3840354_3840810_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
CP022578.1\|AVO09574.1\|3840816_3841611_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
CP022578.1\|AVO09575.1\|3841716_3842391_-\|cAMP-receptor-protein	unknown	unknown	gnl\|CDD\|223736
CP022578.1\|AVO09585.1\|3851784_3853410_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173853
CP022578.1\|AVO10473.1\|3854393_3855194_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
CP022578.1\|AVO09586.1\|3853411_3854338_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP022578.1\|AVO09577.1\|3842974_3843712_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
CP022578.1\|AVO09579.1\|3844526_3845348_+\|coenzyme-A-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518

Protein	Function_ID	Function_description	E-value
CP022578.1\|AVO09580.1\|3846539_3847523_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.34553e-25
CP022578.1\|AVO09583.1\|3849121_3851077_-\|acetyl-coenzyme-A-synthetase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
CP022578.1\|AVO09581.1\|3847523_3848042_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	8.41555e-32
CP022578.1\|AVO09588.1\|3858358_3859222_-\|hypothetical-protein	gnl\|CDD\|273654	TIGR01490, Uncharacterized_protein_Rv3661/MT3761, HAD-superfamily subfamily IB hydrolase, TIGR01490. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled here are all bacterial. The IB subfamily includes the enzyme phosphoserine phosphatase (TIGR00338). Due to this relationship, several of these sequences have been annotated as "phosphoserine phosphatase related proteins," or "Phosphoserine phosphatase-family enzymes." There is presently no evidence that any of the enzymes in this model possess PSPase activity. OMNI\|NTL01ML1250 is annotated as a "possible transferase," however this is due to the C-terminal domain found on this sequence which is homologous to a group of glycerol-phosphate acyltransferases (between trusted and noise to TIGR00530). A subset of these sequences including OMNI\|CC1962, the Caulobacter crescentus CicA protein cluster together and may represent a separate equivalog. [Unknown function, Enzymes of unknown specificity].	5.37865e-86
CP022578.1\|AVO09578.1\|3843711_3844395_+\|thioredoxin	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.72736e-22
CP022578.1\|AVO10472.1\|3855190_3856837_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
CP022578.1\|AVO10471.1\|3845353_3846547_+\|acid-resistance-periplasmic-serine-protease-MarP	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	2.19977e-19
CP022578.1\|AVO09573.1\|3840354_3840810_+\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	7.62827e-68
CP022578.1\|AVO09574.1\|3840816_3841611_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.29322e-75
CP022578.1\|AVO09575.1\|3841716_3842391_-\|cAMP-receptor-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	3.59113e-55
CP022578.1\|AVO09579.1\|3844526_3845348_+\|coenzyme-A-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	1.0647e-47
CP022578.1\|AVO10473.1\|3854393_3855194_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.07199e-77
CP022578.1\|AVO09586.1\|3853411_3854338_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.57934e-99
CP022578.1\|AVO09577.1\|3842974_3843712_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	3.2984e-106
CP022578.1\|AVO09585.1\|3851784_3853410_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.27273e-122

>CP022578.1|AVO09581.1|3847523_3848042_-|phage-holin-family-protein
MSKIDRKNGVPSTLTTIPLADPHAGPAEPSIGDLIKDATTQMSTLVRAEVELARAEITRDVKKGLTGSVFFISSLVVGFYSTFFFFFFVAELLDTWIWRWVAFLLVFAIMVVVTAVLALLGFLKVRRIRGPRQTIASVKETRTALTPGHDKTPVTPKPVTSDRATPVDPSGW
>CP022578.1|AVO09580.1|3846539_3847523_-|alpha/beta-hydrolase
MAAPDPSMTRIAGPWRHLDVHANGIRFHVVEAVPSGQPEGPDAATPPMQPALARPLVILLHGFGSFWWSWRHQLCGLTGARVVAVDLRGYGGSDKPPRGYDGWTLAGDTAGLIRALGHPSATLVGHADGGLACWTTALLHSRLVRAIALISSPHPAALRRSTLTRRDQRHALLPTLLRYQLPIWPERLLTRNNAAEIERLVRARGCAKWLASEDFSQAIDHLRQAIQIPAAAHCALEYQRWAVRSQLRSEGRRFIRAMTQQLGMPLLHLRGDADPYVLADPVERTQRYAPHGRYISIAGAGHFSHEEAPEEVNRHLMRFLEQVHQLS
>CP022578.1|AVO10471.1|3845353_3846547_+|acid-resistance-periplasmic-serine-protease-MarP
MTPSQWLDIAVLAVAFIAAISGWRAGALGSMLSFGGVLLGATAGVLLAPHIVSQISAPRAKLFAALFLILALVVVGEVAGVVLGRAVRGAIRNRPIRLIDSVIGVGVQLVVVLTAAWLLAMPLTQSKEQPELAAAVKGSRVLARVNEAAPTWLKTVPKRLSALLNTSGLPAVLEPFSRTPVIPVASPDPALVNNPVVAATEPSVVKIRSLAPRCQKVLEGTGFVISPDRVMTNAHVVAGSNNVTVYAGDKPFEATVVSYDPSVDVAILAVPHLPPPPLVFAAEPAKTGADVVVLGYPGGGNFTATPARIREAIRLSGPDIYGDPEPVTRDVYTIRADVEQGDSGGPLIDLNGQVLGVVFGAAVDDAETGFVLTAGEVAGQLAKIGATQPVGTGACVS
>CP022578.1|AVO09579.1|3844526_3845348_+|coenzyme-A-pyrophosphatase
MSAGGTPLQAGATPTGSRGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRLPADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPEAGPGDGGVPDDADLLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRLHPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAFINPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQPWDSGDIRELDAAMVLIDDESDPR
>CP022578.1|AVO09578.1|3843711_3844395_+|thioredoxin
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG
>CP022578.1|AVO09577.1|3842974_3843712_+|endonuclease-III
MRGRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILSAQSTDKRVNLTTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASLIGLGQALVERFGGEVPATMDKLVTLPGVGRKTANVILGNAFGIPGITVDTHFGRLVRRWRWTTAEDPVKVEQAVGELIERKEWTLLSHRVIFHGRRVCHARRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLLALAGL
>CP022578.1|AVO09576.1|3842489_3842867_-|hypothetical-protein
MFTLLVSWLLVACVPGLLMLATLGLGRLERFLARDTVTATDVAEFLEQAEAVDVHTLARNGMPEALDYLHRRQARRITDSPPLGSGAGPRYAGPLFVTDLDSPVEPPRHGQPNPQFRTARHANHV
>CP022578.1|AVO09575.1|3841716_3842391_-|cAMP-receptor-protein
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGNRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
>CP022578.1|AVO09574.1|3840816_3841611_+|MBL-fold-metallo-hydrolase
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR
>CP022578.1|AVO09573.1|3840354_3840810_+|RidA-family-protein
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPEEGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVFGDSGAHARSAVGVSELPLDAPVEVELIVEVG
>CP022578.1|AVO09582.1|3848387_3849086_+|protease
MQTAHRRFAAAFAAVLLAVVCLPANTAAADDKLPLGGGAGIVVNGDTMCTLTTIGHDKNGDLIGFTSAHCGGPGAQIAAEGAENAGPVGIMVAGNDGLDYAVIKFDPAKVTPVAVFNGFAINGIGPDPSFGQIACKQGRTTGNSCGVTWGPGESPGTLVMQVCGGPGDSGAPVTVDNLLVGMIHGAFSDNLPSCITKYIPLHTPAVVMSINADLADINAKNRPGAGFVPVPA
>CP022578.1|AVO09583.1|3849121_3851077_-|acetyl-coenzyme-A-synthetase
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWSGAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
>CP022578.1|AVO09584.1|3851342_3851612_-|hypothetical-protein
MLATHRDCASQGKTSPDRALLACGILEEDRWCRRCGEEGSPRDTVTRRLTHWCGLHPGVSVDHSCLSRCCRLDCRRRGPAVPQRDPPRR
>CP022578.1|AVO09585.1|3851784_3853410_+|ABC-transporter-substrate-binding-protein
MVRRMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTGTNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGWKFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKSRTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFGRNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFYANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDTPLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPGFDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVDAVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWRGDYPSMIEFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRILFHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
>CP022578.1|AVO09586.1|3853411_3854338_+|ABC-transporter-permease
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG
>CP022578.1|AVO10473.1|3854393_3855194_+|ABC-transporter-permease
MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA
>CP022578.1|AVO10472.1|3855190_3856837_+|ABC-transporter-ATP-binding-protein
MSVPAAPLLSVEGLEVTFGTDAPAVCGVDLAVRSGQTVAVVGESGSGKSTTAAAILGLLPAGGRITAGRVVFDGRDITGADAKRLRSIRGREIGYVPQDPMTNLNPVWKVGFQVTEALRANTDGRAARRRAVELLAEAGLPDPAKQAGRYPHQLSGGMCQRALIAIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQGLTDELGTALLLITHDLALAAQRAEAVVVVRRGVVVESGAAQSILQSPQHEYTRRLVAAAPSLTARSRRPPESRSRATTQAGDILVVSELTKIYRESRGAPWRRVESRAVDGVSFRLPRASTLAIVGESGSGKSTLARMVLGLLQPTSGTVVFDGTYDVGALARDQVLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRVHHVGDRRQRQRAVRELVDQVALPSSILGRRPRELSGGQRQRVAIARALALRPEVLVCDEAVSALDVLVQAQILDLLADLQADLGLTYLFISHDLAVIRQIADDVLVMRAGRVVEHASTEEVFSRPRHEYTRQLLQAIPGAPSAPRKVGNL
>CP022578.1|AVO09587.1|3856833_3857604_+|oxidoreductase
MTVDPLAPLMELPGVAAASDRVRDALSRVHRHRANLRGWPVAAAEASLRAARASSVLDGGPARLHDAGAPTSGKPALSDPVFAGALRVGQALEGGAGPVVGVWRRAPLQALARLHMLAAADQVDDDRLGRPRSDADVGPRLELLADVVTHPTLASAPVVAAVAHGELLTLRPFGCADGVVARAVSRLVTIATGLDPHGLGVPEVIWMRQPAEYHDAARRFAGGTPDGVAGWLLLCCGAMLDGAREALSIAESLSPG
>CP022578.1|AVO09588.1|3858358_3859222_-|hypothetical-protein
MTVSDSPAQRQTPPQTPGGTAPRARTAAFFDLDKTIIAKSSTLAFSKPFFAQGLLNRRAVLKSSYAQFIFLLSGADHDQMDRMRTHLTNMCAGWDVAQVRSIVNETLHDIVTPLVFAEAADLIAAHKLCGRDVVVVSASGEEIVGPIARALGATHAMATRMIVEDGKYTGEVAFYCYGEGKAQAIRELAASEGYPLEHCYAYSDSITDLPMLEAVGHASVVNPDRGLRKEASVRGWPVLSFSRPVSLRDRIPAPSAAAIATTAAVGISALAAGAVTYALLRRFAFQP
>CP022578.1|AVO09589.1|3859304_3859499_-|hypothetical-protein
MRGCQKGRPPPGGEEARVVVHQPRGVGLIHPRLWPSNAYYTHDSAQSRKYRTQWKAQLEPCKCS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP022578_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022578_11

4009084-4010248

Orphan

Consensus_repeat	Method
GCCGCCGNNNCCGCCGGNGCCGCCNNNGCCGCCGGNNCCGCCG	CRT

14 spacers

The CRISPR arrays of CP022578_11

>merge|CP022578|11|4009084-4010248|CRT
GCCGCCGTTACCACCGTTACCACCGTCGCCGCCGTCGCCGACGCCGGTGGCTGCCCCTCCGTCGGCGCCATCGCCGCCGTCACCGCCGGCGCCGCCTTTGCCGCCGGTGCCGCTGCCGGTGGGCGCGCCGCCGCTGCCGCCGGGCCCGCCTGTGCCGCCGGTCCCGCCGCTGCCGCCGTTGCCGTTGGTGCCGCCTTTTCCTCCGACCCCGGCGTTGCCGCCGTCACCGCCGGGCCCGCCGTCGCCAGCGATGCCGCCCATGCCGCCTTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGTTGAAGTTGGCCCCGCCGCTACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTTGCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCGGTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCGGCGCCGGAGCCGTTGGTGCCGCCGGTGCCGGCGTTGCCGCCGGCCCCGCCTTTGCCGCCGGCCCCGCCGGCAAAGCCGGGCTGGCCGCCCAATCCGGAACCGCTGTCTCCTTGGCCGCCGTTACCGCCTTGGCCGCCGTCACCGCCGATGCCCGCGTTGCCTGCGGTGCCGCCGGTGTTGGCTAGGCCGCCGGCGCCGGCGTTGCCGCCGGCCCCGCCTGTGCCGCCGGTCCCGCCGGCGGAGTCGTCGCCGGCCCCGCCGGTGCCGCCTTTGCCGCCAGTGCCGCCGGTGCCGCCGGTGCCGCTGGTGGCGCTGCTGAGTCCGTCGGTGTTTAGGCCGCCGTTGCCGCCGTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGTTGAAGTTGGCCCCGCCGCTACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTTGCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCGGTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCGGCGCCGCCGGAGCCGTTGGTGCCGCCG

>CP022578|11|5|4009084-4010248|CRT
GCCGCCGTTACCACCGTTACCACCGTCGCCGCCGTCGCCGACG	CCGGTGGCTGCCCCTCCGTCGGCGCCATC
GCCGCCGTCACCGCCGGCGCCGCCTTTGCCGCCGGTGCCGCTG	CCGGTGGGCGCGCCGCCGCTGCCGCCGGGCCCGCCTGTGCCGCCGGTCCCGCCGCT
GCCGCCGTTGCCGTTGGTGCCGCCTTTTCCTCCGACCCCGGCG	TTGCCGCCGTCACCGCCGGGCCCGCCGTCGCCAGCGATGCCGCCCATGCCGCCTTT
GCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCG	TTGAAGTTGGCCCCGCCGCT
ACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCG	GTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTT
GCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCG	GTGCCGCCGTTGCTGCCGTTGCTGAAGCT
GATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCG	GCGCCGGAGCCGTTGGTGCCGCCGGT
GCCGGCGTTGCCGCCGGCCCCGCCTTTGCCGCCGGCCCCGCCG	GCAAAGCCGGGCTGGCCGCCCAATCCGGAACCGCT
GTCTCCTTGGCCGCCGTTACCGCCTTGGCCGCCGTCACCGCCG	ATGCCCGCGTTGCCTGCGGTGCCGCCGGTGTTGGCTAGGCCGCCGGC
GCCGGCGTTGCCGCCGGCCCCGCCTGTGCCGCCGGTCCCGCCG	GCGGAGTCGTCGCCGGCCCCGCCGGT
GCCGCCTTTGCCGCCAGTGCCGCCGGTGCCGCCGGTGCCGCTG	GTGGCGCTGCTGAGTCCGTCGGTGTTTAGGCCGCCGTT
GCCGCCGTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCG	TTGAAGTTGGCCCCGCCGCTACCGCCGGC
CCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCT	TTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTT
GCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCG	GTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTG
TCCGCCGGCCCCGCCGGCGCCGCCGGAGCCGTTGGTGCCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
CP022578.1\|AVO09714.1\|3998504_3999689_-\|acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181378
CP022578.1\|AVO09719.1\|4006747_4008394_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236100
CP022578.1\|AVO09724.1\|4022066_4023614_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236063
CP022578.1\|AVO10490.1\|4000785_4001697_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|224462
CP022578.1\|AVO09729.1\|4035980_4037183_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP022578.1\|AVO09726.1\|4028933_4033085_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP022578.1\|AVO09728.1\|4034834_4035956_-\|acyl-CoA-dehydrogenase-FadE27	unknown	unknown	gnl\|CDD\|224871
CP022578.1\|AVO09725.1\|4023780_4028643_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP022578.1\|AVO09722.1\|4014451_4020874_-\|PE-PGRS-family-protein	unknown	unknown	gnl\|CDD\|376422
CP022578.1\|AVO09717.1\|4002957_4003668_-\|acetoacetate-decarboxylase	unknown	unknown	gnl\|CDD\|377649
CP022578.1\|AVO10492.1\|4005882_4006674_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181122
CP022578.1\|AVO09715.1\|3999705_4000770_-\|lipid-transfer-protein	unknown	unknown	gnl\|CDD\|181173
CP022578.1\|AVO09727.1\|4033255_4034764_-\|long-chain-fatty-acid--CoA-ligase-FadD17	unknown	unknown	gnl\|CDD\|236120
CP022578.1\|AVO09721.1\|4013666_4014323_+\|fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|236100
CP022578.1\|AVO09716.1\|4001849_4002893_+\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274647
CP022578.1\|AVO09730.1\|4037397_4037589_+\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
CP022578.1\|AVO09720.1\|4008390_4008609_+\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO09718.1\|4003696_4004893_+\|cytochrome-P450-monooxygenase-Cyp142	unknown	unknown	gnl\|CDD\|225035
CP022578.1\|AVO10491.1\|4004947_4005787_-\|hypothetical-protein	unknown	unknown	unknown
CP022578.1\|AVO09723.1\|4021233_4022070_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070

Protein	Function_ID	Function_description	E-value
CP022578.1\|AVO09714.1\|3998504_3999689_-\|acetyl-CoA-acetyltransferase	gnl\|CDD\|181378	PRK08313, PRK08313, thiolase domain-containing protein.	0
CP022578.1\|AVO09719.1\|4006747_4008394_+\|acyl-CoA-synthetase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	0
CP022578.1\|AVO09724.1\|4022066_4023614_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236063	PRK07586, PRK07586, acetolactate synthase large subunit.	0
CP022578.1\|AVO09718.1\|4003696_4004893_+\|cytochrome-P450-monooxygenase-Cyp142	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.72638e-107
CP022578.1\|AVO09729.1\|4035980_4037183_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.72908e-173
CP022578.1\|AVO09726.1\|4028933_4033085_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.56038e-30
CP022578.1\|AVO09728.1\|4034834_4035956_-\|acyl-CoA-dehydrogenase-FadE27	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.51968e-48
CP022578.1\|AVO09722.1\|4014451_4020874_-\|PE-PGRS-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	5.90651e-33
CP022578.1\|AVO09717.1\|4002957_4003668_-\|acetoacetate-decarboxylase	gnl\|CDD\|377649	pfam06314, ADC, Acetoacetate decarboxylase (ADC). This family consists of several acetoacetate decarboxylase (ADC) proteins (EC:4.1.1.4).	9.37323e-27
CP022578.1\|AVO10492.1\|4005882_4006674_-\|enoyl-CoA-hydratase	gnl\|CDD\|181122	PRK07799, PRK07799, crotonase/enoyl-CoA hydratase family protein.	0
CP022578.1\|AVO09715.1\|3999705_4000770_-\|lipid-transfer-protein	gnl\|CDD\|181173	PRK07937, PRK07937, lipid-transfer protein; Provisional.	0
CP022578.1\|AVO09727.1\|4033255_4034764_-\|long-chain-fatty-acid--CoA-ligase-FadD17	gnl\|CDD\|236120	PRK07867, PRK07867, acyl-CoA synthetase; Validated.	0
CP022578.1\|AVO09721.1\|4013666_4014323_+\|fatty-acid--CoA-ligase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	8.05622e-104
CP022578.1\|AVO09716.1\|4001849_4002893_+\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274647	TIGR03559, F420_Rv3520c, probable F420-dependent oxidoreductase, Rv3520c family. Members of this protein family are predicted to be oxidoreductases dependent on coenzyme F420. The family includes a single member in Mycobacterium tuberculosis (Rv3520c/MT3621) but four in Mycobacterium smegmatis. Prediction that this family is F420-dependent is based primarily on Partial Phylogenetic Profiling vs. F420 biosynthesis. [Unknown function, Enzymes of unknown specificity].	0
CP022578.1\|AVO09730.1\|4037397_4037589_+\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	6.5974e-14
CP022578.1\|AVO10490.1\|4000785_4001697_-\|DNA-binding-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	9.89177e-41
CP022578.1\|AVO09725.1\|4023780_4028643_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.63447e-28
CP022578.1\|AVO09723.1\|4021233_4022070_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	2.24025e-81

>CP022578.1|AVO09720.1|4008390_4008609_+|hypothetical-protein
MMGAAATGSGHPARKVDMGRLSCLSGAEPTSMWMEVRHGCSRASRNSCGGFAEAGPHLIDGHRAALPGVAIG
>CP022578.1|AVO09719.1|4006747_4008394_+|acyl-CoA-synthetase
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKYDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVLPDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSATWMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLFLLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHRTVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGG
>CP022578.1|AVO10492.1|4005882_4006674_-|enoyl-CoA-hydratase
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMGLIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVFLSDDAKEGPRAFAEKRAPNFQNR
>CP022578.1|AVO10491.1|4004947_4005787_-|hypothetical-protein
MIEPFLGSEAIASGALTRHRLRSAYATIHPDVYVSPGADLTAWSRAQAAWLWSRRRGVIAGQSAAAMHGAKWVDARQAAELLYDHRRPPAGIHTWSDRVADDEIQPISGMNTTTPARTALDLARRYPVGKAVAAIDALARATDLKLADVEMLAERYRGSRGIRNARIALDLVDPGAESPRETWLRLLLIRAGFPRPQTQIPVYDEYGQLVAVIDMGWAGIKVGVDYEGDHHRTDRRTFNKDIKRAEALTELGWTDVRVTVEDTEGGIIWRVSAAWQRRT
>CP022578.1|AVO09718.1|4003696_4004893_+|cytochrome-P450-monooxygenase-Cyp142
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG
>CP022578.1|AVO09717.1|4002957_4003668_-|acetoacetate-decarboxylase
MPVSQHTIAGTVLTMPVRIRTGNLHSAMFSVPADPAQRLIDYSGLRVCEYLPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAFIHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGIEFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLGDHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
>CP022578.1|AVO09716.1|4001849_4002893_+|LLM-class-F420-dependent-oxidoreductase
MEAGMKLGLQLGYWGAQPPQNHAELVAAAEDAGFDTVFTAEAWGSDAYTPLAWWGSSTQRVRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQVVEGWYGQRFPKPLARTREYIDIVRQVWARESPVTSAGPHYRLPLTGEGTTGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFYSPRMAGMYNEWLDEGFARPGARRSREDFEICATAQVVITDDRAAAFAGIKPFLALYMGGMGAEETNFHADVYRRMGYTQVVDEVTKLFRSGRKDEAAEIIPDELVDDAVIVGDIDHVRKQMAVWEAAGVTMMVVTAGSAEQVRDLAALV
>CP022578.1|AVO10490.1|4000785_4001697_-|DNA-binding-protein
MGPTLSRFFTALRARRIVGVRGSDGRVHVPPVEYDPVTYEPLSEMVPVSSVGTVASWTWQPEPLAGQPLDRPFAWALIKLDGADTLLMHAVDVGTAGPSAIHTGARVHAHWADQPVGAITDIACFALGETAEPVAAHKTEDARDPVTMIVTPIQLEIQHTASHEESAYLRAIAQGKLVGARTGKTGKVYFPPHGADPATGKPTSEFVELPDKGTVTTFAIVNIPFLGQRIKPPYVAAYVLLDGADIPFLHLVSDVDAHQVRMGMRVEAVWKPRERWGLGIDNIEYFRPTGEPDADYDTYKHHL
>CP022578.1|AVO09715.1|3999705_4000770_-|lipid-transfer-protein
MSVRDIAVVGFAHAPHVRRTDGTTNGVEMLMPCFAQLYDELGITKADIGFWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKLLTGEVDTALVYGFGKSSAGTLRRVLSRQTDPYTVAPLWPDSVSMAGLQARLGLDSGKWTHEQMARVAFDSFTNARRVDSVEPPITVGELLARPFFADPLRRHDIAPITDGAAAVVLAADNRARELRENPAWITGIEHRIESPALGARDITESPSTKLAAKIATGGHTGDIDVAEIHGPFTHQHLIVAEAIRIPGKTKVNPSGGPLAANPMFAAGLERIGFAAQHIWDGSARRVLAHATSGPALQQNLVAVMEGRG
>CP022578.1|AVO09714.1|3998504_3999689_-|acetyl-CoA-acetyltransferase
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFEGVMMPELLMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAHLQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGTALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENLGFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQVPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
>CP022578.1|AVO09721.1|4013666_4014323_+|fatty-acid--CoA-ligase
MAASLSENLSCHSSNMCRLSGNAATNLERPGEEPPGDRCTRRQAVRPARTLAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGS
>CP022578.1|AVO09722.1|4014451_4020874_-|PE-PGRS-family-protein
MSFVLISPEVVSAAAGDLANVGSTISAANKAAAAATTQVLAAGADEVSARIAALFGMYGLEYQAISAQVAAYHQQFVQTLRTGAASYMLAEATNVEQNLLNLINAPTQTLLGRPLIGDGANATTPGGAGGDGGLLFGSGGNGAPGAPGQAGGAGGSAGLLGNGGSGGAGGTGAPGGNGGNAGWLYGRGGVGGAGGIGGGTGGAGGHAWLFGHGGTGGIGGGPGGNGGWLLGNGGHGGAGGIGGGSGGAGGNGGWLLGNGGIGGAGGTGGGAGGTGGNAAWLLGGGGTGGAGGIGGGNGGHGGNGGWLLGNGGNGGLGGDGDGGTGGGHGGNGGNPGWLLGTAGGGGNGGAGSTGTAGGGSGGTGGDGGTGGRGGLLMGAGAGGHGGTGGAGGAGVDGGGAGGAGGAGGNGGAGGQAALLFGRGGTGGAGGYGGDGGGGGDGFDGTMAGLGGTGGSGGTGGDGGAPGNGGAGGAGQLLSHSGVAGASGKGGAGGTGGNGGAGSAGADAPAGSGAMGSTGFAGGAGGDGGNGGGSGASQGNGGNGGNGGTGGKGGTGMNSLDPLLAAQDGGQGGTGGTGGNAGAGGTGFTQGADGNAGNGGDGGVGGNGGNGADNTTTAAAGTTGGDGGAGGAGGTGGTGGAAGTGTGGQQGTGGQQGNGGNGGTGGTGGTGGAGMNSLDPLLAAQDGGQGGTGGTGGNAGAGGTGFTQGADGNAGNGGDGGVGGNGGNGADNTTTAAAGTTGGAGGAGGAGGTGGTGGAAGTGTGGQQGNGGNGGNGGTGGKGGTGMNSLDPLLAAQDGGQGGTGGTGGNAGAGGTGFTQGADGNAGNGGDGGVGGNGGNGADNTTTAAAGTTGGAGGAGGAGGTGGTGGAAGTGTGGQQGNGGNGGNGGTGGKGGTGGAGMNSLDPLLAAQDGGQGGTGGTGGNAGAGGTGFTQGADGNAGNGGDGGVGGNGGNGADNTTTAAAGTTGGAGGAGGAGGTGGTGGAAGTGTGGQQGNGGNGGNGGTGGKGGTGGAGMNSLDPLLAAQDGGQGGTGGTGGNAGAGGTGFTQGADGNAGNGGDGGVGGNGGNGADNTTTAAAGTTGGDGGAGGAGGTGGTGGAAGTGTGGQQGNGGNGGNGGTGGKGGTGGDGALAGSSGGAGGKGGNGGDAGKAGTGSAPGTAGTGGDGGKGGNGGIGAAGTTGPVGTGASGGTGGSGGAGGTGGDGGAANGGTAGAGGAGGNGGKGGDGGAGVTSSTAGNSGGAGGSGGKGGDAGAGGAGATPGANGIAGNGGDGGDGAAGAVGISGATGAGDGGHGGTGGAGGNGGTGGAGGSGIDGVGGGTGGTGGNGGNGAIGGAGGDAGGSGNSGGNGGTGGKGGNAGAGGAAGSNGGTVGANGTGGDGGNGGAAGAATAGSNGGAGTGSAGGNGGTGGRGGSGGAGGDGIGGVGGGKGGNGADGEVGGAGGAGGSGPNTSPGGNGGQGGQGGSGGAGGAAGAGGAGGGANGTAGNGGQGGAGGTGGAGAASSATNGGSGGAGGSGGAGGTGGAGGTGGAGGDGVGGAGGGNGGHGGDAGDGGNGANGNNRSSGSFLAAGGTGGAAGDGGQGGQGGAGGGAGGQGGAGGAGGTGGNGGNITGGTAGTAGAAGNGGAAGKGGAGGQGGTGGGTGGQGGAGGDGGAGGTGGDRTVGGGTVPAGSGGQGGNAGGGGAGGQGGADGGSGGDGGDAGTGGNGGNGGNRNSGNGTGGAGGNGGGGANGGAGGAGGSGGGTGGNGGAGGDAGDAGNGNGTGNGGNGGNGGIAGMGGNGGAGTGSGNGGNGGSGGNGGNAGMGGNSGTGSGDGGAGGNGGAAGTGGTGGDGGLTGTGGTGGSGGTGGDGGNGGNGADNTANMTAQAGGDGGNGGDGGFGGGAGAGGGGLTAGANGTGGQGGAGGDGGNGAIGGHGPLTDDPGGNGGTGGNGGTGGTGGAGIGSLGGGTGGDGGNGGNGGTGGEGGNGGTGGEGGEVGGAGGTGGLGDPRVGGSGGDGGTGGSGGAAGNGGNGGNAGAGGNGNGGTGGAGGIGGTGGNGGDAEPGVPPGAGGAGGAGTTGGKGGTGGNGSGTGSGGTGGDGGTGGGGGNGGTGWNGGKGDTGSGGGAGDGGKAPAGGTGGAGGDGGAGGKGGSGGV
>CP022578.1|AVO09723.1|4021233_4022070_+|amidohydrolase
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
>CP022578.1|AVO09724.1|4022066_4023614_+|acetolactate-synthase-large-subunit
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYARIAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAGTVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAAPVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGIPAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGAADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGVLLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVPARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
>CP022578.1|AVO09725.1|4023780_4028643_-|PE-family-protein
MSFVLIAPEFVTAAAGDLTNLGSSISAANASAASATTQVLAAGADEVSARIAALFGGFGLEYQAISAQVAAYHQRFVQALSTGAGAYASAEAAAAEQIVLGVINAPTQALLGRPLIGDGANATTPGGAGGAGGLLFGNGGAGAAGAPGQAGGAGGPAGLWGNGGPGGAGGSGGGTGGAGGAGGWLFGVGGAGGVGGAGGGTGGAGGPGGLIWGGGGAGGVGGAGGGTGGAGGRAELLFGAGGAGGAGGAGTDGGPGATGGTGGHGGVGGDGGWLAPGGAGGAGGQGGAGGAGSDGGALGGTGGTGGTGGAGGAGGRGALLLGAGGQGGLGGAGGQGGTGGAGGDGVLGGVGGTGGKGGVGGVAGLGGAGGAAGQLFSAGGAAGAVGVGGTGGQGGAGGAGAAGADAPASTGLTGGTGFAGGAGGVGGQGGNAIAGGINGSGGAGGTGGQGGAGGMGGSGADNASGIGADGGAGGTGGNAGAGGAGGAAGTGGTGGVVGAAGKAGIGGTGGQGGAGGAGSAGTDATATGATGGTGFSGGAGGAGGAGGNTGVGGTNGSGGQGGTGGAGGAGGAGGVGADNPTGIGGTGGTGGKGGAGGAGGAGADATATGATGGTGFAGGAGGAGGQGGSSGAGGTNGSGGAGGTGGQGGAGGAGGAGADNPTGIGGAGGTGGTGGAAGAGGAGGAIGTGGTGGAVGSVGNAGIGGTGGTGGVGGAGGAGAAAAAGSSATGGAGFAGGAGGEGGAGGNSGVGGTNGSGGAGGAGGKGGTGGAGGSGADNPTGAGFAGGAGGTGGAAGAGGAGGATGTGGTGGVVGATGSAGIGGAGGRGGDGGDGASGLGLGLSGFDGGQGGQGGAGGSAGAGGINGAGGAGGNGGDGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAKAGDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSINANGGAGGNGGTGGKGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGAAGKAGGGGNGGVGGDGGEGASGLGLGLSGFDGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGGAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGNGGDGDGFIGGSGGTGGTGGDAGVGGLANTGGTAGNAGIGGAGGRGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGRAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGTGGTGGAGGDGQNGTTGVASEGGAGGQGGDGGDGGEGGGAGFGSGVAGAAGAGGNGGKGGDGGTGGTGGTNFAGGQGGAGGRGGAGGNGANGVGDNAAGGDGGNGGAGGLGGGGGTGGTNGNGGLGGGGGNGGAGGAGGTPTGSGTEGTGGDGGDAGAGGNGGSATGVGNGGNGGDGGNGGDGGNGAPGGFGGGAGAGGLGGSGAGGGTDGDDGNGGSPGTDGS
>CP022578.1|AVO09726.1|4028933_4033085_-|PE-family-protein
MSFVLVSPETVAAVATDLKRIGASLAHENASAAASTTAVVSAAADEVSTAVAALFSQHAQGYQAAAAQVAAFHSRFVQALTAGAGAYAFAEAANASPLQSAMGAVSASAQTLLSRPLIGNGANATTPGGNGGDGGWLFGSGGNGAPGAAGQSGGNGGSAGLWGNGGAGGAGGSGGAAGGNGGNGGWLFGAGGTGGIGGTGAPGAMGGTGGNGGNGALLIGGGGLGGAGGMGGTGGGTGGTGGNGGNGALLIGAGGVGGAGGIGGQGTGAGGAAGAGGTGGNGGAGGLFMNGGDGGAGGQGGDGAAGDAAASAGGTGGKGGQGGTGGMGGAGGDGTTVIAAGTGGEGGTGGAAGAGGAAGARGALTSGGLAGGVGAGGTGGTGGTGGNGADAAAVVGFGANGDPGFAGGKGGNGGIGGAAVTGGVAGDGGTGGKGGTGGAGGAGNDAGSTGNPGGKGGDGGIGGAGGAGGAAGTGNGGHAGNTGDGGDGGTGGNGGNGTGGVNGADNTLNPDTPGGAGEPGGAGGAGGAGGAAGGPGGTGGTGGNGGNGGNGGNGGNGGNAGNNSTNAPVGGEGGAGGDGGAGGAGGAANGGTAGSQGTGGVGGDGGAGGNGGGGKAGTGNSGNFGVDGEAGFSGGAGGNGGVGGAAGANGGTGGSGGNGGDGGAGGIGGAGGNGIPGTGTEPAGGTGAKGGDGGDGGAGGAGGNAGGAGGNGGAGGQGGNAGQGGAGGAGGNAVIPGDGVGKAPHGDAGGSGGDGGKGGQGGSGGTGGSGAPIGGGAGGTGGSGGHAGKGGAGGIGAQGTTITVPGNGGNAGDGGNGGGGGAGGTGGDGATGTPAGNGGDGGNGGNAGAGGNGGSGDFGGNTTSGASGSGGNGGNAGTAGSGGAGGTGGTGLSGGNGGNGGNGGNGGDGGNGAHGTVGAQFVPATSLPTPNGGAGGNGGTGSNGGAPGPAGAPGPTTGGNAGSQGIGGDGGNGGDGGKGGDGADAVNVVFMPTEPQAATGTAGSAGDPTGGNGGPGTPGSPMVAPPPPTPITQVQQGGDGGAGGTGSTNANDGTATGGKGGEGGVGSILGGPGGNGGTGGNASATGTNGVANAGNGGKGGDGGQFGAGGNGGAGGSVTDGSAGSTAGNGGNGGNATNGTIAGQPAGGNGSAGGKGGDGGNIAAGATGTAGNGGNGGNGNDGAVNAGTGGSGGNGGNAGGGGANGGDGGAGGAGGAGGRGGKGIDGGFGGDGGNGGSNNGTGAGGNGGNGGTGGVGSVGAAGGDGGNGGTGGFAGFGGTAGNGGSGGTGGAGGDGGTGGDGGNGGTGVIAGGGGTGGTGGASGAGGAGGTGGFAGNGNAGGNGGTGGASEDGDNGNAGSGATGGTGGNGGTGGDGGAAGLGGVA
>CP022578.1|AVO09727.1|4033255_4034764_-|long-chain-fatty-acid--CoA-ligase-FadD17
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
>CP022578.1|AVO09728.1|4034834_4035956_-|acyl-CoA-dehydrogenase-FadE27
MDFTTTEAAQDLGGLVDTIVDAVCTPEHQRELDKLEQRFDRELWRKLIDAGILSSAAPESLGGDGFGVLEQVAVLVALGHQLAAVPYLESVVLAAGALARFGSPELQQGWGVSAVSGDRILTVALDGEMGEGPVQAAGTGHGYRLTGTRTQVGYGPVADAFLVPAETDSGAAVFLVAAGDPGVAVTALATTGLGSVGHLELNGAKVDAARRVGGTDVAVWLGTLSTLSRTAFQLGVLERGLQMTAEYARTREQFDRPIGSFQAVGQRLADGYIDVKGLRLTLTQAAWRVAEDSLASRECPQPADIDVATAGFWAAEAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAKQTEFALGGATGQLRRIGRELAETPA
>CP022578.1|AVO09729.1|4035980_4037183_-|acyl-CoA-dehydrogenase
MRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETIAQMGRDGWLALGWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAPTIMAYGTDEQKRFFLPRIAAGDLHFSIGYSEPGAGTDLANLRTTAVRDGDDYVVNGQKMWTSLIQYADYVWLAVRTNPESSGAKKHRGISVLIVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLVTNQLNHERVALVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLKLINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRQNSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR
>CP022578.1|AVO09730.1|4037397_4037589_+|ferredoxin
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP022578.1	3212192-3212215	0	1.0
CP022578_11	11.4\|4009397\|20\|CP022578\|CRT	4009397-4009416	20	CP022578.1	4010612-4010631	0	1.0
CP022578_11	11.5\|4009460\|41\|CP022578\|CRT	4009460-4009500	41	CP022578.1	4010675-4010715	0	1.0
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	CP022578.1	4010759-4010787	0	1.0
CP022578_11	11.8\|4009685\|35\|CP022578\|CRT	4009685-4009719	35	CP022578.1	4010294-4010328	0	1.0
CP022578_11	11.9\|4009763\|47\|CP022578\|CRT	4009763-4009809	47	CP022578.1	4010372-4010418	0	1.0
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	CP022578.1	4010462-4010487	0	1.0
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	CP022578.1	4010612-4010640	0	1.0
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	CP022578.1	4010684-4010715	0	1.0
CP022578_11	11.14\|4010150\|56\|CP022578\|CRT	4010150-4010205	56	CP022578.1	4010759-4010814	0	1.0
CP022578_3	3.3\|1499755\|21\|CP022578\|CRT	1499755-1499775	21	CP022578.1	1191147-1191167	1	0.952
CP022578_3	3.3\|1499755\|21\|CP022578\|CRT	1499755-1499775	21	CP022578.1	2056047-2056067	1	0.952
CP022578_8	8.1\|3186684\|21\|CP022578\|CRISPRCasFinder	3186684-3186704	21	CP022578.1	3416532-3416552	1	0.952
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP022578.1	1125030-1125053	1	0.958
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP022578.1	2707618-2707641	1	0.958
CP022578_11	11.11\|4009922\|38\|CP022578\|CRT	4009922-4009959	38	CP022578.1	4010531-4010568	1	0.974
CP022578_3	3.3\|1499755\|21\|CP022578\|CRT	1499755-1499775	21	CP022578.1	2056206-2056226	2	0.905
CP022578_3	3.3\|1499755\|21\|CP022578\|CRT	1499755-1499775	21	CP022578.1	2387116-2387136	2	0.905
CP022578_3	3.5\|1499854\|21\|CP022578\|CRT	1499854-1499874	21	CP022578.1	2457612-2457632	2	0.905
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP022578.1	1688317-1688340	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP022578.1	2621224-2621247	2	0.917

1. spacer 9.15|3215198|24|CP022578|CRT matches to position: 3212192-3212215, mismatch: 0, identity: 1.0

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtgctgatcggcaacgg	Protospacer
************************

2. spacer 11.4|4009397|20|CP022578|CRT matches to position: 4010612-4010631, mismatch: 0, identity: 1.0

ttgaagttggccccgccgct	CRISPR spacer
ttgaagttggccccgccgct	Protospacer
********************

3. spacer 11.5|4009460|41|CP022578|CRT matches to position: 4010675-4010715, mismatch: 0, identity: 1.0

gtgccgcctttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgccgcctttgccggggtcgccggcgccggtgcctgcgtt	Protospacer
*****************************************

4. spacer 11.6|4009544|29|CP022578|CRT matches to position: 4010759-4010787, mismatch: 0, identity: 1.0

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgctgccgttgctgaagct	Protospacer
*****************************

5. spacer 11.8|4009685|35|CP022578|CRT matches to position: 4010294-4010328, mismatch: 0, identity: 1.0

gcaaagccgggctggccgcccaatccggaaccgct	CRISPR spacer
gcaaagccgggctggccgcccaatccggaaccgct	Protospacer
***********************************

6. spacer 11.9|4009763|47|CP022578|CRT matches to position: 4010372-4010418, mismatch: 0, identity: 1.0

atgcccgcgttgcctgcggtgccgccggtgttggctaggccgccggc	CRISPR spacer
atgcccgcgttgcctgcggtgccgccggtgttggctaggccgccggc	Protospacer
***********************************************

7. spacer 11.10|4009853|26|CP022578|CRT matches to position: 4010462-4010487, mismatch: 0, identity: 1.0

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagtcgtcgccggccccgccggt	Protospacer
**************************

8. spacer 11.12|4010003|29|CP022578|CRT matches to position: 4010612-4010640, mismatch: 0, identity: 1.0

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ttgaagttggccccgccgctaccgccggc	Protospacer
*****************************

9. spacer 11.13|4010075|32|CP022578|CRT matches to position: 4010684-4010715, mismatch: 0, identity: 1.0

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ttgccggggtcgccggcgccggtgcctgcgtt	Protospacer
********************************

10. spacer 11.14|4010150|56|CP022578|CRT matches to position: 4010759-4010814, mismatch: 0, identity: 1.0

gtgccgccgttgctgccgttgctgaagctgatgccagcacccccggcgccgccttg	CRISPR spacer
gtgccgccgttgctgccgttgctgaagctgatgccagcacccccggcgccgccttg	Protospacer
********************************************************

11. spacer 3.3|1499755|21|CP022578|CRT matches to position: 1191147-1191167, mismatch: 1, identity: 0.952

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgtacggc	Protospacer
************** ******

12. spacer 3.3|1499755|21|CP022578|CRT matches to position: 2056047-2056067, mismatch: 1, identity: 0.952

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgtacggc	Protospacer
************** ******

13. spacer 8.1|3186684|21|CP022578|CRISPRCasFinder matches to position: 3416532-3416552, mismatch: 1, identity: 0.952

gttgccgaagaacccggcgtt	CRISPR spacer
gttgccgacgaacccggcgtt	Protospacer
******** ************

14. spacer 9.15|3215198|24|CP022578|CRT matches to position: 1125030-1125053, mismatch: 1, identity: 0.958

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtggtgatcggcaacgg	Protospacer
********** *************

15. spacer 9.15|3215198|24|CP022578|CRT matches to position: 2707618-2707641, mismatch: 1, identity: 0.958

caacgccgtgctgatcggcaacgg	CRISPR spacer
cagcgccgtgctgatcggcaacgg	Protospacer
**.*********************

16. spacer 11.11|4009922|38|CP022578|CRT matches to position: 4010531-4010568, mismatch: 1, identity: 0.974

gtggcgctgctgagtccgtcggtgtttaggccgccgtt	CRISPR spacer
gtggcgctgctgagtccgtcggtgtttaggccgccttt	Protospacer
*********************************** **

17. spacer 3.3|1499755|21|CP022578|CRT matches to position: 2056206-2056226, mismatch: 2, identity: 0.905

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgttcggc	Protospacer
************** * ****

18. spacer 3.3|1499755|21|CP022578|CRT matches to position: 2387116-2387136, mismatch: 2, identity: 0.905

gccggcgggctgctctacggc	CRISPR spacer
gccggcggcctggtctacggc	Protospacer
******** *** ********

19. spacer 3.5|1499854|21|CP022578|CRT matches to position: 2457612-2457632, mismatch: 2, identity: 0.905

aatggcgggctgctgttcggc	CRISPR spacer
aacggcgggctgctattcggc	Protospacer
**.***********.******

20. spacer 9.15|3215198|24|CP022578|CRT matches to position: 1688317-1688340, mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccctgctgttcggcaacgg	Protospacer
******* ***** **********

21. spacer 9.15|3215198|24|CP022578|CRT matches to position: 2621224-2621247, mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caaggccgggctgatcggcaacgg	Protospacer
*** **** ***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022578_3	3.9\|1500028\|21\|CP022578\|CRT	1500028-1500048	21	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	60334-60354	1	0.952
CP022578_7	7.3\|3186282\|21\|CP022578\|CRISPRCasFinder	3186282-3186302	21	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	162990-163010	1	0.952
CP022578_7	7.3\|3186282\|21\|CP022578\|CRISPRCasFinder	3186282-3186302	21	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	334397-334417	1	0.952
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	622336-622360	2	0.92
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1218692-1218716	2	0.92
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	172932-172956	2	0.92
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1830573-1830597	2	0.92
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	275362-275386	2	0.92
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	213084-213108	2	0.92
CP022578_8	8.1\|3186684\|21\|CP022578\|CRISPRCasFinder	3186684-3186704	21	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	263134-263154	2	0.905
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	121532-121555	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	102694-102717	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	86260-86283	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	569399-569422	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	157190-157213	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	163705-163728	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2209494-2209517	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	247640-247663	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1138142-1138165	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	195459-195482	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	15605-15628	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	19538-19561	2	0.917
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NC_010355	Azospirillum phage Cd, complete genome	19538-19561	2	0.917
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP010862	Marinovum algicola DG 898 plasmid pMaD7	541-566	2	0.923
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP010862	Marinovum algicola DG 898 plasmid pMaD7	115037-115062	2	0.923
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1393349-1393371	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	44810-44832	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	176002-176024	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP011600	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence	136283-136305	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	203450-203472	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	167406-167428	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	170418-170440	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	43734-43756	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	20012-20034	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	25318-25340	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MT077884	Escherichia coli plasmid p33, complete sequence	98619-98641	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MT077886	Escherichia coli plasmid p39, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	93378-93400	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	43745-43767	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	44821-44843	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	100130-100152	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054602	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed3, complete sequence	107000-107022	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	30579-30601	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	30578-30600	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	30560-30582	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	30483-30505	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	30571-30593	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	30481-30503	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	30574-30596	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	30479-30501	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	30576-30598	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	30494-30516	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	30476-30498	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	30481-30503	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	30571-30593	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	95265-95287	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	105020-105042	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	90018-90040	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	102106-102128	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP041374	Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence	25318-25340	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	49495-49517	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	131326-131348	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP030355	Novosphingobium sp. P6W plasmid pP6W2, complete sequence	134948-134970	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	135541-135563	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	43733-43755	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042495	Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence	19986-20008	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	52890-52912	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_AP019666	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence	35068-35090	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	28882-28904	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	70393-70415	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	200679-200701	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	45068-45090	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	43747-43769	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	176160-176182	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	30480-30502	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	48684-48706	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	49139-49161	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	45065-45087	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	86243-86265	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	178730-178752	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	237499-237521	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	100158-100180	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	25318-25340	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	43739-43761	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054751	Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence	25317-25339	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054781	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence	25315-25337	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	43745-43767	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	79589-79611	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	43741-43763	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	36795-36817	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054763	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence	25320-25342	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	138756-138778	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	174467-174489	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	97842-97864	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054745	Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence	25317-25339	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054727	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence	25317-25339	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054739	Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence	25318-25340	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054775	Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence	25317-25339	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054733	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence	25316-25338	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054721	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence	25317-25339	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054757	Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence	25316-25338	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054769	Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence	25318-25340	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP022533	Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence	329552-329574	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	169697-169719	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052317	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP054064	Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence	41735-41757	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	189620-189642	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP042489	Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence	96707-96729	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052495	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence	43738-43760	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	227390-227412	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	71058-71080	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	103366-103388	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	45068-45090	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MF398271	Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence	43735-43757	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	98908-98930	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	151606-151628	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	98619-98641	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	99194-99216	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MF788071	Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence	99072-99094	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP040534	Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence	30480-30502	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MH727545	Mycobacterium phage DismalStressor, complete genome	31436-31458	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MN871473	UNVERIFIED: Pseudomonas virus Pa-Z, complete genome	34302-34324	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	KJ510412	Mycobacterium phage ZoeJ, complete genome	31097-31119	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_026598	Mycobacterium phage Milly, complete genome	31409-31431	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	AF068845	Mycobacteriophage TM4, complete genome	31079-31101	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MH834601	Mycobacterium phage BoostSeason, complete genome	31340-31362	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	KX688047	Mycobacterium phage Marcoliusprime, complete genome	31436-31458	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	KX171208	Pseudomonas phage vB_Pae436M-8, complete genome	39845-39867	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_028759	Mycobacterium phage Mufasa, complete genome	31330-31352	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK318076	Pseudomonas phage vB_PaeM_fHoPae01, complete genome	46520-46542	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MF140408	Mycobacterium phage DismalFunk, complete genome	31436-31458	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_003387	Mycobacterium phage TM4, complete genome	31079-31101	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MT119369	Pseudomonas phage sortsol, complete genome	39163-39185	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	228718-228740	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	26569-26591	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	135652-135674	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	13203-13225	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	152337-152359	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	152320-152342	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	164935-164957	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	70400-70422	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	35044-35066	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	129894-129916	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	16145-16167	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	21993-22015	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP035380	Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence	68028-68050	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	65988-66010	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	155702-155724	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	213321-213343	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	242447-242469	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	75515-75537	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	138375-138397	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_AP018757	Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence	71908-71930	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	85374-85396	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	44008-44030	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	185425-185447	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	84048-84070	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	233367-233389	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	101277-101299	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	90058-90080	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	90058-90080	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP025983	Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence	101604-101626	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	250724-250746	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	119413-119435	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	164360-164382	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	275726-275748	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	52613-52635	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP052259	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence	106040-106062	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	51437-51459	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	96984-97006	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	115656-115678	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MK715436	Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence	180751-180773	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MN058044	Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence	140988-141010	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	73197-73219	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	94082-94104	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	67641-67663	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MT090958	Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence	40792-40814	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	MT118290	Pseudomonas phage Epa10, complete genome	14177-14199	2	0.913
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	KC787101	Mycobacterium phage 33D, partial genome	17312-17334	2	0.913
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	21024-21047	2	0.917
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	18854-18877	2	0.917
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1096444-1096467	2	0.917
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	2202213-2202236	2	0.917
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2280709-2280732	2	0.917
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	MT723937	Gordonia phage JKSyngboy, complete genome	20058-20084	3	0.889
CP022578_3	3.8\|1499986\|24\|CP022578\|CRT	1499986-1500009	24	NZ_CP014599	Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence	110878-110901	3	0.875
CP022578_3	3.8\|1499986\|24\|CP022578\|CRT	1499986-1500009	24	NZ_CP028945	Vibrio sp. dhg plasmid unnamed1, complete sequence	122425-122448	3	0.875
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	196683-196707	3	0.88
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	538429-538453	3	0.88
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	216008-216032	3	0.88
CP022578_9	9.12\|3215059\|24\|CP022578\|CRT	3215059-3215082	24	MN103533	Mycobacterium phage Weirdo19, complete genome	26904-26927	3	0.875
CP022578_9	9.13\|3215104\|24\|CP022578\|CRT	3215104-3215127	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1931013-1931036	3	0.875
CP022578_9	9.13\|3215104\|24\|CP022578\|CRT	3215104-3215127	24	MN428050	Mycobacterium phage Apex, complete genome	66856-66879	3	0.875
CP022578_9	9.13\|3215104\|24\|CP022578\|CRT	3215104-3215127	24	NC_042035	Mycobacterium phage Zemanar, complete sequence	66569-66592	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1088836-1088859	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	428271-428294	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NC_022061	Mycobacterium phage KayaCho, complete genome	54386-54409	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP019938	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence	212659-212682	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	427938-427961	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1996033-1996056	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	985412-985435	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1058931-1058954	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	41184-41207	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	373463-373486	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	MK415401	Phage apr34_1789, complete genome	11948-11971	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	MK415401	Phage apr34_1789, complete genome	39191-39214	3	0.875
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	MK415401	Phage apr34_1789, complete genome	66320-66343	3	0.875
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	56824-56849	3	0.885
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	360267-360289	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	CP049262	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09b, complete sequence	65353-65375	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1056097-1056119	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP016024	Ralstonia insidiosa strain ATCC 49129 plasmid pRI-1, complete sequence	164245-164267	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	341625-341647	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	AP014203	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C76-MedDCM-OCT-S35-C25, * SEQUENCING IN PROGRESS *	14236-14258	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	887752-887774	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	KJ680225	Uncultured bacterium plasmid PLAsvaD clone PLAsvaD-1, complete sequence	11452-11474	3	0.87
CP022578_12	12.7\|4029351\|23\|CP022578\|CRT	4029351-4029373	23	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1528049-1528071	3	0.87
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	35301-35324	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	291387-291410	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	325555-325578	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	655846-655869	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	267879-267902	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1875698-1875721	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	346568-346591	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	254516-254539	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	246597-246620	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	327835-327858	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	325066-325089	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	339124-339147	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	335787-335810	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	336568-336591	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	336564-336587	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	334228-334251	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	336564-336587	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	329277-329300	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	340824-340847	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	325066-325089	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021368	Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence	148853-148876	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	334231-334254	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	336568-336591	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021364	Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence	11440-11463	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	21137-21160	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1301930-1301953	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1276369-1276392	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1369478-1369501	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	354438-354461	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1453767-1453790	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1456865-1456888	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	877468-877491	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	14409-14432	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	172006-172029	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	992654-992677	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	CP052389	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1	111819-111842	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	591834-591857	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	778719-778742	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	18093-18116	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	368858-368881	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1433221-1433244	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1206221-1206244	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1301937-1301960	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	56616-56639	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_010355	Azospirillum phage Cd, complete genome	56616-56639	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1410926-1410949	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	222044-222067	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	427361-427384	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1410904-1410927	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	228267-228290	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	641369-641392	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021026	Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence	258025-258048	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	227510-227533	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	419355-419378	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	373597-373620	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	9852-9875	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	292136-292159	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	422366-422389	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	416865-416888	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	230035-230058	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	292502-292525	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	292136-292159	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	292502-292525	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	164625-164648	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	292505-292528	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	313384-313407	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	292505-292528	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	292505-292528	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1083909-1083932	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	594657-594680	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	772752-772775	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	674210-674233	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	303720-303743	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1205658-1205681	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	568287-568310	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	216443-216466	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	437565-437588	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	447327-447350	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	182486-182509	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	504090-504113	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	189001-189024	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	313384-313407	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	556202-556225	3	0.875
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1944556-1944579	3	0.875
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_LN831788	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence	37853-37879	3	0.889
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1404466-1404492	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	408796-408822	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	872965-872991	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	817736-817762	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP050100	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence	134253-134279	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP009439	Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence	64506-64532	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	448572-448598	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	351850-351876	4	0.852
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	126145-126169	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	491307-491331	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	791148-791172	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	MH338239	Mycobacterium phage Mryolo, complete genome	49970-49994	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	MK305893	Mycobacterium phage Beatrix, complete genome	51771-51795	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	MN617845	Mycobacterium phage BaconJack, complete genome	53260-53284	4	0.84
CP022578_4	4.1\|2711030\|25\|CP022578\|CRT	2711030-2711054	25	MK359312	Mycobacterium phage Fushigi, complete genome	49866-49890	4	0.84
CP022578_9	9.11\|3215011\|27\|CP022578\|CRT	3215011-3215037	27	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	57662-57688	4	0.852
CP022578_9	9.13\|3215104\|24\|CP022578\|CRT	3215104-3215127	24	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	253003-253026	4	0.833
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	153566-153589	4	0.833
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2430241-2430264	4	0.833
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	2216018-2216041	4	0.833
CP022578_9	9.15\|3215198\|24\|CP022578\|CRT	3215198-3215221	24	NZ_CP041162	Leisingera aquaemixtae strain R2C4 plasmid unnamed6	26010-26033	4	0.833
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_DQ996271	Burkholderia glumae BGR1 plasmid pBGF3, complete sequence	15025-15050	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	493185-493210	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	65645-65670	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP026546	Cupriavidus metallidurans strain Ni-2 plasmid unnamed2	51548-51573	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	904666-904691	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1012698-1012723	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	839293-839318	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	274169-274194	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	833395-833420	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	KT281796	Mycobacterium phage Zakhe101, complete genome	31092-31117	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	AY129335	Mycobacterium virus Corndog, complete genome	32037-32062	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MK493325	Synechococcus phage S-RIM8 isolate RW_62_0316, complete genome	126816-126841	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MK493322	Synechococcus phage S-RIM8 isolate RW_01_0115_WH8101, complete genome	126232-126257	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	KX349288	Synechococcus phage S-RIM8 isolate RW_08_0711, complete genome	126232-126257	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MN428058	Mycobacterium phage Krili, complete genome	30504-30529	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	KX349286	Synechococcus phage S-RIM8 isolate RW_03_0807_WH8101, complete genome	126434-126459	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_004685	Mycobacterium phage Corndog, complete genome	32037-32062	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	JN698993	Mycobacterium phage Firecracker, complete genome	31190-31215	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MK493324	Synechococcus phage S-RIM8 isolate RW_22_0214, complete genome	126230-126255	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	KX349290	Synechococcus phage S-RIM8 isolate RW_25_1112, complete genome	126816-126841	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	KX349287	Synechococcus phage S-RIM8 isolate RW_06_0613, complete genome	126816-126841	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MN585964	Mycobacterium phage Blessica, complete genome	31307-31332	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_022057	Mycobacterium phage Catdawg, complete genome	30996-31021	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MT818425	Mycobacterium phage NiebruSaylor, complete genome	30376-30401	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_022325	Mycobacterium phage Dylan, complete genome	31088-31113	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MN428052	Mycobacterium phage Smooch, complete genome	32708-32733	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	858391-858416	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	857911-857936	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_AP022578	Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence	91147-91172	4	0.846
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	129492-129517	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	72560-72585	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	91819-91844	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	380346-380371	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	373437-373462	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	583543-583568	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	591013-591038	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	1599-1624	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	636379-636404	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	164455-164480	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	70165-70190	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	128382-128407	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	110886-110911	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP015441	Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence	172126-172151	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	87110-87135	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	282142-282167	4	0.846
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	62657-62682	4	0.846
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	389742-389773	4	0.875
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NC_008712	Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence	304571-304598	4	0.857
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP035418	Leisingera sp. NJS204 plasmid unnamed1, complete sequence	36671-36694	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP038237	Leisingera sp. NJS201 plasmid unnamed3, complete sequence	98992-99015	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	449137-449160	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1451692-1451715	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	387125-387148	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1744538-1744561	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	LR134132	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 12	10708-10731	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	504872-504895	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	413337-413360	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	17298-17321	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	456993-457016	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	267198-267221	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	18955-18978	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	395965-395988	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	195123-195146	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1363739-1363762	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	209300-209323	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	574427-574450	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP041043	Paracoccus sp. AK26 plasmid pAK3, complete sequence	26178-26201	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1043767-1043790	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	120240-120263	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	41515-41538	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	47178-47201	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1043871-1043894	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	368523-368546	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	43405-43428	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	43405-43428	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	43405-43428	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	122685-122708	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	43405-43428	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	392596-392619	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	409631-409654	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	MK494131	Mycobacterium phage GodPhather, complete genome	23250-23273	4	0.833
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	MH001450	Mycobacterium phage Jeon, complete genome	22992-23015	4	0.833
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	33469-33495	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	110878-110904	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	239569-239595	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	MN586047	Gordonia phage EMoore, complete genome	40681-40707	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	161496-161522	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_LR594663	Variovorax sp. RA8 plasmid 2	378846-378872	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	470375-470401	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	63908-63934	4	0.852
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	661184-661210	4	0.852
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	MN657133	Cryobacterium sp. strain ANT_H10B plasmid pA10BH1, complete sequence	14846-14872	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	151977-152003	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	44267-44293	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	MK937603	Gordonia phage Bakery, complete genome	37715-37741	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	KM389402	UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00002 genomic sequence	1379-1405	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NC_003278	Pseudomonas phage phiCTX, complete genome	20233-20259	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	Y13918	Pseudomonas aeruginosa phage phi CTX DNA, complete genome	20233-20259	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	AB008550	Pseudomonas phage phiCTX DNA, complete genome	20233-20259	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	MK034952	Pseudomonas phage Dobby, complete genome	21003-21029	5	0.815
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1425504-1425533	5	0.833
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1378155-1378184	5	0.833
CP022578_9	9.11\|3215011\|27\|CP022578\|CRT	3215011-3215037	27	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	475069-475095	5	0.815
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NZ_CP011276	Planctomyces sp. SH-PL62 plasmid pPL62-3, complete sequence	45340-45367	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	180588-180615	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	CP048434	Collinsella aerofaciens ATCC 25986 strain JCM 10188 plasmid putative_pCaero1, complete sequence	1248-1275	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	547608-547635	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	46144-46171	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	293491-293518	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1836376-1836403	5	0.821
CP022578_9	9.14\|3215149\|28\|CP022578\|CRT	3215149-3215176	28	JN698994	Mycobacterium phage DS6A, complete genome	26497-26524	5	0.821
CP022578_11	11.1\|4009127\|29\|CP022578\|CRT	4009127-4009155	29	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	794861-794889	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	622905-622933	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	366233-366261	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350096-350124	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	107935-107963	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1246783-1246811	5	0.828
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1098549-1098577	5	0.828
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	806571-806596	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	450243-450268	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	454769-454794	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	453978-454003	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	364700-364725	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1448373-1448398	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	NZ_CP045120	Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence	19670-19695	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MT855965	Microcystis phage vB_MaeS-yong1, complete genome	36712-36737	5	0.808
CP022578_11	11.7\|4009616\|26\|CP022578\|CRT	4009616-4009641	26	MN585977	Mycobacterium phage Atcoo, complete genome	13801-13826	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90829-90854	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94051-94076	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90196-90221	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	91954-91979	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	99406-99431	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	378246-378271	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377376-377401	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	382104-382129	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	580909-580934	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	585397-585422	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	2589-2614	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	637369-637394	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	634147-634172	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	1464-1489	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	3222-3247	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	628792-628817	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	636244-636269	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	638002-638027	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	114567-114592	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	116667-116692	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	118425-118450	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1339243-1339268	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	206048-206073	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	76043-76068	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	941372-941397	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	109907-109932	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	598229-598254	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	1547-1572	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	147207-147232	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP041042	Paracoccus sp. AK26 plasmid pAK4, complete sequence	65044-65069	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	37871-37896	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_MN366361	Bacterium plasmid pALTS33, complete sequence	14146-14171	5	0.808
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	144699-144724	5	0.808
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	77729-77760	5	0.844
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	475336-475367	5	0.844
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	55536-55567	5	0.844
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	280084-280115	5	0.844
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	254573-254604	5	0.844
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	260674-260705	5	0.844
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	486394-486425	5	0.844
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NC_034248	Rhizobium phage RHEph10, complete genome	882-909	5	0.821
CP022578_14	14.1\|4159156\|27\|CP022578\|CRT	4159156-4159182	27	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	202881-202907	5	0.815
CP022578_14	14.1\|4159156\|27\|CP022578\|CRT	4159156-4159182	27	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	356185-356211	5	0.815
CP022578_14	14.1\|4159156\|27\|CP022578\|CRT	4159156-4159182	27	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	328577-328603	5	0.815
CP022578_14	14.6\|4159450\|27\|CP022578\|CRT	4159450-4159476	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	347008-347034	5	0.815
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP041156	Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence	134619-134642	5	0.792
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	403908-403931	5	0.792
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	29587-29610	5	0.792
CP022578_14	14.7\|4159498\|24\|CP022578\|CRT	4159498-4159521	24	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	268829-268852	5	0.792
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	2099-2125	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	2099-2125	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK359320	Mycobacterium phage Cookies, complete genome	58413-58439	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KX611831	Mycobacterium phage Pharsalus, complete genome	58834-58860	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NC_041844	Mycobacterium phage Optimus, complete genome	77610-77636	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK967379	Mycobacterium phage HokkenD, complete genome	80092-80118	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MH230878	Mycobacterium phage Oogway, complete genome	40771-40797	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MN585999	Mycobacterium phage Briton15, complete genome	41723-41749	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MG962370	Mycobacterium phage Kykar, complete genome	40271-40297	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MH576975	Mycobacterium phage Target, complete genome	39125-39151	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK359331	Mycobacterium phage Rajelicia, complete genome	41672-41698	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MH744414	Mycobacterium phage Arcanine, complete genome	41138-41164	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KF493880	Mycobacterium phage HanShotFirst, complete genome	41672-41698	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	JF937103	Mycobacterium virus Museum, complete genome	41210-41236	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MH576971	Mycobacterium phage Arlo, complete genome	39521-39547	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MH697575	Mycobacterium phage Adahisdi, complete genome	41184-41210	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KJ409696	Mycobacterium phage Lamina13, complete genome	41059-41085	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NC_028784	Mycobacterium phage Tasp14, complete genome	41683-41709	5	0.815
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KT259047	Mycobacterium phage Rufus, complete genome	40308-40334	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	207153-207179	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	994943-994969	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	212744-212770	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	94785-94811	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	585833-585859	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	317095-317121	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	635-661	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	247982-248008	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	227894-227920	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	119527-119553	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	181599-181625	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	506639-506665	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP042276	Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence	278724-278750	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	90925-90951	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_007491	Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence	169292-169318	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP029339	Streptomyces sp. SM17 plasmid pSM17A, complete sequence	131132-131158	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	99679-99705	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	100069-100095	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP011297	Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence	184399-184425	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1021631-1021657	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP017304	Rhodococcus sp. YL-1 plasmid pYLL2 sequence	153165-153191	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_005073	Rhodococcus erythropolis linear plasmid pBD2, complete sequence	91758-91784	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	159620-159646	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	439701-439727	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	93748-93774	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	252263-252289	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_010311	Streptomyces sp. HK1 plasmid pSHK1, complete sequence	38778-38804	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	126191-126217	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	286156-286182	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	CP000385	Mycobacterium sp. MCS Plasmid1, complete sequence	68541-68567	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	99012-99038	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	396755-396781	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	975997-976023	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	39259-39285	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP046100	Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence	42420-42446	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	951354-951380	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	975997-976023	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP014942	Rhodococcus sp. BH4 plasmid, complete sequence	129884-129910	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP014942	Rhodococcus sp. BH4 plasmid, complete sequence	333630-333656	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	273293-273319	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	224386-224412	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	7080-7106	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	546501-546527	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP050125	Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence	123696-123722	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_008704	Mycobacterium sp. KMS plasmid pMKMS02, complete sequence	94600-94626	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	57775-57801	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	175596-175622	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP045549	Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence	29547-29573	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP034156	Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence	105961-105987	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP034156	Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence	426971-426997	5	0.815
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	152523-152549	5	0.815
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	MN234199	Mycobacterium phage Ekdilam, complete genome	53598-53624	6	0.778
CP022578_3	3.6\|1499893\|27\|CP022578\|CRT	1499893-1499919	27	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	211346-211372	6	0.778
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	262130-262159	6	0.8
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1624787-1624816	6	0.8
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1624922-1624951	6	0.8
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	GQ141189	Bifidobacterium phage Bbif-1, complete sequence	38062-38092	6	0.806
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	88882-88911	6	0.8
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	4449-4478	6	0.8
CP022578_11	11.1\|4009127\|29\|CP022578\|CRT	4009127-4009155	29	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	529162-529190	6	0.793
CP022578_11	11.1\|4009127\|29\|CP022578\|CRT	4009127-4009155	29	MK305891	Streptomyces phage Gibson, complete genome	21789-21817	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	487068-487096	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	621642-621670	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP014799	Salipiger profundus strain JLT2016 plasmid pTPRO3, complete sequence	3172-3200	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	9795-9823	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KC736071	Mycobacterium phage WIVsmall, complete genome	29696-29724	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350105-350133	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	338806-338834	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	53689-53717	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	174759-174787	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_031109	Gordonia phage Jumbo, complete genome	54641-54669	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK814754	Mycobacterium phage Sumter, complete genome	28142-28170	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK814754	Mycobacterium phage Sumter, complete genome	28640-28668	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN369739	Mycobacterium phage Kenuha5, complete genome	22589-22617	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK494110	Mycobacterium phage SwagPigglett, complete genome	24954-24982	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH479919	Mycobacterium phage Moose, complete genome	28919-28947	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KY012363	Mycobacterium phage Empress, complete genome	26300-26328	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK967397	Mycobacterium phage Mahavrat, complete genome	24815-24843	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH669010	Mycobacterium phage PHappiness, complete genome	24929-24957	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH669003	Mycobacterium phage Girr, complete genome	24926-24954	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG925342	Mycobacterium phage Forsytheast, complete genome	28919-28947	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK359354	Mycobacterium phage PinkPlastic, complete genome	28500-28528	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH632118	Mycobacterium phage Zeeculate, complete genome	29465-29493	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG872836	Mycobacterium phage Fajezeel, complete genome	29005-29033	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN585999	Mycobacterium phage Briton15, complete genome	28984-29012	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG872841	Mycobacterium phage Priscilla, complete genome	25144-25172	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH155865	Mycobacterium phage BobaPhett, complete genome	25107-25135	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN585985	Mycobacterium phage Watermelon, complete genome	29572-29600	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KY348865	Mycobacterium phage Bubbles123, complete genome	25541-25569	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN428047	Mycobacterium phage Doomphist, complete genome	24963-24991	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH651169	Mycobacterium phage Burwell21, complete genome	25141-25169	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG925344	Mycobacterium phage Ichabod, complete genome	28890-28918	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK359315	Mycobacterium phage MisterCuddles, complete genome	24926-24954	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH697581	Mycobacterium phage Crispicous1, complete genome	28240-28268	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK359299	Mycobacterium phage Petp2012, complete genome	29653-29681	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH371120	Mycobacterium phage OlympiaSaint, complete genome	25330-25358	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MF190168	Mycobacterium phage Spoonbill, complete genome	25141-25169	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG925340	Mycobacterium phage Corvo, complete genome	29641-29669	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT771340	Mycobacterium phage Jorgensen, complete genome	28477-28505	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN735433	Mycobacterium phage Scottish, complete genome	26252-26280	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG920060	Mycobacterium phage Bob3, complete genome	28226-28254	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH338239	Mycobacterium phage Mryolo, complete genome	28445-28473	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH651183	Mycobacterium phage Nivrat, complete genome	25115-25143	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_021297	Mycobacterium phage PattyP, complete genome	28982-29010	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KY224001	Mycobacterium phage Blue, complete genome	29185-29213	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MF919508	Mycobacterium phage ILeeKay, complete genome	28856-28884	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	AY500152	Mycobacteriophage U2, complete genome	28818-28846	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG770213	Mycobacterium phage OldBen, complete genome	24921-24949	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK967387	Mycobacterium phage Big3, complete genome	29344-29372	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH651188	Mycobacterium phage Ruby, complete genome	24926-24954	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_041989	Mycobacterium phage Shauna1, complete genome	22606-22634	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	JN020140	Mycobacterium virus MrGordo, complete genome	28429-28457	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH834617	Mycobacterium phage Lizziana, complete genome	25116-25144	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	EU744251	Mycobacterium phage Jasper, complete genome	28533-28561	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK524499	Mycobacterium phage Tripl3t, complete genome	29563-29591	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK820638	Mycobacterium phage HermioneGrange, complete genome	28614-28642	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_041988	Mycobacterium phage ShiLan, complete genome	25142-25170	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KX522649	Mycobacterium phage Bircsak, complete genome	29189-29217	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK524517	Mycobacterium phage James, complete genome	25107-25135	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK305886	Mycobacterium phage Poenanya, complete genome	24963-24991	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	JN859129	Mycobacterium virus DotProduct, complete genome	24830-24858	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG962372	Mycobacterium phage McGuire, complete genome	28727-28755	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK305893	Mycobacterium phage Beatrix, complete genome	30124-30152	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK016494	Mycobacterium phage Filuzino, complete genome	24946-24974	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KM066034	Mycobacterium phage Inventum, complete genome	25082-25110	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN586011	Mycobacterium phage LilMoolah, complete genome	25241-25269	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KT438500	Mycobacterium phage Pari, complete genome	28446-28474	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH338238	Mycobacterium phage Michley, complete genome	28566-28594	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH399784	Mycobacterium phage NormanBulbieJr, complete genome	25130-25158	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT310893	Mycobacterium phage DRBy19, complete genome	24977-25005	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH399771	Mycobacterium phage ByChance, complete genome	25118-25146	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KX522943	Mycobacterium phage Gompeii16, complete genome	29190-29218	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KY702574	Mycobacterium phage Kingsley, complete genome	22409-22437	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH450133	Mycobacterium phage SwissCheese, complete genome	29419-29447	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_009877	Mycobacterium phage U2, complete genome	28818-28846	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KJ025956	Mycobacterium phage Saal, complete genome	24931-24959	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN813700	Mycobacterium phage Atkinbua, complete genome	29150-29178	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_024136	Mycobacterium phage Seabiscuit, complete genome	28727-28755	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN369751	Mycobacterium phage TDanisky, complete genome	24977-25005	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT639644	Mycobacterium phage MaryBeth, complete genome	28847-28875	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT639654	Mycobacterium phage Jerm2, complete genome	28880-28908	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH590602	Mycobacterium phage Gorge, complete genome	25111-25139	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	JF937108	Mycobacterium phage Switzer, complete genome	28833-28861	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	JN660814	Mycobacterium phage Dreamboat, complete genome	28647-28675	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_011054	Mycobacterium phage Boomer, complete genome	24638-24666	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH669011	Mycobacterium phage PherrisBueller, complete genome	28556-28584	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_023687	Mycobacterium phage Bruns, complete genome	28664-28692	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK310141	Mycobacterium phage Fenn, complete genome	30323-30351	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	JF937103	Mycobacterium virus Museum, complete genome	28773-28801	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH669005	Mycobacterium phage JoeyJr, complete genome	25119-25147	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_028654	Mycobacterium phage Sparkdehlily, complete genome	24977-25005	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK524523	Mycobacterium phage Naira, complete genome	30370-30398	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH450113	Mycobacterium phage BigMau, complete genome	28880-28908	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN444869	Mycobacterium phage DreamCatcher, complete genome	30058-30086	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_023695	Mycobacterium phage Violet, complete genome	29236-29264	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG812495	Mycobacterium phage Pippin, complete genome	29064-29092	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_023726	Mycobacterium phage Euphoria, complete genome	28737-28765	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG812489	Mycobacterium phage Greg, complete genome	29005-29033	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT310897	Mycobacterium phage Manatee, complete genome	28435-28463	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH155871	Mycobacterium phage Mattes, complete genome	25107-25135	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN204502	Mycobacterium phage KingMidas, complete genome	26251-26279	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_022068	Mycobacteriophage Daenerys, complete genome	24951-24979	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK310142	Mycobacterium phage MetalQZJ, complete genome	28847-28875	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KT895281	Mycobacterium phage Cabrinians, complete genome	25135-25163	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_031041	Mycobacterium phage Papez, complete genome	30400-30428	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH513971	Mycobacterium phage Hope4ever, complete genome	29092-29120	6	0.793
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH450130	Mycobacterium phage Rohr, complete genome	28919-28947	6	0.793
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	135403-135428	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94486-94511	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377811-377836	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	633712-633737	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	9254-9279	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	58977-59002	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	48043-48068	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	117792-117817	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	114132-114157	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	303401-303426	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	270828-270853	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	820542-820567	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	40667-40692	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	423227-423252	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	440801-440826	6	0.769
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	73325-73350	6	0.769
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1269400-1269428	6	0.793
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2357907-2357935	6	0.793
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	448301-448329	6	0.793
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	126742-126773	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1287244-1287275	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	35379-35410	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1145460-1145491	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP018466	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence	26645-26676	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102513-102544	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP020976	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA	31697-31728	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP020965	Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence	14916-14947	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP018727	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence	16476-16507	6	0.812
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	213684-213715	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	24060-24091	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	27512-27543	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	164930-164961	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	326642-326673	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1773789-1773820	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	298129-298160	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	318546-318577	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	333102-333133	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	301273-301304	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	362911-362942	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210636-2210667	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	454698-454729	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	114578-114609	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	303386-303417	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	913358-913389	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	11036-11067	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	302533-302564	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	683734-683765	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687348-687379	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	311647-311678	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	299307-299338	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	298391-298422	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	295588-295619	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	299550-299581	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	302550-302581	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	317013-317044	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	362983-363014	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	317013-317044	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	317013-317044	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	317013-317044	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1795331-1795362	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	311630-311661	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	311600-311631	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	306151-306182	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	304280-304311	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	299829-299860	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	317013-317044	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	315314-315345	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	301318-301349	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1777383-1777414	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1777383-1777414	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	82570-82601	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	68738-68769	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	364384-364415	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1639384-1639415	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	619974-620005	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	2029088-2029119	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1292463-1292494	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	89190-89221	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	192209-192240	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	780405-780436	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	315319-315350	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	294173-294204	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	294176-294207	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	294176-294207	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_031109	Gordonia phage Jumbo, complete genome	20059-20090	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	929944-929975	6	0.812
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	209775-209806	6	0.812
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	LN997844	Streptomyces reticuli genome assembly TUE45, plasmid : III	46922-46949	6	0.786
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	DQ115854	Cyanobacteria phage AS-1 contig_47 genomic sequence	815-842	6	0.786
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	86709-86736	6	0.786
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	175180-175207	6	0.786
CP022578_14	14.1\|4159156\|27\|CP022578\|CRT	4159156-4159182	27	NC_048759	Serratia phage MTx, partial genome	50157-50183	6	0.778
CP022578_14	14.6\|4159450\|27\|CP022578\|CRT	4159450-4159476	27	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	319826-319852	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MG872843	Mycobacterium phage Sotrice96, complete genome	58962-58988	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MT723943	Mycobacterium phage Cactus, complete genome	58219-58245	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MT114165	Mycobacterium phage BadStone, complete genome	58858-58884	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KF493883	Mycobacterium phage Mosby, complete genome	58434-58460	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MF919529	Mycobacterium phage Sassay, complete genome	57396-57422	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK359343	Mycobacterium phage Pollywog, complete genome	43646-43672	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KU865303	Mycobacterium phage TeardropMSU, complete genome	58043-58069	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KR080204	Mycobacterium phage Mindy, complete genome	58182-58208	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NC_029079	Mycobacterium phage Dusk, complete genome	58518-58544	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	NC_022065	Mycobacterium phage Contagion, complete genome	58434-58460	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KX817173	Mycobacterium phage Tuco, complete genome	60123-60149	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MT684595	Mycobacterium phage Mova, complete genome	43328-43354	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	KF188414	Mycobacterium phage ABCat, complete genome	59289-59315	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MF919540	Mycobacterium phage Willez, complete genome	57396-57422	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MN234212	Mycobacterium phage Paphu, complete genome	40417-40443	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK061415	Mycobacterium phage Rhynn, complete genome	39582-39608	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MK524531	Mycobacterium phage Rutherferd, complete genome	41404-41430	6	0.778
CP022578_14	14.11\|4159720\|27\|CP022578\|CRT	4159720-4159746	27	MN617845	Mycobacterium phage BaconJack, complete genome	42888-42914	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	330036-330062	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_002699	Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence	8359-8385	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	501002-501028	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	229195-229221	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	113102-113128	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	506092-506118	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	122717-122743	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	103719-103745	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	109506-109532	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	103719-103745	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	398793-398819	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	203705-203731	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	641102-641128	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	581085-581111	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2350438-2350464	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP013069	Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence	118179-118205	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_016115	Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence	106743-106769	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1759817-1759843	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	557163-557189	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP015040	Rhodovulum sp. P5 plasmid pRGUI01, complete sequence	15924-15950	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	271657-271683	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP042268	Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence	2903-2929	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP045074	Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence	455498-455524	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	330124-330150	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	323550-323576	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	731394-731420	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	213993-214019	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	385369-385395	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1509591-1509617	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	107589-107615	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP016080	Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence	121758-121784	6	0.778
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_022739	Pseudomonas sp. VLB120 plasmid pSTY, complete sequence	113279-113305	6	0.778
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	2067764-2067799	6	0.833
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MK977708	Mycobacterium phage Fulbright, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MG099948	Mycobacterium phage Philonius, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MH926055	Mycobacterium phage Chewbacca, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MT723932	Mycobacterium phage Schnauzer, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	KU935726	Mycobacterium phage Xerxes, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	KU935730	Mycobacterium phage Pipsqueaks, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MH316570	Mycobacterium phage Silvafighter, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MK524518	Mycobacterium phage Smurph, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MK524515	Mycobacterium phage Parmesanjohn, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MH697585	Mycobacterium phage Gex, complete genome	10280-10310	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	KM588359	Mycobacterium phage Carcharodon, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MH697576	Mycobacterium phage Aggie, complete genome	10282-10312	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MH697593	Mycobacterium phage Tapioca, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	MG099936	Mycobacterium phage Andies, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	NC_031243	Mycobacterium phage Xeno, complete genome	10281-10311	7	0.774
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	JN256079	Mycobacterium phage Charlie, complete genome	10281-10311	7	0.774
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	MF417927	Uncultured Caudovirales phage clone 9F_2, partial genome	6978-7007	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	732060-732089	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	87847-87876	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	JX469830	Uncultured bacterium plasmid pG527, complete sequence	62414-62443	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	JX469833	Uncultured bacterium plasmid pWEC911, complete sequence	55706-55735	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NC_008357	Pseudomonas aeruginosa plasmid pBS228, complete sequence	88668-88697	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	CP002151	Uncultured bacterium plasmid PB5, complete sequence	46922-46951	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	CP002152	Uncultured bacterium plasmid PB11, complete sequence	49405-49434	7	0.767
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	CP002153	Uncultured bacterium plasmid PSP21, complete sequence	51092-51121	7	0.767
CP022578_9	9.4\|3214531\|36\|CP022578\|CRT	3214531-3214566	36	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	201261-201296	7	0.806
CP022578_9	9.11\|3215011\|27\|CP022578\|CRT	3215011-3215037	27	NZ_AP018520	Sphingobium sp. YG1 plasmid pYGP1, complete sequence	54324-54350	7	0.741
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MN585973	Mycobacterium phage StAnnes, complete genome	24891-24919	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG944221	Mycobacterium phage Scowl, complete genome	29090-29118	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KT309034	Mycobacterium phage Dante, complete genome	24864-24892	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_048850	Mycobacterium phage Cornie, complete genome	23306-23334	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_021538	Mycobacterium phage Job42, complete genome	26532-26560	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_026584	Mycobacterium phage Minerva, complete genome	38743-38771	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	KJ409696	Mycobacterium phage Lamina13, complete genome	28205-28233	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_028784	Mycobacterium phage Tasp14, complete genome	28829-28857	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350114-350142	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350666-350694	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211451-2211479	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	455349-455377	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_014819	Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence	68663-68691	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	144921-144949	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_LT703506	Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2	304359-304387	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP025615	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence	36213-36241	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	445678-445706	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	455533-455561	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	2019770-2019798	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	119320-119348	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP040096	Pantoea sp. SO10 plasmid unnamed1, complete sequence	107446-107474	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	333785-333813	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	348321-348349	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT522000	Mycobacterium phage Soul22, complete genome	22193-22221	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22191-22219	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	AY129336	Mycobacteriophage Che9d, complete genome	22206-22234	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK359343	Mycobacterium phage Pollywog, complete genome	23656-23684	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_042030	Mycobacterium phage Yoshi, complete sequence	22194-22222	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_048729	Mycobacterium phage Renaud18, complete genome	22866-22894	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT889380	Mycobacterium phage Coco12, complete genome	22837-22865	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_026585	Mycobacteriophage Estave1, complete genome	22559-22587	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MG925354	Mycobacterium phage Ogopogo, complete genome	22786-22814	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_023698	Mycobacterium phage Avani, complete genome	22198-22226	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MT114167	Mycobacterium phage Phanphagia, complete genome	22492-22520	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH077585	Mycobacterium phage TChen, complete genome	22971-22999	7	0.759
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NC_048788	Mycobacterium phage ThetaBob, complete genome	22784-22812	7	0.759
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	134977-135002	7	0.731
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	580333-580358	7	0.731
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	9680-9705	7	0.731
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	58551-58576	7	0.731
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	48469-48494	7	0.731
CP022578_11	11.10\|4009853\|26\|CP022578\|CRT	4009853-4009878	26	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	582845-582870	7	0.731
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	33127-33155	7	0.759
CP022578_11	11.12\|4010003\|29\|CP022578\|CRT	4010003-4010031	29	MK510999	Pseudomonas phage BR58, partial genome	18164-18192	7	0.759
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	104974-105005	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	230840-230871	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	19813-19844	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP051543	Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence	106285-106316	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	268526-268557	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	465925-465956	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	456256-456287	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	466109-466140	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	344363-344394	7	0.781
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	20371-20402	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	128423-128454	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	101685-101716	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	101829-101860	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102057-102088	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102099-102130	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102285-102316	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102327-102358	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102471-102502	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416440-416471	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	210543-210574	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1974012-1974043	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	213747-213778	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	374789-374820	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	723914-723945	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP019063	Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence	394924-394955	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	134704-134735	7	0.781
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	105338-105369	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	916895-916926	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	333906-333937	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1727798-1727829	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1754493-1754524	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	917354-917385	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1783272-1783303	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1814773-1814804	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350104-350135	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211449-2211480	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1959037-1959068	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	698830-698861	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1714018-1714049	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	329136-329167	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	579487-579518	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1792768-1792799	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1500392-1500423	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1735050-1735081	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1729871-1729902	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1798700-1798731	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	446057-446088	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1672859-1672890	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1729331-1729362	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1804248-1804279	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1798667-1798698	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1708136-1708167	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	440080-440111	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1814775-1814806	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1708448-1708479	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1708136-1708167	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1707339-1707370	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	248523-248554	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1708334-1708365	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1688979-1689010	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1750023-1750054	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1782005-1782036	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1781004-1781035	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1708447-1708478	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1798491-1798522	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1783694-1783725	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	216325-216356	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	216325-216356	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	573838-573869	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	80793-80824	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	315284-315315	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83152-83183	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	67805-67836	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	71042-71073	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	258325-258356	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	250537-250568	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	301071-301102	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	202914-202945	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	509871-509902	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_011879	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence	75980-76011	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	170110-170141	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261733-261764	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	308611-308642	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT889380	Mycobacterium phage Coco12, complete genome	22835-22866	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT114167	Mycobacterium phage Phanphagia, complete genome	22490-22521	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1797462-1797493	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	50134-50165	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	765883-765914	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1797460-1797491	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP014276	Martelella sp. AD-3 plasmid unnamed1, complete sequence	26313-26344	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	245788-245819	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	52536-52567	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1462200-1462231	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	300484-300515	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	280825-280856	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	670169-670200	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	98683-98714	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK494095	Mycobacterium phage Daegal, complete genome	5958-5989	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK494105	Mycobacterium phage Pinnie, complete genome	23390-23421	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK494105	Mycobacterium phage Pinnie, complete genome	23159-23190	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_028791	Mycobacterium phage MOOREtheMARYer, complete genome	23011-23042	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP023779	Nocardia terpenica strain NC_YFY_NT001 plasmid p_NC_YFY_NT001, complete sequence	6341-6372	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	318451-318482	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	396853-396884	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	391036-391067	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	153727-153758	7	0.781
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	573119-573150	7	0.781
CP022578_12	12.6\|4029297\|32\|CP022578\|CRT	4029297-4029328	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2781975-2782006	7	0.781
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NC_022050	Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence	39653-39680	7	0.75
CP022578_14	14.4\|4159339\|33\|CP022578\|CRT	4159339-4159371	33	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	612195-612227	7	0.788
CP022578_14	14.9\|4159615\|27\|CP022578\|CRT	4159615-4159641	27	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	369282-369308	7	0.741
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	663780-663806	7	0.741
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	286244-286270	7	0.741
CP022578_14	14.13\|4159831\|27\|CP022578\|CRT	4159831-4159857	27	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	29168-29194	7	0.741
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1465470-1465499	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	251025-251054	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	258423-258452	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	88284-88313	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	52655-52684	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	190437-190466	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	273171-273200	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	52528-52557	8	0.733
CP022578_8	8.2\|3186729\|30\|CP022578\|CRISPRCasFinder	3186729-3186758	30	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	163428-163457	8	0.733
CP022578_9	9.4\|3214531\|36\|CP022578\|CRT	3214531-3214566	36	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	519535-519570	8	0.778
CP022578_11	11.1\|4009127\|29\|CP022578\|CRT	4009127-4009155	29	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	938431-938459	8	0.724
CP022578_11	11.1\|4009127\|29\|CP022578\|CRT	4009127-4009155	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1510083-1510111	8	0.724
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	NZ_CP048923	Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence	17406-17434	8	0.724
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MK937593	Mycobacterium phage Flypotenuse, complete genome	26855-26883	8	0.724
CP022578_11	11.6\|4009544\|29\|CP022578\|CRT	4009544-4009572	29	MH536820	Mycobacterium phage Glexan, complete genome	26855-26883	8	0.724
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	223846-223877	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	87943-87974	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	223111-223142	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	73264-73295	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	624011-624042	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP046571	Xanthomonas albilineans strain Xa-FJ1 plasmid pXaFJ1, complete sequence	7592-7623	8	0.75
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	424526-424557	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	69206-69237	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416248-416279	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416296-416327	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416344-416375	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416128-416159	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416224-416255	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416368-416399	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	222441-222472	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	393193-393224	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	416863-416894	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	393262-393293	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	399992-400023	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	398832-398863	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	398832-398863	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	398824-398855	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	416863-416894	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	399992-400023	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	399470-399501	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	JN699011	Mycobacterium phage Stinger, complete genome	23830-23861	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_KM406416	Bifidobacterium breve strain JCM 7017 plasmid megaplasmid pMP7017, complete sequence	12241-12272	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_019018	Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence	58948-58979	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_011355	Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence	5698-5729	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	599851-599882	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	173242-173273	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	5705-5736	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	194754-194785	8	0.75
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1389287-1389318	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	280285-280316	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	876589-876620	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350665-350696	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466591-3466622	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210945-2210976	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211119-2211150	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467425-3467456	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350506-350537	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	752721-752752	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211059-2211090	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467362-3467393	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684907-684938	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1552681-1552712	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83251-83282	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83422-83453	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	116486-116517	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1172375-1172406	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306654-306685	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	302070-302101	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MF141540	Mycobacterium phage Avocado, complete genome	24054-24085	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	KR080198	Mycobacterium phage Cambiare, complete genome	24519-24550	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	258384-258415	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	806900-806931	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	94315-94346	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	473669-473700	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	151628-151659	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_020275	Mycobacterium intracellulare subsp. yongonense 05-1390 plasmid pMyong1, complete sequence	117761-117792	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	713857-713888	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	41273-41304	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1755080-1755111	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	162817-162848	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	529169-529200	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1657444-1657475	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	408199-408230	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK814754	Mycobacterium phage Sumter, complete genome	28140-28171	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK814754	Mycobacterium phage Sumter, complete genome	28638-28669	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN369739	Mycobacterium phage Kenuha5, complete genome	22587-22618	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK967397	Mycobacterium phage Mahavrat, complete genome	24813-24844	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH001451	Mycobacterium phage Nairb, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK524490	Mycobacterium phage Donny, complete genome	33810-33841	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT522000	Mycobacterium phage Soul22, complete genome	22191-22222	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	KY348865	Mycobacterium phage Bubbles123, complete genome	25539-25570	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN428047	Mycobacterium phage Doomphist, complete genome	24961-24992	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22189-22220	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	AY129336	Mycobacteriophage Che9d, complete genome	22204-22235	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT771340	Mycobacterium phage Jorgensen, complete genome	28475-28506	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK359343	Mycobacterium phage Pollywog, complete genome	23654-23685	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MF155936	Mycobacterium phage ZenTime222, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_042030	Mycobacterium phage Yoshi, complete sequence	22192-22223	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH338241	Mycobacterium phage Tarynearal, complete genome	23683-23714	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_048729	Mycobacterium phage Renaud18, complete genome	22864-22895	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_026585	Mycobacteriophage Estave1, complete genome	22557-22588	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK305886	Mycobacterium phage Poenanya, complete genome	24961-24992	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	JN859129	Mycobacterium virus DotProduct, complete genome	24828-24859	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK494089	Mycobacterium phage Ibrahim, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MG925354	Mycobacterium phage Ogopogo, complete genome	22784-22815	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_023698	Mycobacterium phage Avani, complete genome	22196-22227	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	JN699007	Mycobacterium phage Acadian, complete genome	33805-33836	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_024135	Mycobacterium phage Bernal13, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_011054	Mycobacterium phage Boomer, complete genome	24636-24667	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT889381	Mycobacterium phage Suigeneris, complete genome	33810-33841	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	KM591905	Mycobacterium phage RonRayGun, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH077585	Mycobacterium phage TChen, complete genome	22969-23000	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN735432	Mycobacteriophage Whitty, complete genome	21241-21272	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_048788	Mycobacterium phage ThetaBob, complete genome	22782-22813	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP018471	Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence	13085-13116	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_008712	Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence	40934-40965	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	480125-480156	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	83601-83632	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	52094-52125	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	288114-288145	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	572169-572200	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	335584-335615	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_008539	Arthrobacter sp. FB24 plasmid 3, complete sequence	16079-16110	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1246417-1246448	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	449577-449608	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	94222-94253	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	455292-455323	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	313198-313229	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	218474-218505	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190142-190173	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	112997-113028	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_008766	Acidovorax sp. JS42 plasmid pAOVO02, complete sequence	13754-13785	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	645804-645835	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP023550	Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence	151176-151207	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	219895-219926	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_006525	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	12466-12497	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	677364-677395	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN096355	Mycobacterium phage Purky, complete genome	13504-13535	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH669003	Mycobacterium phage Girr, complete genome	14385-14416	8	0.75
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK016504	Mycobacterium phage Whouxphf, complete genome	14517-14548	8	0.75
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP021406	Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence	151899-151930	8	0.75
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	300695-300726	8	0.75
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP010872	Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6003, complete sequence	102705-102736	8	0.75
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP040823	Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence	5062-5093	8	0.75
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP040823	Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence	111204-111235	8	0.75
CP022578_12	12.6\|4029297\|32\|CP022578\|CRT	4029297-4029328	32	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	279027-279058	8	0.75
CP022578_13	13.6\|4030672\|28\|CP022578\|CRT	4030672-4030699	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	783761-783788	8	0.714
CP022578_14	14.4\|4159339\|33\|CP022578\|CRT	4159339-4159371	33	MN234213	Gordonia phage Schiebs, complete genome	11497-11529	8	0.758
CP022578_14	14.4\|4159339\|33\|CP022578\|CRT	4159339-4159371	33	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	447918-447950	8	0.758
CP022578_14	14.5\|4159393\|36\|CP022578\|CRT	4159393-4159428	36	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	296417-296452	8	0.778
CP022578_14	14.5\|4159393\|36\|CP022578\|CRT	4159393-4159428	36	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	346479-346514	8	0.778
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	233810-233845	8	0.778
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	263517-263552	8	0.778
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	811469-811504	8	0.778
CP022578_3	3.7\|1499938\|30\|CP022578\|CRT	1499938-1499967	30	NZ_CP022197	Celeribacter ethanolicus strain TSPH2 plasmid unnamed, complete sequence	25141-25170	9	0.7
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	NZ_CP014964	Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence	13698-13728	9	0.71
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	20960-20990	9	0.71
CP022578_5	5.1\|2856753\|31\|CP022578\|CRISPRCasFinder	2856753-2856783	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	15390-15420	9	0.71
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	4245-4276	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	426519-426550	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	160488-160519	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	414196-414227	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	204646-204677	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	209773-209804	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	139549-139580	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	143-174	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	340876-340907	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	177208-177239	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1525216-1525247	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	443295-443326	9	0.719
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	MH632120	Mycobacterium phage Thonko, complete genome	12336-12367	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416392-416423	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416080-416111	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416176-416207	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416200-416231	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416320-416351	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416416-416447	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	1010316-1010347	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	985673-985704	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	880738-880769	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	1010316-1010347	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	880737-880768	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	723992-724023	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	1019170-1019201	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121353-121384	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	379096-379127	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	293535-293566	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	293535-293566	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	97913-97944	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	238635-238666	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	72142-72173	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2084374-2084405	9	0.719
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	60533-60564	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350095-350126	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3465304-3465335	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4086145-4086176	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4571813-4571844	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4863684-4863715	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1271064-1271095	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466267-3466298	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467023-3467054	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687357-687388	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	69755-69786	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	13863-13894	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306606-306637	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT889380	Mycobacterium phage Coco12, complete genome	14812-14843	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT114167	Mycobacterium phage Phanphagia, complete genome	14467-14498	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	364375-364406	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	531166-531197	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	342003-342034	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	13742-13773	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	14621-14652	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	14824-14855	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	274043-274074	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	13743-13774	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	13743-13774	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	479451-479482	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	13742-13773	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	13738-13769	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	18613-18644	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	18613-18644	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	13750-13781	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	18613-18644	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	13861-13892	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	18613-18644	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	13743-13774	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	557389-557420	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	14599-14630	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1333618-1333649	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	13750-13781	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	534054-534085	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	14599-14630	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	14599-14630	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	18613-18644	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021126	Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence	14821-14852	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	14599-14630	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	14599-14630	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	14826-14857	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	262378-262409	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	13741-13772	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1022655-1022686	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	918752-918783	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN428047	Mycobacterium phage Doomphist, complete genome	14549-14580	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MK305886	Mycobacterium phage Poenanya, complete genome	14549-14580	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	JN859129	Mycobacterium virus DotProduct, complete genome	14425-14456	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	659488-659519	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	600186-600217	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	72745-72776	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	126716-126747	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	152440-152471	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	152668-152699	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	27567-27598	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_001759	Streptomyces phaeochromogenes plasmid pJV1, complete sequence	409-440	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	125962-125993	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	686343-686374	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH051248	Mycobacterium phage BigPhil, complete genome	14271-14302	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MF668281	Mycobacterium phage RitaG, complete genome	14558-14589	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN369749	Mycobacterium phage MinionDave, complete genome	15113-15144	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MT684597	Mycobacterium phage Mandlovu, complete genome	14527-14558	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	KY012363	Mycobacterium phage Empress, complete genome	15766-15797	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MN585973	Mycobacterium phage StAnnes, complete genome	14462-14493	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH077578	Mycobacterium phage DillTech15, complete genome	14464-14495	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MH020235	Mycobacterium phage Batiatus, complete genome	14465-14496	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	KY471267	Mycobacterium phage SassyB, complete genome	14466-14497	9	0.719
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MG872841	Mycobacterium phage Priscilla, complete genome	14423-14454	9	0.719
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	917199-917230	9	0.719
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	895925-895956	9	0.719
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	232436-232467	9	0.719
CP022578_12	12.5\|4029243\|32\|CP022578\|CRT	4029243-4029274	32	NZ_CP015221	Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence	130163-130194	9	0.719
CP022578_12	12.6\|4029297\|32\|CP022578\|CRT	4029297-4029328	32	NZ_CP013071	Sphingobium indicum B90A plasmid pSRL1, complete sequence	86867-86898	9	0.719
CP022578_12	12.6\|4029297\|32\|CP022578\|CRT	4029297-4029328	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1334636-1334667	9	0.719
CP022578_12	12.6\|4029297\|32\|CP022578\|CRT	4029297-4029328	32	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	44253-44284	9	0.719
CP022578_14	14.4\|4159339\|33\|CP022578\|CRT	4159339-4159371	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	444168-444200	9	0.727
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NC_031262	Mycobacterium phage Brocalys, complete genome	19446-19481	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	NC_004683	Mycobacterium phage Che9c, complete genome	20558-20593	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	AY129333	Mycobacterium virus Che9c, complete genome	20558-20593	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	MN234184	Mycobacterium phage IdentityCrisis, complete genome	18582-18617	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	KM083128	Mycobacterium phage Sparky, complete genome	21436-21471	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	MT889380	Mycobacterium phage Coco12, complete genome	22836-22871	9	0.75
CP022578_14	14.18\|4160212\|36\|CP022578\|CRT	4160212-4160247	36	MT114167	Mycobacterium phage Phanphagia, complete genome	22491-22526	9	0.75
CP022578_1	1.7\|431664\|35\|CP022578\|CRT,PILER-CR,CRISPRCasFinder	431664-431698	35	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	414652-414686	10	0.714
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_KU140623	Sinorhizobium sp. M14 plasmid pSinB, complete sequence	65269-65300	10	0.688
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	152547-152578	10	0.688
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP048631	Ancylobacter pratisalsi strain DSM 102029 plasmid pLGM, complete sequence	130266-130297	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416152-416183	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416272-416303	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	865209-865240	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	824526-824557	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	224222-224253	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	244313-244344	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	226869-226900	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	224416-224447	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	224786-224817	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	224786-224817	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	224781-224812	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	244313-244344	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	224416-224447	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	230392-230423	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	219568-219599	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	238684-238715	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	238684-238715	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	222088-222119	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	243141-243172	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013523	Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence	68631-68662	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	260131-260162	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	249908-249939	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	1008420-1008451	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	227840-227871	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	902801-902832	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	1008420-1008451	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	KU935731	Mycobacterium phage Phrann, complete genome	21013-21044	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	MK224497	Mycobacterium phage Henu3, complete genome	33343-33374	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	MT498061	Mycobacterium phage Jung, complete genome	21826-21857	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	MH230879	Mycobacterium phage Xavia, complete genome	22489-22520	10	0.688
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	MN585977	Mycobacterium phage Atcoo, complete genome	22360-22391	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	685570-685601	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684352-684383	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	107037-107068	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	377424-377455	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	507464-507495	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	768792-768823	10	0.688
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	MG812488	Mycobacterium phage Frankie, complete genome	14521-14552	10	0.688
CP022578_14	14.5\|4159393\|36\|CP022578\|CRT	4159393-4159428	36	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211249-2211284	10	0.722
CP022578_14	14.5\|4159393\|36\|CP022578\|CRT	4159393-4159428	36	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350879-350914	10	0.722
CP022578_11	11.13\|4010075\|32\|CP022578\|CRT	4010075-4010106	32	NZ_CP015743	Shinella sp. HZN7 plasmid pShin-07, complete sequence	96148-96179	11	0.656
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	247382-247413	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	302631-302662	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	109051-109082	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1435597-1435628	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	682268-682299	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1797409-1797440	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1694606-1694637	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1797508-1797539	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1695253-1695284	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1797504-1797535	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1797493-1797524	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1797493-1797524	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1797504-1797535	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1797515-1797546	11	0.656
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1797316-1797347	11	0.656
CP022578_12	12.2\|4029063\|32\|CP022578\|CRT	4029063-4029094	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	71709-71740	12	0.625
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1603109-1603140	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1403949-1403980	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1603236-1603267	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1355265-1355296	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	700709-700740	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1602738-1602769	13	0.594
CP022578_12	12.4\|4029189\|32\|CP022578\|CRT	4029189-4029220	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	155711-155742	13	0.594

1. spacer 3.9|1500028|21|CP022578|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 1, identity: 0.952

aatggcgggctcctgttcggc	CRISPR spacer
aatggcgggctcctgctcggc	Protospacer
***************.*****

2. spacer 7.3|3186282|21|CP022578|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 1, identity: 0.952

ggcaccgccgggcgcaccgac	CRISPR spacer
ggcaccaccgggcgcaccgac	Protospacer
******.**************

3. spacer 7.3|3186282|21|CP022578|CRISPRCasFinder matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 1, identity: 0.952

ggcaccgccgggcgcaccgac	CRISPR spacer
ggcaccaccgggcgcaccgac	Protospacer
******.**************

4. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgtgctg	Protospacer
************.******* ****

5. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgtgctg	Protospacer
************.******* ****

6. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgtgctg	Protospacer
************.******* ****

7. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgtgctg	Protospacer
************.******* ****

8. spacer 4.1|2711030|25|CP022578|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgcccgccgccgagctg	Protospacer
************  ***********

9. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 2, identity: 0.92

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgtgctg	Protospacer
************.******* ****

10. spacer 8.1|3186684|21|CP022578|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.905

gttgccgaagaacccggcgtt	CRISPR spacer
gttgccgaagaacccggcgac	Protospacer
******************* .

11. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgttctgatcggcaacgg	Protospacer
***** *** **************

12. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgttctgatcggcaacgg	Protospacer
***** *** **************

13. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
cgacgccgtgctgatcggcagcgg	Protospacer
*.******************.***

14. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

15. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

16. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

17. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgggctgatcggaaacgg	Protospacer
******** ********* *****

18. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacggcgtgctgctcggcaacgg	Protospacer
***** ******* **********

19. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtgctgctcggcatcgg	Protospacer
************* ****** ***

20. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

21. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgagctgatcggcaacgg	Protospacer
***** ** ***************

22. spacer 9.15|3215198|24|CP022578|CRT matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

23. spacer 9.15|3215198|24|CP022578|CRT matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

24. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP010862 (Marinovum algicola DG 898 plasmid pMaD7) position: , mismatch: 2, identity: 0.923

gcgccggagccgttggtgccgccggt	CRISPR spacer
gtgccggagcctttggtgccgccggt	Protospacer
*.********* **************

25. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP010862 (Marinovum algicola DG 898 plasmid pMaD7) position: , mismatch: 2, identity: 0.923

gcgccggagccgttggtgccgccggt	CRISPR spacer
gtgccggagcctttggtgccgccggt	Protospacer
*.********* **************

26. spacer 12.7|4029351|23|CP022578|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gtcgccaccggcgccggtgccgc	Protospacer
**.*******************.

27. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

28. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

29. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP011600 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

30. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

31. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

32. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

33. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

34. spacer 12.7|4029351|23|CP022578|CRT matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

35. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

36. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

37. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

38. spacer 12.7|4029351|23|CP022578|CRT matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

39. spacer 12.7|4029351|23|CP022578|CRT matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

40. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

41. spacer 12.7|4029351|23|CP022578|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

42. spacer 12.7|4029351|23|CP022578|CRT matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

43. spacer 12.7|4029351|23|CP022578|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

44. spacer 12.7|4029351|23|CP022578|CRT matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

45. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054602 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gctgacaccggcgccggtgccgt	Protospacer
*.** ******************

46. spacer 12.7|4029351|23|CP022578|CRT matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

47. spacer 12.7|4029351|23|CP022578|CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

48. spacer 12.7|4029351|23|CP022578|CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

49. spacer 12.7|4029351|23|CP022578|CRT matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

50. spacer 12.7|4029351|23|CP022578|CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

51. spacer 12.7|4029351|23|CP022578|CRT matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

52. spacer 12.7|4029351|23|CP022578|CRT matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

53. spacer 12.7|4029351|23|CP022578|CRT matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

54. spacer 12.7|4029351|23|CP022578|CRT matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

55. spacer 12.7|4029351|23|CP022578|CRT matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

56. spacer 12.7|4029351|23|CP022578|CRT matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

57. spacer 12.7|4029351|23|CP022578|CRT matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

58. spacer 12.7|4029351|23|CP022578|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

59. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

60. spacer 12.7|4029351|23|CP022578|CRT matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

61. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

62. spacer 12.7|4029351|23|CP022578|CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

63. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

64. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP041374 (Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

65. spacer 12.7|4029351|23|CP022578|CRT matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

66. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

67. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

68. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP030355 (Novosphingobium sp. P6W plasmid pP6W2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gatgccaccggcggcggtgccgt	Protospacer
* *********** *********

69. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

70. spacer 12.7|4029351|23|CP022578|CRT matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

71. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

72. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042495 (Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

73. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

74. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_AP019666 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

75. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

76. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

77. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

78. spacer 12.7|4029351|23|CP022578|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

79. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

80. spacer 12.7|4029351|23|CP022578|CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

81. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

82. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

83. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

84. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

85. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

86. spacer 12.7|4029351|23|CP022578|CRT matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

87. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

88. spacer 12.7|4029351|23|CP022578|CRT matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

89. spacer 12.7|4029351|23|CP022578|CRT matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

90. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

91. spacer 12.7|4029351|23|CP022578|CRT matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

92. spacer 12.7|4029351|23|CP022578|CRT matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

93. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

94. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

95. spacer 12.7|4029351|23|CP022578|CRT matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

96. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054751 (Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

97. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054781 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

98. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

99. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

100. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

101. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

102. spacer 12.7|4029351|23|CP022578|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

103. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054763 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

104. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

105. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

106. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

107. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054745 (Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

108. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054727 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

109. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054739 (Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

110. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054775 (Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

111. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054733 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

112. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054721 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

113. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054757 (Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

114. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054769 (Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

115. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP022533 (Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

116. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

117. spacer 12.7|4029351|23|CP022578|CRT matches to CP052317 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

118. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP054064 (Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

119. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

120. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP042489 (Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

121. spacer 12.7|4029351|23|CP022578|CRT matches to CP052495 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

122. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

123. spacer 12.7|4029351|23|CP022578|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

124. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

125. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

126. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MF398271 (Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

127. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

128. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

129. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

130. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

131. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MF788071 (Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

132. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP040534 (Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

133. spacer 12.7|4029351|23|CP022578|CRT matches to MH727545 (Mycobacterium phage DismalStressor, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

134. spacer 12.7|4029351|23|CP022578|CRT matches to MN871473 (UNVERIFIED: Pseudomonas virus Pa-Z, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

135. spacer 12.7|4029351|23|CP022578|CRT matches to KJ510412 (Mycobacterium phage ZoeJ, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

136. spacer 12.7|4029351|23|CP022578|CRT matches to NC_026598 (Mycobacterium phage Milly, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

137. spacer 12.7|4029351|23|CP022578|CRT matches to AF068845 (Mycobacteriophage TM4, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

138. spacer 12.7|4029351|23|CP022578|CRT matches to MH834601 (Mycobacterium phage BoostSeason, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

139. spacer 12.7|4029351|23|CP022578|CRT matches to KX688047 (Mycobacterium phage Marcoliusprime, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

140. spacer 12.7|4029351|23|CP022578|CRT matches to KX171208 (Pseudomonas phage vB_Pae436M-8, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

141. spacer 12.7|4029351|23|CP022578|CRT matches to NC_028759 (Mycobacterium phage Mufasa, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

142. spacer 12.7|4029351|23|CP022578|CRT matches to MK318076 (Pseudomonas phage vB_PaeM_fHoPae01, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

143. spacer 12.7|4029351|23|CP022578|CRT matches to MF140408 (Mycobacterium phage DismalFunk, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

144. spacer 12.7|4029351|23|CP022578|CRT matches to NC_003387 (Mycobacterium phage TM4, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

145. spacer 12.7|4029351|23|CP022578|CRT matches to MT119369 (Pseudomonas phage sortsol, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

146. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

147. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

148. spacer 12.7|4029351|23|CP022578|CRT matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

149. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

150. spacer 12.7|4029351|23|CP022578|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

151. spacer 12.7|4029351|23|CP022578|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

152. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

153. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

154. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

155. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

156. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

157. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

158. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP035380 (Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

159. spacer 12.7|4029351|23|CP022578|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

160. spacer 12.7|4029351|23|CP022578|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

161. spacer 12.7|4029351|23|CP022578|CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

162. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

163. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

164. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

165. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_AP018757 (Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

166. spacer 12.7|4029351|23|CP022578|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

167. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

168. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

169. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

170. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

171. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

172. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

173. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

174. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP025983 (Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

175. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

176. spacer 12.7|4029351|23|CP022578|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

177. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

178. spacer 12.7|4029351|23|CP022578|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

179. spacer 12.7|4029351|23|CP022578|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

180. spacer 12.7|4029351|23|CP022578|CRT matches to CP052259 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

181. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

182. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

183. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

184. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MK715436 (Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

185. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MN058044 (Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

186. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

187. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

188. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

189. spacer 12.7|4029351|23|CP022578|CRT matches to MT090958 (Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

190. spacer 12.7|4029351|23|CP022578|CRT matches to MT118290 (Pseudomonas phage Epa10, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

191. spacer 12.7|4029351|23|CP022578|CRT matches to KC787101 (Mycobacterium phage 33D, partial genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

192. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

193. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

194. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

195. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttt	Protospacer
************** ***** ***

196. spacer 14.7|4159498|24|CP022578|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttt	Protospacer
************** ***** ***

197. spacer 3.6|1499893|27|CP022578|CRT matches to MT723937 (Gordonia phage JKSyngboy, complete genome) position: , mismatch: 3, identity: 0.889

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggactcgcgtacgacgccggt	Protospacer
 **************  **********

198. spacer 3.8|1499986|24|CP022578|CRT matches to NZ_CP014599 (Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.875

accggcactaatgtcaccggcggt	CRISPR spacer
aacggcactaatgtcaccggcgtg	Protospacer
* ********************

199. spacer 3.8|1499986|24|CP022578|CRT matches to NZ_CP028945 (Vibrio sp. dhg plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

accggcactaatgtcaccggcggt	CRISPR spacer
accggcactaatgtcaccgccaga	Protospacer
******************* *.*

200. spacer 4.1|2711030|25|CP022578|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 3, identity: 0.88

ggccccgccgccacccgccgagctg	CRISPR spacer
agccccgccgccacccgccgaccgg	Protospacer
.******************** * *

201. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccgcccgccgagggg	Protospacer
************.*********  *

202. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

ggccccgccgccacccgccgagctg	CRISPR spacer
ggccccgccgccaccagccgcgccg	Protospacer
*************** **** **.*

203. spacer 9.12|3215059|24|CP022578|CRT matches to MN103533 (Mycobacterium phage Weirdo19, complete genome) position: , mismatch: 3, identity: 0.875

cagcggtgccaacgctctaggcgc	CRISPR spacer
ccacggtgccaacgctctaggccc	Protospacer
* .******************* *

204. spacer 9.13|3215104|24|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
cgacggtgaccgcgccggggtgtt	Protospacer
.*******.**.************

205. spacer 9.13|3215104|24|CP022578|CRT matches to MN428050 (Mycobacterium phage Apex, complete genome) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
tgccggtggccacaccggggtgta	Protospacer
** **********.*********

206. spacer 9.13|3215104|24|CP022578|CRT matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
tgccggtggccacaccggggtgta	Protospacer
** **********.*********

207. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgcggtgctgatcgccaacgc	Protospacer
****** ********** *****

208. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgcgctgatcggcaccgc	Protospacer
********.*********** **

209. spacer 9.15|3215198|24|CP022578|CRT matches to NC_022061 (Mycobacterium phage KayaCho, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cgtcgcggtgctgatcggcaacgg	Protospacer
*. *** *****************

210. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP019938 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cacccccgtgctgatcggcaacgc	Protospacer
** * ******************

211. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgaggtgatcggcaacga	Protospacer
******** * ************.

212. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgcggtgctgatcgccaacgc	Protospacer
****** ********** *****

213. spacer 9.15|3215198|24|CP022578|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgaggtgatcggcaacga	Protospacer
******** * ************.

214. spacer 9.15|3215198|24|CP022578|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccctgctgatcgccaacgt	Protospacer
******* ********* *****

215. spacer 9.15|3215198|24|CP022578|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cggcgccgtgctgatcggcagcgg	Protospacer
*..*****************.***

216. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctcggcaaagg	Protospacer
 ************ ******* **

217. spacer 9.15|3215198|24|CP022578|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

218. spacer 9.15|3215198|24|CP022578|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

219. spacer 9.15|3215198|24|CP022578|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

220. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 3, identity: 0.885

gcggagtcgtcgccggccccgccggt	CRISPR spacer
accgagtcgccgccggccccgccggt	Protospacer
.* ******.****************

221. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
atcgccaccggcgccggtgccgc	Protospacer
.*.*******************.

222. spacer 12.7|4029351|23|CP022578|CRT matches to CP049262 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09b, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cttgccaccggctccggtgccgg	Protospacer
 *********** *********

223. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cgtgccgccggcgccggtgccgt	Protospacer
  ****.****************

224. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP016024 (Ralstonia insidiosa strain ATCC 49129 plasmid pRI-1, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
attgccaccggtgccggtgccga	Protospacer
.**********.**********

225. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
atcgccaccggcgccggtgccgc	Protospacer
.*.*******************.

226. spacer 12.7|4029351|23|CP022578|CRT matches to AP014203 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C76-MedDCM-OCT-S35-C25, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cttgccaccggcgacggtgccgc	Protospacer
 ************ ********.

227. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgcaaccggcgccggtgccag	Protospacer
***** ***************.

228. spacer 12.7|4029351|23|CP022578|CRT matches to KJ680225 (Uncultured bacterium plasmid PLAsvaD clone PLAsvaD-1, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
attgccaccggtgccggtgccga	Protospacer
.**********.**********

229. spacer 12.7|4029351|23|CP022578|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cgtgccgccggcgccggtgccgt	Protospacer
  ****.****************

230. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaac	Protospacer
*********************  .

231. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

232. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

233. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

234. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
cctgcgccgatcagcccggcgtcc	Protospacer
** *******************..

235. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgttg	Protospacer
 ************** *******

236. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgttg	Protospacer
 ************** *******

237. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggccccgatcagcccggcgtag	Protospacer
***** ****************

238. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

239. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

240. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggctttc	Protospacer
.******************* **.

241. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

242. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

243. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

244. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

245. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

246. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

247. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

248. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

249. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggctttc	Protospacer
.******************* **.

250. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021368 (Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatctgcccggcgtcc	Protospacer
************ *********..

251. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

252. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

253. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021364 (Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatctgcccggcgtcc	Protospacer
************ *********..

254. spacer 14.7|4159498|24|CP022578|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

255. spacer 14.7|4159498|24|CP022578|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

256. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

257. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

258. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcaccgatcagcccggcgagt	Protospacer
*****.***************  *

259. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgatg	Protospacer
****************** ** *

260. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgatg	Protospacer
****************** ** *

261. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

262. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

263. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

264. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

265. spacer 14.7|4159498|24|CP022578|CRT matches to CP052389 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaccagcccggcgatg	Protospacer
**********.********** *

266. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

267. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ctggcgcggatcagcccggcgttg	Protospacer
*.***** ***************

268. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

269. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

270. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

271. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

272. spacer 14.7|4159498|24|CP022578|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

273. spacer 14.7|4159498|24|CP022578|CRT matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

274. spacer 14.7|4159498|24|CP022578|CRT matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

275. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgcctatcaggccggcgttt	Protospacer
.******* ***** *********

276. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

277. spacer 14.7|4159498|24|CP022578|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

278. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgcctatcaggccggcgttt	Protospacer
.******* ***** *********

279. spacer 14.7|4159498|24|CP022578|CRT matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

280. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

281. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021026 (Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

282. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

283. spacer 14.7|4159498|24|CP022578|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

284. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

285. spacer 14.7|4159498|24|CP022578|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

286. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

287. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

288. spacer 14.7|4159498|24|CP022578|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

289. spacer 14.7|4159498|24|CP022578|CRT matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

290. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

291. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

292. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

293. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

294. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

295. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

296. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

297. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

298. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

299. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

300. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

301. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

302. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

303. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

304. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

305. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

306. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

307. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

308. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

309. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

310. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

311. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

312. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

313. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

314. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_LN831788 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence) position: , mismatch: 3, identity: 0.889

ccggcgccgccatcgccgaccaggtac-	CRISPR spacer
cccgcgccgccatggccgacca-gtacg	Protospacer
** ********** ******** ****

315. spacer 3.6|1499893|27|CP022578|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctcgtggccgacgccggc	Protospacer
 ******* ****.************.

316. spacer 3.6|1499893|27|CP022578|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctcgtggccgacgccggc	Protospacer
 ******* ****.************.

317. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gccggcggtctcggggccgacgccggg	Protospacer
*.****** **** ************

318. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gccggcggtctcggggccgacgccggg	Protospacer
*.****** **** ************

319. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP050100 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggcgtcgcggccgacgccgat	Protospacer
 *******  ***************.*

320. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP009439 (Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcgggctcgcggccggcgccgat	Protospacer
 *******.**********.*****.*

321. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggcgtcgcggccgacgccgat	Protospacer
 *******  ***************.*

322. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ggcggcggactccccgccgacgccgct	Protospacer
* ********** * ********** *

323. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
acgcccgccgccacccgccgagcgg	Protospacer
.  ******************** *

324. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
ctccccgccgccaccggccgcgctg	Protospacer
  ************* **** ****

325. spacer 4.1|2711030|25|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
accaccgccgccccccgccgagctg	Protospacer
. * ******** ************

326. spacer 4.1|2711030|25|CP022578|CRT matches to MH338239 (Mycobacterium phage Mryolo, complete genome) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
atccccgccgccatccgccgcgctg	Protospacer
. ***********.****** ****

327. spacer 4.1|2711030|25|CP022578|CRT matches to MK305893 (Mycobacterium phage Beatrix, complete genome) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
atccccgccgccatccgccgcgctg	Protospacer
. ***********.****** ****

328. spacer 4.1|2711030|25|CP022578|CRT matches to MN617845 (Mycobacterium phage BaconJack, complete genome) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
tcccccgccgccatccgccgcgctg	Protospacer
  ***********.****** ****

329. spacer 4.1|2711030|25|CP022578|CRT matches to MK359312 (Mycobacterium phage Fushigi, complete genome) position: , mismatch: 4, identity: 0.84

ggccccgccgccacccgccgagctg	CRISPR spacer
atccccgccgccatccgccgcgctg	Protospacer
. ***********.****** ****

330. spacer 9.11|3215011|27|CP022578|CRT matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

gaacggcggcttgctcttcggctccgc	CRISPR spacer
gctcggcggcgtgatcttcggctccgc	Protospacer
*  ******* ** *************

331. spacer 9.13|3215104|24|CP022578|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 4, identity: 0.833

tgacggtggccacgccggggtgtt	CRISPR spacer
ccgcggcggccacgccggggtgtt	Protospacer
. .***.*****************

332. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
ggacgccgtgctgatcggcaccgc	Protospacer
 .****************** **

333. spacer 9.15|3215198|24|CP022578|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
tggcgccgtgctgttcggcaacgg	Protospacer
...********** **********

334. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
tggcgccgtgctgttcggcaacgg	Protospacer
...********** **********

335. spacer 9.15|3215198|24|CP022578|CRT matches to NZ_CP041162 (Leisingera aquaemixtae strain R2C4 plasmid unnamed6) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
gcccgccgtgctgttcggcaacgg	Protospacer
   ********** **********

336. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_DQ996271 (Burkholderia glumae BGR1 plasmid pBGF3, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggcgctgttggtgccgccgaa	Protospacer
******* **.*************.

337. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
cggccggtgcccttggtgccgccggt	Protospacer
  ***** *** **************

338. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ttggcggagccggtggtgccgccggt	Protospacer
 .* ******** *************

339. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP026546 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed2) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagcctttggtgtcgccggc	Protospacer
 ********** ******.******.

340. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggagccgttggtgccatcgcg	Protospacer
********************..**

341. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggagccgttggtgccatcgcg	Protospacer
********************..**

342. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ttggcggagccggtggtgccgccggt	Protospacer
 .* ******** *************

343. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggtgccgctggtgccgccggt	Protospacer
..***** ****.*************

344. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
cggccggtgcccttggtgccgccggt	Protospacer
  ***** *** **************

345. spacer 11.7|4009616|26|CP022578|CRT matches to KT281796 (Mycobacterium phage Zakhe101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

346. spacer 11.7|4009616|26|CP022578|CRT matches to AY129335 (Mycobacterium virus Corndog, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

347. spacer 11.7|4009616|26|CP022578|CRT matches to MK493325 (Synechococcus phage S-RIM8 isolate RW_62_0316, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

348. spacer 11.7|4009616|26|CP022578|CRT matches to MK493322 (Synechococcus phage S-RIM8 isolate RW_01_0115_WH8101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

349. spacer 11.7|4009616|26|CP022578|CRT matches to KX349288 (Synechococcus phage S-RIM8 isolate RW_08_0711, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

350. spacer 11.7|4009616|26|CP022578|CRT matches to MN428058 (Mycobacterium phage Krili, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

351. spacer 11.7|4009616|26|CP022578|CRT matches to KX349286 (Synechococcus phage S-RIM8 isolate RW_03_0807_WH8101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

352. spacer 11.7|4009616|26|CP022578|CRT matches to NC_004685 (Mycobacterium phage Corndog, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

353. spacer 11.7|4009616|26|CP022578|CRT matches to JN698993 (Mycobacterium phage Firecracker, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

354. spacer 11.7|4009616|26|CP022578|CRT matches to MK493324 (Synechococcus phage S-RIM8 isolate RW_22_0214, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

355. spacer 11.7|4009616|26|CP022578|CRT matches to KX349290 (Synechococcus phage S-RIM8 isolate RW_25_1112, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

356. spacer 11.7|4009616|26|CP022578|CRT matches to KX349287 (Synechococcus phage S-RIM8 isolate RW_06_0613, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

357. spacer 11.7|4009616|26|CP022578|CRT matches to MN585964 (Mycobacterium phage Blessica, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

358. spacer 11.7|4009616|26|CP022578|CRT matches to NC_022057 (Mycobacterium phage Catdawg, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

359. spacer 11.7|4009616|26|CP022578|CRT matches to MT818425 (Mycobacterium phage NiebruSaylor, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

360. spacer 11.7|4009616|26|CP022578|CRT matches to NC_022325 (Mycobacterium phage Dylan, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

361. spacer 11.7|4009616|26|CP022578|CRT matches to MN428052 (Mycobacterium phage Smooch, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

362. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
tcgccggagccggtggtgctgccgct	Protospacer
 *********** ******.**** *

363. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
tcgccggagccggtggtgctgccgct	Protospacer
 *********** ******.**** *

364. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_AP022578 (Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgcccgagccgttggcgccgccagc	Protospacer
***** **********.******.*.

365. spacer 11.7|4009616|26|CP022578|CRT matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gagccggagccgctggtgccgcccga	Protospacer
* **********.********** *

366. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

367. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

368. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

369. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgttgccggccccgccggt	Protospacer
. ** *****.***************

370. spacer 11.10|4009853|26|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggccccgccgga	Protospacer
. ** ********************

371. spacer 11.10|4009853|26|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

372. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

373. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

374. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

375. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

376. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

377. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

378. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP015441 (Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagacggcgccggccccgccgca	Protospacer
****** ** **************

379. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagtcctcgccggcgccgccgcc	Protospacer
******** ******** ****** .

380. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggcgtcgtcgccggcctcgccgat	Protospacer
 *** *************.*****.*

381. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcgaagtcgtcgccggccccgatggc	Protospacer
***.***************** .**.

382. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 4, identity: 0.875

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atcaccgccggtgccgtcgtcgccgccggcct	Protospacer
.** ************.**************.

383. spacer 13.6|4030672|28|CP022578|CRT matches to NC_008712 (Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence) position: , mismatch: 4, identity: 0.857

ggcacggtgatggtggtgccctgtgcgc-	CRISPR spacer
ggcacggtgatcgtggagccctg-gctcg	Protospacer
*********** **** ****** ** *

384. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP035418 (Leisingera sp. NJS204 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggcggca	Protospacer
 ******************** .

385. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP038237 (Leisingera sp. NJS201 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggcggca	Protospacer
 ******************** .

386. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

387. spacer 14.7|4159498|24|CP022578|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

388. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

389. spacer 14.7|4159498|24|CP022578|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgataagcccggcgtca	Protospacer
 ********** **********.

390. spacer 14.7|4159498|24|CP022578|CRT matches to LR134132 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 12) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgacg	Protospacer
******** ************ .

391. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

392. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

393. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaccagcccggcgaag	Protospacer
**********.**********

394. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

395. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaacagcccggcgagg	Protospacer
********** **********

396. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcacggcgggc	Protospacer
*************** *****  .

397. spacer 14.7|4159498|24|CP022578|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgaag	Protospacer
******** ************

398. spacer 14.7|4159498|24|CP022578|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggcgagg	Protospacer
************** ******

399. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

400. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgacgagg	Protospacer
******************.**

401. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgaga	Protospacer
**************** ****

402. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP041043 (Paracoccus sp. AK26 plasmid pAK3, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgacgatcagcccggcgacc	Protospacer
****** ************** ..

403. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

404. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgaag	Protospacer
****************** **

405. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

406. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgaga	Protospacer
**************** ****

407. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

408. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccgtcgtca	Protospacer
.***************** ***.

409. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

410. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

411. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

412. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgaag	Protospacer
******** ************

413. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

414. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

415. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcacggcgggc	Protospacer
*************** *****  .

416. spacer 14.7|4159498|24|CP022578|CRT matches to MK494131 (Mycobacterium phage GodPhather, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcgcggcgcca	Protospacer
*************** *****..

417. spacer 14.7|4159498|24|CP022578|CRT matches to MH001450 (Mycobacterium phage Jeon, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcgcggcgcca	Protospacer
*************** *****..

418. spacer 14.13|4159831|27|CP022578|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgcccaggtcg	Protospacer
*** ************** ******

419. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccgacgaggaag	Protospacer
.******************* *** *

420. spacer 14.13|4159831|27|CP022578|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccctcgccgacgaggtgg	Protospacer
*********** ******** ****.

421. spacer 14.13|4159831|27|CP022578|CRT matches to MN586047 (Gordonia phage EMoore, complete genome) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgtcatcgccgagcaggtcg	Protospacer
*********.********* *****

422. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccaccatcgccgacctggcgc	Protospacer
********.************ **..*

423. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgtcgccatcggcgaccaggtgc	Protospacer
 *****.******** *********.*

424. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgacgccgccatagccgaccaggccc	Protospacer
***.********* **********. *

425. spacer 14.13|4159831|27|CP022578|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgacgccgccatagccgaccaggccc	Protospacer
***.********* **********. *

426. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgtccccatcgccgaccaggaag	Protospacer
******.* *************** *

427. spacer 3.6|1499893|27|CP022578|CRT matches to MN657133 (Cryobacterium sp. strain ANT_H10B plasmid pA10BH1, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gcgtgcggtctcgcggccgacgccggc	Protospacer
*.  **** *****************.

428. spacer 3.6|1499893|27|CP022578|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ggcggcggactcgcggccgtcgccatc	Protospacer
* ***************** ****. .

429. spacer 3.6|1499893|27|CP022578|CRT matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
tgcggcggactggcggtcgacgccggc	Protospacer
  ********* ****.*********.

430. spacer 3.6|1499893|27|CP022578|CRT matches to MK937603 (Gordonia phage Bakery, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gacggcggactcgcggtcgccgccgcg	Protospacer
* **************.** *****

431. spacer 3.6|1499893|27|CP022578|CRT matches to KM389402 (UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00002 genomic sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

432. spacer 3.6|1499893|27|CP022578|CRT matches to NC_003278 (Pseudomonas phage phiCTX, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

433. spacer 3.6|1499893|27|CP022578|CRT matches to Y13918 (Pseudomonas aeruginosa phage phi CTX DNA, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

434. spacer 3.6|1499893|27|CP022578|CRT matches to AB008550 (Pseudomonas phage phiCTX DNA, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

435. spacer 3.6|1499893|27|CP022578|CRT matches to MK034952 (Pseudomonas phage Dobby, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

436. spacer 3.7|1499938|30|CP022578|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.833

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggcgca	Protospacer
* ************** ****** ****

437. spacer 3.7|1499938|30|CP022578|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggcgca	Protospacer
* ************** ****** ****

438. spacer 9.11|3215011|27|CP022578|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 5, identity: 0.815

gaacggcggcttgctcttcggctccgc	CRISPR spacer
catcggcggctttctcttcggcttcgt	Protospacer
 * ********* **********.**.

439. spacer 9.14|3215149|28|CP022578|CRT matches to NZ_CP011276 (Planctomyces sp. SH-PL62 plasmid pPL62-3, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
gcgccggcgggttcggcgccggtaacgc	Protospacer
 .***********.********** **

440. spacer 9.14|3215149|28|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggcgggtttggggccgggcgggg	Protospacer
**************** *****    **

441. spacer 9.14|3215149|28|CP022578|CRT matches to CP048434 (Collinsella aerofaciens ATCC 25986 strain JCM 10188 plasmid putative_pCaero1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
tgtgcggcggatttcgcgccggtaccgg	Protospacer
*   ******.*** *************

442. spacer 9.14|3215149|28|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggcgggtttggggccgggcgggg	Protospacer
**************** *****    **

443. spacer 9.14|3215149|28|CP022578|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

444. spacer 9.14|3215149|28|CP022578|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

445. spacer 9.14|3215149|28|CP022578|CRT matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

446. spacer 9.14|3215149|28|CP022578|CRT matches to JN698994 (Mycobacterium phage DS6A, complete genome) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ctgccggcgggttaggcgccggcgcagg	Protospacer
.************ ********..* **

447. spacer 11.1|4009127|29|CP022578|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
ccggtgggtgctcctccgtcggcgcacac	Protospacer
******* ***.*************   *

448. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgatgttgccgttgctgccggt	Protospacer
********* **.***********  * *

449. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

----gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
atcggtg----cggtgctgccgttgctgaagct	Protospacer
    ***    ** *******************

450. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgccgccgttgccgccgtt	Protospacer
*************.********.*  *.*

451. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gcggcgccgttgctggcgatgctgaagcc	Protospacer
*.* *********** ** *********.

452. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

gtgc-cgccgttgctgccgttgctgaagct	CRISPR spacer
-tacgcgcggttgctgccgtcgctgaagtt	Protospacer
 *.* *** ***********.*******.*

453. spacer 11.6|4009544|29|CP022578|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.828

gtgc-cgccgttgctgccgttgctgaagct	CRISPR spacer
-tacgcgcggttgctgccgtcgctgaagtt	Protospacer
 *.* *** ***********.*******.*

454. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggagccgttgatgccgccgcc	Protospacer
..*************.******** .

455. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggagccgttgatgccgccgcc	Protospacer
..*************.******** .

456. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttgttgccgcgtat	Protospacer
 ************** ******  .*

457. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttgttgccgcgtat	Protospacer
 ************** ******  .*

458. spacer 11.7|4009616|26|CP022578|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccgcagccggtggtgccgcctcc	Protospacer
****** ***** **********  .

459. spacer 11.7|4009616|26|CP022578|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccgcagccggtggtgccgcctcc	Protospacer
****** ***** **********  .

460. spacer 11.7|4009616|26|CP022578|CRT matches to NZ_CP045120 (Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttcttgccgccgcc	Protospacer
 *************  ******** .

461. spacer 11.7|4009616|26|CP022578|CRT matches to MT855965 (Microcystis phage vB_MaeS-yong1, complete genome) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgcccgagccgttgctgccgccgcg	Protospacer
 **** ********* ********

462. spacer 11.7|4009616|26|CP022578|CRT matches to MN585977 (Mycobacterium phage Atcoo, complete genome) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggtgccgctggtgccgccgcg	Protospacer
 ****** ****.***********

463. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

464. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

465. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

466. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

467. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagatgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

468. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

469. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagacgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

470. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

471. spacer 11.10|4009853|26|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aggctgtcgtcgccggccccgccggc	Protospacer
. *  ********************.

472. spacer 11.10|4009853|26|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tagctgtcgtcgccggccccgccgat	Protospacer
  *  *******************.*

473. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

474. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

475. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

476. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

477. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

478. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagatgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

479. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

480. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

481. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

482. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcaccggccccgccggt	Protospacer
.  * ******.**************

483. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

484. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

485. spacer 11.10|4009853|26|CP022578|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
ccggagtcgtcgccgccctcgccgcg	Protospacer
 ************** **.*****

486. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcactctcgtcgccggccccgccggg	Protospacer
**.   *******************

487. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

488. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

489. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

490. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agggagtcgtcgccgtcctcgccgga	Protospacer
. ************* **.******

491. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atcgtgtcgtcgccgcccccgccggt	Protospacer
.. * ********** **********

492. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP041042 (Paracoccus sp. AK26 plasmid pAK4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agggtgtcgtcgcctgccccgccgga	Protospacer
. ** ********* **********

493. spacer 11.10|4009853|26|CP022578|CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
caggtgtcgccgccggccccgccggg	Protospacer
  ** ****.***************

494. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_MN366361 (Bacterium plasmid pALTS33, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
acggagccgtcgccggcctcgccgcc	Protospacer
.*****.***********.***** .

495. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgttgccggccccgccggt	Protospacer
.  * *****.***************

496. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 5, identity: 0.844

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggtcgccgtcgccggtgctt-cgttc	Protospacer
. ************* *********.* ****

497. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

ttgccggggtcgccggcgccggt--gcctgcgtt	CRISPR spacer
ttgccggggtcgccggctgcggtgggcttgcg--	Protospacer
*****************  ****  **.****

498. spacer 12.4|4029189|32|CP022578|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcctccgccggtgccgccgtcgccgccgcagc	Protospacer
*.*.************************   *

499. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtccccgcccgtgccgccgccgccgccgatcg	Protospacer
********* *********.********..*

500. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgccgccggtgccgccgtggccgccggtgc	Protospacer
*.* **************** ********. *

501. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtatccgccggtcccgccggcgccgccggcac	Protospacer
** .******** ****** ********** *

502. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccg--ccggccc	CRISPR spacer
gtcccggccggtgccgccgtccccgtttcggc--	Protospacer
***** *************** ***  .****

503. spacer 13.6|4030672|28|CP022578|CRT matches to NC_034248 (Rhizobium phage RHEph10, complete genome) position: , mismatch: 5, identity: 0.821

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
ggaacggtaatggtggtgccctggacga	Protospacer
** *****.************** .**

504. spacer 14.1|4159156|27|CP022578|CRT matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

505. spacer 14.1|4159156|27|CP022578|CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

506. spacer 14.1|4159156|27|CP022578|CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

507. spacer 14.6|4159450|27|CP022578|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acgccaccggtttggtttccgccggcg	CRISPR spacer
catccaccgatttggcttccgccggcg	Protospacer
   ******.*****.***********

508. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP041156 (Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggctgcg	Protospacer
 *******************  .

509. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

510. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

511. spacer 14.7|4159498|24|CP022578|CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

512. spacer 14.11|4159720|27|CP022578|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgccgccgtacagccacccggcctgt	Protospacer
****.****** ************  .

513. spacer 14.11|4159720|27|CP022578|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgccgccgtacagccacccggcctgt	Protospacer
****.****** ************  .

514. spacer 14.11|4159720|27|CP022578|CRT matches to MK359320 (Mycobacterium phage Cookies, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

515. spacer 14.11|4159720|27|CP022578|CRT matches to KX611831 (Mycobacterium phage Pharsalus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

516. spacer 14.11|4159720|27|CP022578|CRT matches to NC_041844 (Mycobacterium phage Optimus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

517. spacer 14.11|4159720|27|CP022578|CRT matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

518. spacer 14.11|4159720|27|CP022578|CRT matches to MH230878 (Mycobacterium phage Oogway, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

519. spacer 14.11|4159720|27|CP022578|CRT matches to MN585999 (Mycobacterium phage Briton15, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

520. spacer 14.11|4159720|27|CP022578|CRT matches to MG962370 (Mycobacterium phage Kykar, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

521. spacer 14.11|4159720|27|CP022578|CRT matches to MH576975 (Mycobacterium phage Target, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

522. spacer 14.11|4159720|27|CP022578|CRT matches to MK359331 (Mycobacterium phage Rajelicia, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

523. spacer 14.11|4159720|27|CP022578|CRT matches to MH744414 (Mycobacterium phage Arcanine, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

524. spacer 14.11|4159720|27|CP022578|CRT matches to KF493880 (Mycobacterium phage HanShotFirst, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

525. spacer 14.11|4159720|27|CP022578|CRT matches to JF937103 (Mycobacterium virus Museum, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

526. spacer 14.11|4159720|27|CP022578|CRT matches to MH576971 (Mycobacterium phage Arlo, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

527. spacer 14.11|4159720|27|CP022578|CRT matches to MH697575 (Mycobacterium phage Adahisdi, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

528. spacer 14.11|4159720|27|CP022578|CRT matches to KJ409696 (Mycobacterium phage Lamina13, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

529. spacer 14.11|4159720|27|CP022578|CRT matches to NC_028784 (Mycobacterium phage Tasp14, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

530. spacer 14.11|4159720|27|CP022578|CRT matches to KT259047 (Mycobacterium phage Rufus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

531. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgaccagaccg	Protospacer
*** *******************..

532. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgtcgccgccaccgccgaccaggccg	Protospacer
*** ********.***********.

533. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

534. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

535. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgttatcgccgaccaggccg	Protospacer
*********..*************.

536. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccattgccgtccaggtcg	Protospacer
.************.**** ******

537. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccgtcgccgaccaccagc	Protospacer
***********.**********   .*

538. spacer 14.13|4159831|27|CP022578|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccgtcgccgaccaccagc	Protospacer
***********.**********   .*

539. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

540. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

541. spacer 14.13|4159831|27|CP022578|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccaccgccgatcaggcga	Protospacer
************.******.****..

542. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cgggcgccgccatcgccgtccagctcg	Protospacer
* **************** **** *

543. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP042276 (Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cgatcgccgccatcgtcgaccagggac	Protospacer
* . ***********.******** **

544. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccctcgccgacaaggatc	Protospacer
.********** ******** ***  *

545. spacer 14.13|4159831|27|CP022578|CRT matches to NC_007491 (Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

546. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP029339 (Streptomyces sp. SM17 plasmid pSM17A, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

547. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggtgccggcatcgccgaccagggtc	Protospacer
.***.**** **************  *

548. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggtgccggcatcgccgaccagggtc	Protospacer
.***.**** **************  *

549. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP011297 (Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

550. spacer 14.13|4159831|27|CP022578|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgacc-aggtac	CRISPR spacer
ccggcgccgccatcgacgaccttagca-	Protospacer
*************** *****  .*.*

551. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP017304 (Rhodococcus sp. YL-1 plasmid pYLL2 sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

552. spacer 14.13|4159831|27|CP022578|CRT matches to NC_005073 (Rhodococcus erythropolis linear plasmid pBD2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

553. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgacgacatcgccgaccagatca	Protospacer
****** ** *************.*

554. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

555. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

556. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

557. spacer 14.13|4159831|27|CP022578|CRT matches to NC_010311 (Streptomyces sp. HK1 plasmid pSHK1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

558. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

559. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccggcattgccgaccagcagc	Protospacer
********* ***.*********  .*

560. spacer 14.13|4159831|27|CP022578|CRT matches to CP000385 (Mycobacterium sp. MCS Plasmid1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccattggcgaccagcccc	Protospacer
*************.* ******* . *

561. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

562. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

563. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

564. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac---	CRISPR spacer
acggcgccgccatcgccgac---gtcctca	Protospacer
 *******************   ** *

565. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP046100 (Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

566. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

567. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

568. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP014942 (Rhodococcus sp. BH4 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

569. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP014942 (Rhodococcus sp. BH4 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

570. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

571. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP017303 (Rhodococcus sp. YL-1 plasmid pYLL1 sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

572. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccggcgccgaccagcagc	Protospacer
***********. **********  .*

573. spacer 14.13|4159831|27|CP022578|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgacgagctga	Protospacer
** ***************** ** *.

574. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP050125 (Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

575. spacer 14.13|4159831|27|CP022578|CRT matches to NC_008704 (Mycobacterium sp. KMS plasmid pMKMS02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccattggcgaccagcccc	Protospacer
*************.* ******* . *

576. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

577. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccagcgcctaccaggccc	Protospacer
.*********** **** ******. *

578. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP045549 (Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
agggcgccgccctcgccgaccacgtgc	Protospacer
  ********* ********** **.*

579. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP034156 (Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

580. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP034156 (Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

581. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
acgtcgccgccatcgccgcccaggcgc	Protospacer
 ** ************** *****..*

582. spacer 3.6|1499893|27|CP022578|CRT matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 6, identity: 0.778

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctggcggccgacgccccg	Protospacer
 ******* ** ************

583. spacer 3.6|1499893|27|CP022578|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 6, identity: 0.778

gtcggcggactcgcggccgacgccggt	CRISPR spacer
cgcggcgaactcgcggccggcgccgtc	Protospacer
  *****.***********.***** .

584. spacer 3.7|1499938|30|CP022578|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gtgagcgggttgttcctcggcgtggggggc	Protospacer
*  .***********.********** **.

585. spacer 3.7|1499938|30|CP022578|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggtgca	Protospacer
* ************** ****** **.*

586. spacer 3.7|1499938|30|CP022578|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggtgca	Protospacer
* ************** ****** **.*

587. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to GQ141189 (Bifidobacterium phage Bbif-1, complete sequence) position: , mismatch: 6, identity: 0.806

gggtcca----acggttcggcttgccgttcgcgct	CRISPR spacer
----ccagcgcatggttcggctggccgttcgcgct	Protospacer
    ***    *.********* ************

588. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaaaatgccgtcgatgccggcaacgccgag	Protospacer
**.* .*****.************.****

589. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaaaatgccgtcgatgccggcaacgccgag	Protospacer
**.* .*****.************.****

590. spacer 11.1|4009127|29|CP022578|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 6, identity: 0.793

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
ccggtggtcgcccctccgtcggcgacgat	Protospacer
*******..*************** *. .

591. spacer 11.1|4009127|29|CP022578|CRT matches to MK305891 (Streptomyces phage Gibson, complete genome) position: , mismatch: 6, identity: 0.793

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggcggctgccactccgtcggcgtagtc	Protospacer
 ***.******* ***********. .**

592. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tcgccgccgttgatgccgttgttgaagac	Protospacer
 .********** ********.***** .

593. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct---	CRISPR spacer
gtgccgccgatgctgccgt---tggcgctcag	Protospacer
********* *********   **. ***

594. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP014799 (Salipiger profundus strain JLT2016 plasmid pTPRO3, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tcgccgccgttgcggccgttgctgaggaa	Protospacer
 .*********** ***********.*

595. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgttgctgaaagc	Protospacer
*  ****.******************. .

596. spacer 11.6|4009544|29|CP022578|CRT matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggactc	Protospacer
 ************.**********.* ..

597. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgccgtt	Protospacer
 ************.********.*  *.*

598. spacer 11.6|4009544|29|CP022578|CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gatccgctgctgctgccgttgctgaaggc	Protospacer
*  ****.*.***************** .

599. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gatccgctgctgctgccgttgctgaaggc	Protospacer
*  ****.*.***************** .

600. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgtttctgccgtcgctgatccg	Protospacer
 ********** *******.*****  *

601. spacer 11.6|4009544|29|CP022578|CRT matches to NC_031109 (Gordonia phage Jumbo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccggtgctgccggtgctgcgggc	Protospacer
********* ******** ***** .* .

602. spacer 11.6|4009544|29|CP022578|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

603. spacer 11.6|4009544|29|CP022578|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

604. spacer 11.6|4009544|29|CP022578|CRT matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

605. spacer 11.6|4009544|29|CP022578|CRT matches to MK494110 (Mycobacterium phage SwagPigglett, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

606. spacer 11.6|4009544|29|CP022578|CRT matches to MH479919 (Mycobacterium phage Moose, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

607. spacer 11.6|4009544|29|CP022578|CRT matches to KY012363 (Mycobacterium phage Empress, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

608. spacer 11.6|4009544|29|CP022578|CRT matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

609. spacer 11.6|4009544|29|CP022578|CRT matches to MH669010 (Mycobacterium phage PHappiness, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

610. spacer 11.6|4009544|29|CP022578|CRT matches to MH669003 (Mycobacterium phage Girr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

611. spacer 11.6|4009544|29|CP022578|CRT matches to MG925342 (Mycobacterium phage Forsytheast, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

612. spacer 11.6|4009544|29|CP022578|CRT matches to MK359354 (Mycobacterium phage PinkPlastic, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

613. spacer 11.6|4009544|29|CP022578|CRT matches to MH632118 (Mycobacterium phage Zeeculate, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

614. spacer 11.6|4009544|29|CP022578|CRT matches to MG872836 (Mycobacterium phage Fajezeel, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

615. spacer 11.6|4009544|29|CP022578|CRT matches to MN585999 (Mycobacterium phage Briton15, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

616. spacer 11.6|4009544|29|CP022578|CRT matches to MG872841 (Mycobacterium phage Priscilla, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

617. spacer 11.6|4009544|29|CP022578|CRT matches to MH155865 (Mycobacterium phage BobaPhett, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

618. spacer 11.6|4009544|29|CP022578|CRT matches to MN585985 (Mycobacterium phage Watermelon, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

619. spacer 11.6|4009544|29|CP022578|CRT matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

620. spacer 11.6|4009544|29|CP022578|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

621. spacer 11.6|4009544|29|CP022578|CRT matches to MH651169 (Mycobacterium phage Burwell21, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

622. spacer 11.6|4009544|29|CP022578|CRT matches to MG925344 (Mycobacterium phage Ichabod, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

623. spacer 11.6|4009544|29|CP022578|CRT matches to MK359315 (Mycobacterium phage MisterCuddles, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

624. spacer 11.6|4009544|29|CP022578|CRT matches to MH697581 (Mycobacterium phage Crispicous1, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

625. spacer 11.6|4009544|29|CP022578|CRT matches to MK359299 (Mycobacterium phage Petp2012, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

626. spacer 11.6|4009544|29|CP022578|CRT matches to MH371120 (Mycobacterium phage OlympiaSaint, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

627. spacer 11.6|4009544|29|CP022578|CRT matches to MF190168 (Mycobacterium phage Spoonbill, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

628. spacer 11.6|4009544|29|CP022578|CRT matches to MG925340 (Mycobacterium phage Corvo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

629. spacer 11.6|4009544|29|CP022578|CRT matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

630. spacer 11.6|4009544|29|CP022578|CRT matches to MN735433 (Mycobacterium phage Scottish, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

631. spacer 11.6|4009544|29|CP022578|CRT matches to MG920060 (Mycobacterium phage Bob3, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

632. spacer 11.6|4009544|29|CP022578|CRT matches to MH338239 (Mycobacterium phage Mryolo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

633. spacer 11.6|4009544|29|CP022578|CRT matches to MH651183 (Mycobacterium phage Nivrat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

634. spacer 11.6|4009544|29|CP022578|CRT matches to NC_021297 (Mycobacterium phage PattyP, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

635. spacer 11.6|4009544|29|CP022578|CRT matches to KY224001 (Mycobacterium phage Blue, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

636. spacer 11.6|4009544|29|CP022578|CRT matches to MF919508 (Mycobacterium phage ILeeKay, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

637. spacer 11.6|4009544|29|CP022578|CRT matches to AY500152 (Mycobacteriophage U2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

638. spacer 11.6|4009544|29|CP022578|CRT matches to MG770213 (Mycobacterium phage OldBen, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

639. spacer 11.6|4009544|29|CP022578|CRT matches to MK967387 (Mycobacterium phage Big3, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

640. spacer 11.6|4009544|29|CP022578|CRT matches to MH651188 (Mycobacterium phage Ruby, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

641. spacer 11.6|4009544|29|CP022578|CRT matches to NC_041989 (Mycobacterium phage Shauna1, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

642. spacer 11.6|4009544|29|CP022578|CRT matches to JN020140 (Mycobacterium virus MrGordo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

643. spacer 11.6|4009544|29|CP022578|CRT matches to MH834617 (Mycobacterium phage Lizziana, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

644. spacer 11.6|4009544|29|CP022578|CRT matches to EU744251 (Mycobacterium phage Jasper, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

645. spacer 11.6|4009544|29|CP022578|CRT matches to MK524499 (Mycobacterium phage Tripl3t, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

646. spacer 11.6|4009544|29|CP022578|CRT matches to MK820638 (Mycobacterium phage HermioneGrange, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

647. spacer 11.6|4009544|29|CP022578|CRT matches to NC_041988 (Mycobacterium phage ShiLan, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

648. spacer 11.6|4009544|29|CP022578|CRT matches to KX522649 (Mycobacterium phage Bircsak, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

649. spacer 11.6|4009544|29|CP022578|CRT matches to MK524517 (Mycobacterium phage James, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

650. spacer 11.6|4009544|29|CP022578|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

651. spacer 11.6|4009544|29|CP022578|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

652. spacer 11.6|4009544|29|CP022578|CRT matches to MG962372 (Mycobacterium phage McGuire, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

653. spacer 11.6|4009544|29|CP022578|CRT matches to MK305893 (Mycobacterium phage Beatrix, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

654. spacer 11.6|4009544|29|CP022578|CRT matches to MK016494 (Mycobacterium phage Filuzino, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

655. spacer 11.6|4009544|29|CP022578|CRT matches to KM066034 (Mycobacterium phage Inventum, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

656. spacer 11.6|4009544|29|CP022578|CRT matches to MN586011 (Mycobacterium phage LilMoolah, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

657. spacer 11.6|4009544|29|CP022578|CRT matches to KT438500 (Mycobacterium phage Pari, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

658. spacer 11.6|4009544|29|CP022578|CRT matches to MH338238 (Mycobacterium phage Michley, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

659. spacer 11.6|4009544|29|CP022578|CRT matches to MH399784 (Mycobacterium phage NormanBulbieJr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

660. spacer 11.6|4009544|29|CP022578|CRT matches to MT310893 (Mycobacterium phage DRBy19, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

661. spacer 11.6|4009544|29|CP022578|CRT matches to MH399771 (Mycobacterium phage ByChance, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

662. spacer 11.6|4009544|29|CP022578|CRT matches to KX522943 (Mycobacterium phage Gompeii16, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

663. spacer 11.6|4009544|29|CP022578|CRT matches to KY702574 (Mycobacterium phage Kingsley, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

664. spacer 11.6|4009544|29|CP022578|CRT matches to MH450133 (Mycobacterium phage SwissCheese, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

665. spacer 11.6|4009544|29|CP022578|CRT matches to NC_009877 (Mycobacterium phage U2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

666. spacer 11.6|4009544|29|CP022578|CRT matches to KJ025956 (Mycobacterium phage Saal, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

667. spacer 11.6|4009544|29|CP022578|CRT matches to MN813700 (Mycobacterium phage Atkinbua, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

668. spacer 11.6|4009544|29|CP022578|CRT matches to NC_024136 (Mycobacterium phage Seabiscuit, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

669. spacer 11.6|4009544|29|CP022578|CRT matches to MN369751 (Mycobacterium phage TDanisky, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

670. spacer 11.6|4009544|29|CP022578|CRT matches to MT639644 (Mycobacterium phage MaryBeth, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

671. spacer 11.6|4009544|29|CP022578|CRT matches to MT639654 (Mycobacterium phage Jerm2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

672. spacer 11.6|4009544|29|CP022578|CRT matches to MH590602 (Mycobacterium phage Gorge, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

673. spacer 11.6|4009544|29|CP022578|CRT matches to JF937108 (Mycobacterium phage Switzer, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

674. spacer 11.6|4009544|29|CP022578|CRT matches to JN660814 (Mycobacterium phage Dreamboat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

675. spacer 11.6|4009544|29|CP022578|CRT matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

676. spacer 11.6|4009544|29|CP022578|CRT matches to MH669011 (Mycobacterium phage PherrisBueller, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

677. spacer 11.6|4009544|29|CP022578|CRT matches to NC_023687 (Mycobacterium phage Bruns, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

678. spacer 11.6|4009544|29|CP022578|CRT matches to MK310141 (Mycobacterium phage Fenn, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

679. spacer 11.6|4009544|29|CP022578|CRT matches to JF937103 (Mycobacterium virus Museum, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

680. spacer 11.6|4009544|29|CP022578|CRT matches to MH669005 (Mycobacterium phage JoeyJr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

681. spacer 11.6|4009544|29|CP022578|CRT matches to NC_028654 (Mycobacterium phage Sparkdehlily, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

682. spacer 11.6|4009544|29|CP022578|CRT matches to MK524523 (Mycobacterium phage Naira, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

683. spacer 11.6|4009544|29|CP022578|CRT matches to MH450113 (Mycobacterium phage BigMau, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

684. spacer 11.6|4009544|29|CP022578|CRT matches to MN444869 (Mycobacterium phage DreamCatcher, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

685. spacer 11.6|4009544|29|CP022578|CRT matches to NC_023695 (Mycobacterium phage Violet, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

686. spacer 11.6|4009544|29|CP022578|CRT matches to MG812495 (Mycobacterium phage Pippin, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

687. spacer 11.6|4009544|29|CP022578|CRT matches to NC_023726 (Mycobacterium phage Euphoria, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

688. spacer 11.6|4009544|29|CP022578|CRT matches to MG812489 (Mycobacterium phage Greg, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

689. spacer 11.6|4009544|29|CP022578|CRT matches to MT310897 (Mycobacterium phage Manatee, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

690. spacer 11.6|4009544|29|CP022578|CRT matches to MH155871 (Mycobacterium phage Mattes, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

691. spacer 11.6|4009544|29|CP022578|CRT matches to MN204502 (Mycobacterium phage KingMidas, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

692. spacer 11.6|4009544|29|CP022578|CRT matches to NC_022068 (Mycobacteriophage Daenerys, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

693. spacer 11.6|4009544|29|CP022578|CRT matches to MK310142 (Mycobacterium phage MetalQZJ, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

694. spacer 11.6|4009544|29|CP022578|CRT matches to KT895281 (Mycobacterium phage Cabrinians, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

695. spacer 11.6|4009544|29|CP022578|CRT matches to NC_031041 (Mycobacterium phage Papez, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

696. spacer 11.6|4009544|29|CP022578|CRT matches to MH513971 (Mycobacterium phage Hope4ever, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

697. spacer 11.6|4009544|29|CP022578|CRT matches to MH450130 (Mycobacterium phage Rohr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

698. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

699. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

700. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

701. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

702. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

703. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

704. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

705. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacgatcgtcgccggccccgccggt	Protospacer
. . ..********************

706. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

707. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aggatgtcgtcgccggccccgccgaa	Protospacer
. *. *******************.

708. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agatagtcgtcgccagccccgccggc	Protospacer
. . **********.**********.

709. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
cgatcgtcgtcgccggccgcgccggt	Protospacer
  .  ************* *******

710. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tgatcgtcggcgccggccccgccggt	Protospacer
  .  **** ****************

711. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tggcgatcgtcgccggccccgccggc	Protospacer
  * ..*******************.

712. spacer 11.10|4009853|26|CP022578|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tggcgatcgtcgccggccccgccggc	Protospacer
  * ..*******************.

713. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atggagtcgtcgcccgccccgccatc	Protospacer
..************ ********. .

714. spacer 11.12|4010003|29|CP022578|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
agccagttgggcccgccgataccgccggc	Protospacer
    ****** ******* **********

715. spacer 11.12|4010003|29|CP022578|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
agccagttgggcccgccgataccgccggc	Protospacer
    ****** ******* **********

716. spacer 11.12|4010003|29|CP022578|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ctgttgtcggccccgccgctgccgccggg	Protospacer
.**  **.************.*******

717. spacer 11.13|4010075|32|CP022578|CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 6, identity: 0.812

ttgccgg--ggtcgccggcgccggtgcctgcgtt	CRISPR spacer
--gccggctggtcgccgccgccggcgcctgcgcc	Protospacer
  *****  ******** ******.*******..

718. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgcccgcattgccgttgccggcgacag	Protospacer
. ******* *******************

719. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
atggccgccggcattgccgttgccgtcgtcaa	Protospacer
** ********************** **

720. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccgccattgccgttgccgccgccat	Protospacer
********** ************** **   .

721. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP018466 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

722. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattgccgtttccgttggcac	Protospacer
********************* *** .*.  *

723. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP020976 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

724. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP020965 (Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

725. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP018727 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

726. spacer 12.2|4029063|32|CP022578|CRT matches to NC_012853 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggaattgctgttgccgttgcccc	Protospacer
*********** *****.******* .*  **

727. spacer 12.4|4029189|32|CP022578|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

728. spacer 12.4|4029189|32|CP022578|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

729. spacer 12.4|4029189|32|CP022578|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

730. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

731. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

732. spacer 12.4|4029189|32|CP022578|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

733. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

734. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

735. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

736. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

737. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtcccgcccgtgccgccggcgccgccggtgc	Protospacer
* .****** ********* *********. *

738. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

739. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

740. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

741. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

742. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

743. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

744. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtcccgccggtgccgccgccgccgccgactg	Protospacer
* .****************.********.*.

745. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcaccgccggtgccgccggtgccgccgccgc	Protospacer
* * *************** .******* * *

746. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

747. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

748. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

749. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

750. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

751. spacer 12.4|4029189|32|CP022578|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

752. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

753. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

754. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

755. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

756. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

757. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

758. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

759. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

760. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

761. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

762. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

763. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

764. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

765. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

766. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

767. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

768. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

769. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

770. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

771. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

772. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

773. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

774. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

775. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtaccgcccgtgccaccgtcgccgccggcac	Protospacer
* . ***** *****.************** *

776. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcccgggccggtgccgcccgcgccgccggccc	Protospacer
 .**  ************  ************

777. spacer 12.4|4029189|32|CP022578|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

778. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

779. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

780. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

781. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

782. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

783. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

784. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

785. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

786. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

787. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

788. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

789. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

790. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

791. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

792. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

793. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

794. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

795. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

796. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

797. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

798. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

799. spacer 12.4|4029189|32|CP022578|CRT matches to NC_031109 (Gordonia phage Jumbo, complete genome) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgctgccggtgccgccgccgccgccggtct	Protospacer
* * *.*************.*********.*.

800. spacer 12.4|4029189|32|CP022578|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtggccgccggtgcggtcgtcgccgccgccgc	Protospacer
**  ********** *.*********** * *

801. spacer 12.4|4029189|32|CP022578|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgccgccggagccgccgccgccgccgccgc	Protospacer
*.* ******* *******.******** * *

802. spacer 13.6|4030672|28|CP022578|CRT matches to LN997844 (Streptomyces reticuli genome assembly TUE45, plasmid : III) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tcgacggtgatggtcgttccctgtgcgt	Protospacer
   *********** ** *********.

803. spacer 13.6|4030672|28|CP022578|CRT matches to DQ115854 (Cyanobacteria phage AS-1 contig_47 genomic sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
gcctcggtgatggtggtgcccggtggca	Protospacer
* * ***************** ***

804. spacer 13.6|4030672|28|CP022578|CRT matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
ggcaacgtgatggtggtgccctggggct	Protospacer
****  ***************** *  .

805. spacer 13.6|4030672|28|CP022578|CRT matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tgcacggtgaaggtggtgcccttcgggt	Protospacer
 ********* *********** .* *.

806. spacer 14.1|4159156|27|CP022578|CRT matches to NC_048759 (Serratia phage MTx, partial genome) position: , mismatch: 6, identity: 0.778

cttagcaagccgccattcccgccgttg	CRISPR spacer
gacagcaagccgccattctcggcgttt	Protospacer
  .***************.** ****

807. spacer 14.6|4159450|27|CP022578|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

acgccaccggtttggtttccgccggcg	CRISPR spacer
ccgccagcggttcggtttccgccgcga	Protospacer
 ***** *****.***********  .

808. spacer 14.11|4159720|27|CP022578|CRT matches to MG872843 (Mycobacterium phage Sotrice96, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

809. spacer 14.11|4159720|27|CP022578|CRT matches to MT723943 (Mycobacterium phage Cactus, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

810. spacer 14.11|4159720|27|CP022578|CRT matches to MT114165 (Mycobacterium phage BadStone, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

811. spacer 14.11|4159720|27|CP022578|CRT matches to KF493883 (Mycobacterium phage Mosby, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

812. spacer 14.11|4159720|27|CP022578|CRT matches to MF919529 (Mycobacterium phage Sassay, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

813. spacer 14.11|4159720|27|CP022578|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

814. spacer 14.11|4159720|27|CP022578|CRT matches to KU865303 (Mycobacterium phage TeardropMSU, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

815. spacer 14.11|4159720|27|CP022578|CRT matches to KR080204 (Mycobacterium phage Mindy, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

816. spacer 14.11|4159720|27|CP022578|CRT matches to NC_029079 (Mycobacterium phage Dusk, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

817. spacer 14.11|4159720|27|CP022578|CRT matches to NC_022065 (Mycobacterium phage Contagion, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

818. spacer 14.11|4159720|27|CP022578|CRT matches to KX817173 (Mycobacterium phage Tuco, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

819. spacer 14.11|4159720|27|CP022578|CRT matches to MT684595 (Mycobacterium phage Mova, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

820. spacer 14.11|4159720|27|CP022578|CRT matches to KF188414 (Mycobacterium phage ABCat, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

821. spacer 14.11|4159720|27|CP022578|CRT matches to MF919540 (Mycobacterium phage Willez, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

822. spacer 14.11|4159720|27|CP022578|CRT matches to MN234212 (Mycobacterium phage Paphu, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

823. spacer 14.11|4159720|27|CP022578|CRT matches to MK061415 (Mycobacterium phage Rhynn, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

824. spacer 14.11|4159720|27|CP022578|CRT matches to MK524531 (Mycobacterium phage Rutherferd, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

825. spacer 14.11|4159720|27|CP022578|CRT matches to MN617845 (Mycobacterium phage BaconJack, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

826. spacer 14.13|4159831|27|CP022578|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

827. spacer 14.13|4159831|27|CP022578|CRT matches to NC_002699 (Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccgactggaacg	Protospacer
********************..*.

828. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagccgg	Protospacer
 ******** ************* ..

829. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
agcacgccgccctcgccgaccaggtag	Protospacer
   .******* **************

830. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

831. spacer 14.13|4159831|27|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

832. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagccgg	Protospacer
 ******** ************* ..

833. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

834. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacga	Protospacer
 ******** *************...

835. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

836. spacer 14.13|4159831|27|CP022578|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

837. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

838. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgtcgccggcatcgccgaccagcccg	Protospacer
*** ***** ************* .

839. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgtcaccgccgaccaggcca	Protospacer
 ********.**.***********.

840. spacer 14.13|4159831|27|CP022578|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccggccccattt	Protospacer
******************.**  .* .

841. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP013069 (Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcggcggccaggccg	Protospacer
.************** **.*****.

842. spacer 14.13|4159831|27|CP022578|CRT matches to NC_016115 (Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
acggcatcgccatcgccgaccagggcg	Protospacer
 ****..*****************

843. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcctggagg	Protospacer
.*****************.** ** .

844. spacer 14.13|4159831|27|CP022578|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
aggccgccgccatcggcgaccaggtga	Protospacer
  * *********** *********.

845. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP015040 (Rhodovulum sp. P5 plasmid pRGUI01, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcatcgccgccatcgccgaccgggtcg	Protospacer
 *. *****************.***

846. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcctggacg	Protospacer
.*****************.** **

847. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP042268 (Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcatcgccgccatcgccgacgaggtct	Protospacer
 *. **************** **** .

848. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP045074 (Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atttcgccgccatcgccgatcaggcac	Protospacer
 .  ***************.****.**

849. spacer 14.13|4159831|27|CP022578|CRT matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgcctaccagcagg	Protospacer
** ************** *****  .

850. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atggcgccgccatcgtcaaccaggtgg	Protospacer
 .*************.*.*******.

851. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccacagccgaccagcagg	Protospacer
************. *********  .

852. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcgaggagg	Protospacer
.*****************.* *** .

853. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccgagcatgagg	Protospacer
.****************** ** * .

854. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccgcccttgcct	Protospacer
****************** **  *. .

855. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgccttcgccgacgaggaca	Protospacer
 ********** ******** ***

856. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP016080 (Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgctctcgccgaccagcgcg	Protospacer
**********. ***********

857. spacer 14.13|4159831|27|CP022578|CRT matches to NC_022739 (Pseudomonas sp. VLB120 plasmid pSTY, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atggcgccgccatcgtcaaccaggtgg	Protospacer
 .*************.*.*******.

858. spacer 14.18|4160212|36|CP022578|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 6, identity: 0.833

tacagc-cacccgccgttgccgccgaggccgccggcg	CRISPR spacer
-acaccgcacccgccgttgccgccgctgccgccctcg	Protospacer
 *** * ******************  ******  **

859. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

860. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

861. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

862. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

863. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

864. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

865. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

866. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

867. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

868. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

869. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

870. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

871. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

872. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

873. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to NC_031243 (Mycobacterium phage Xeno, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

874. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

875. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to MF417927 (Uncultured Caudovirales phage clone 9F_2, partial genome) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
aaaggcgccttcgatgccggcaacaccgac	Protospacer
.*.. **** *.*****************.

876. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccattgccgtcgatgccggcaataccgag	Protospacer
*  *..*****.***********.*****

877. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagatgccgtcgatgccggcaacgccgag	Protospacer
**.. .*****.************.****

878. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to JX469830 (Uncultured bacterium plasmid pG527, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

879. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to JX469833 (Uncultured bacterium plasmid pWEC911, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

880. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NC_008357 (Pseudomonas aeruginosa plasmid pBS228, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

881. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to CP002151 (Uncultured bacterium plasmid PB5, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

882. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to CP002152 (Uncultured bacterium plasmid PB11, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

883. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to CP002153 (Uncultured bacterium plasmid PSP21, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

884. spacer 9.4|3214531|36|CP022578|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 7, identity: 0.806

ccacggcgccgctggcggtgtcccggccggcgtcgg	CRISPR spacer
tcctggccccgctggcggtgacccggccggcgatgg	Protospacer
.* .*** ************ *********** .**

885. spacer 9.11|3215011|27|CP022578|CRT matches to NZ_AP018520 (Sphingobium sp. YG1 plasmid pYGP1, complete sequence) position: , mismatch: 7, identity: 0.741

gaacggcggcttgctcttcggctccgc	CRISPR spacer
tctcggcggcttgctcttcggcctgga	Protospacer
   *******************.. *

886. spacer 11.6|4009544|29|CP022578|CRT matches to MN585973 (Mycobacterium phage StAnnes, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

887. spacer 11.6|4009544|29|CP022578|CRT matches to MG944221 (Mycobacterium phage Scowl, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

888. spacer 11.6|4009544|29|CP022578|CRT matches to KT309034 (Mycobacterium phage Dante, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

889. spacer 11.6|4009544|29|CP022578|CRT matches to NC_048850 (Mycobacterium phage Cornie, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

890. spacer 11.6|4009544|29|CP022578|CRT matches to NC_021538 (Mycobacterium phage Job42, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

891. spacer 11.6|4009544|29|CP022578|CRT matches to NC_026584 (Mycobacterium phage Minerva, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

892. spacer 11.6|4009544|29|CP022578|CRT matches to KJ409696 (Mycobacterium phage Lamina13, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

893. spacer 11.6|4009544|29|CP022578|CRT matches to NC_028784 (Mycobacterium phage Tasp14, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

894. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct-----	CRISPR spacer
ttgccgccgttgccgccgttgc-----ctcccgc	Protospacer
 ************.********     **

895. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgccggg	Protospacer
 ************.********.*  *

896. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgcccgt	Protospacer
 ************.********.*    *

897. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

898. spacer 11.6|4009544|29|CP022578|CRT matches to NC_014819 (Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gggccgccgtcgctgcccttgctgacaac	Protospacer
* ********.****** ******* . .

899. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
aagtgtccgttgctgccgcggctgaagct	Protospacer
. *.  ************. *********

900. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_LT703506 (Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tggttgccgatgccgccgttgctgaagcg	Protospacer
  *..**** ***.**************

901. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP025615 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgctgccaatgctcagcgc	Protospacer
*****************. **** *.  .

902. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

903. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

904. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgctgccgttgctgccgttgccgtattc	Protospacer
 ***.*****************.* * ..

905. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

906. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP040096 (Pantoea sp. SO10 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
atgccgccgttgctgacgttggtgtcgta	Protospacer
.************** ***** **  *.

907. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

908. spacer 11.6|4009544|29|CP022578|CRT matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgatgctgccgttgctgaaagc	Protospacer
*  ****.* ****************. .

909. spacer 11.6|4009544|29|CP022578|CRT matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

910. spacer 11.6|4009544|29|CP022578|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

911. spacer 11.6|4009544|29|CP022578|CRT matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

912. spacer 11.6|4009544|29|CP022578|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

913. spacer 11.6|4009544|29|CP022578|CRT matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

914. spacer 11.6|4009544|29|CP022578|CRT matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

915. spacer 11.6|4009544|29|CP022578|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggc	Protospacer
 ************.********.*  * .

916. spacer 11.6|4009544|29|CP022578|CRT matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

917. spacer 11.6|4009544|29|CP022578|CRT matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

918. spacer 11.6|4009544|29|CP022578|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

919. spacer 11.6|4009544|29|CP022578|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggc	Protospacer
 ************.********.*  * .

920. spacer 11.6|4009544|29|CP022578|CRT matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

921. spacer 11.6|4009544|29|CP022578|CRT matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

922. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

923. spacer 11.10|4009853|26|CP022578|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atccggtcgtcgccggccccgccgcg	Protospacer
..  .*******************

924. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

925. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

926. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

927. spacer 11.10|4009853|26|CP022578|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aacagatcgtcgccggccccgccgga	Protospacer
.  ...*******************

928. spacer 11.12|4010003|29|CP022578|CRT matches to NZ_CP047220 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
cccatttttgccacgccgctaccgccggc	Protospacer
.. *  ** *** ****************

929. spacer 11.12|4010003|29|CP022578|CRT matches to MK510999 (Pseudomonas phage BR58, partial genome) position: , mismatch: 7, identity: 0.759

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ccggccttggaaccgccgctaccgccggc	Protospacer
..*.  ****  *****************

930. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

931. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgtcggcgccggtgcggccgct	Protospacer
. **********.************   **.*

932. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

933. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP051543 (Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccggctcgggtgcctcccct	Protospacer
. *************** * ******* * .*

934. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

935. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

936. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

937. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

938. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

939. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

940. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattgccgtcgccgcgtggct	Protospacer
********************.****   ..*.

941. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

942. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

943. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccg---gcgaacc	CRISPR spacer
attgccgctggcattgccgttaccgtttccgg---	Protospacer
********.************.***    **.

944. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

945. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccg---gcgaacc	CRISPR spacer
attgccgctggcattgccgttaccgtttccgg---	Protospacer
********.************.***    **.

946. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

947. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgtttccgtt---cccag	Protospacer
********.************ *** .   **

948. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccgttgccgttcccgc	Protospacer
*** ********************* .    *

949. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgaccgcattgccgttgccggcgacag	Protospacer
. ***** * *******************

950. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgaccgcattgccgttgccggcgacag	Protospacer
. ***** * *******************

951. spacer 12.2|4029063|32|CP022578|CRT matches to NC_012853 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggaattgccgttgcccccgctat	Protospacer
*********** ************  **   .

952. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcatcgccgtggccgcctggct	Protospacer
**************.***** **** * ..*.

953. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

954. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP019063 (Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccggcggcattgcctttgccaacccgcc	Protospacer
******* ********** *****..*  .**

955. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

956. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

957. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

958. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

959. spacer 12.4|4029189|32|CP022578|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

960. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

961. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

962. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

963. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

964. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccgttgccgccgttgc	Protospacer
**. ****** *********.******* . *

965. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccgttgccgcccgttc	Protospacer
**. ****** *********.****** *..*

966. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

967. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

968. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

969. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

970. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

971. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

972. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

973. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

974. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

975. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

976. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcaccgccggtgccgccatcaccgccgccgc	Protospacer
. * **************.**.****** * *

977. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

978. spacer 12.4|4029189|32|CP022578|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

979. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

980. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

981. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

982. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

983. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtacctgccggtgccgccgtcgccgcccagga	Protospacer
** **.********************* .

984. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

985. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

986. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

987. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

988. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

989. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

990. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

991. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

992. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

993. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

994. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

995. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

996. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

997. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

998. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

999. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1000. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1001. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1002. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1003. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggtcgtcggtgccgccgtcgccgccggtca	Protospacer
*   .**.*********************.*

1004. spacer 12.4|4029189|32|CP022578|CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcctgggccggtgccgcccgcgccgccggccc	Protospacer
 .*.  ************  ************

1005. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtcctcgccggtgcggccgtcgccgcgcgtgg	Protospacer
****.********* ***********  *.

1006. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccaccggtaccgccgtcgccgccgggtc	Protospacer
* . **.*****.**************** .*

1007. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaccccgccggtgccgccgccaccgccgattg	Protospacer
* *****************.*.******...

1008. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccatcgccgccgtcgt	Protospacer
**. ****** *******.********* * .

1009. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcacggccgggaccgccgtcgccgccggcag	Protospacer
* * * ***** .*****************

1010. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgtcgtcgccgccggcct	Protospacer
 .*  ********.**.**************.

1011. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgccgccgtcgcagccggtct	Protospacer
 .*  ****************** *****.*.

1012. spacer 12.4|4029189|32|CP022578|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgccgtcgcagccggcct	Protospacer
 .*  ********.********* *******.

1013. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggtcgccggtgccgccgccgcggccggccg	Protospacer
*   .**************.*** *******

1014. spacer 12.4|4029189|32|CP022578|CRT matches to NC_011879 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gagttcgacggtgccgccgacgccgccggcct	Protospacer
*  ..** *********** ***********.

1015. spacer 12.4|4029189|32|CP022578|CRT matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcctgggccggtgccgcccgcgccgccggccc	Protospacer
 .*.  ************  ************

1016. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gatcccgccggtgccgccggccccgccaccgc	Protospacer
* .**************** * *****. * *

1017. spacer 12.4|4029189|32|CP022578|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccctgcgccggtgccgcagtcgccgcccgccg	Protospacer
 .*. ************ ********* ***

1018. spacer 12.4|4029189|32|CP022578|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggcat	Protospacer
*.. ****** *********.********* .

1019. spacer 12.4|4029189|32|CP022578|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggcat	Protospacer
*.. ****** *********.********* .

1020. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1021. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggatcggccggggccgccgtcgccgcccgcct	Protospacer
*  .* ***** *************** ***.

1022. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cccgccgccgctgccgccgtagccgccgccac	Protospacer
 .* ****** ********* ******* * *

1023. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1024. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP014276 (Martelella sp. AD-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgccgccgctgccgccgccgccgccgatcg	Protospacer
* * ****** ********.********..*

1025. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaccccgcccgtgccaccgtcgccgcccgggt	Protospacer
* ******* *****.*********** *  .

1026. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtgccgacgacgccgccggcgc	Protospacer
. *  *********** ** ********** *

1027. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccgcaggtgccgccgtcgccgaccctgc	Protospacer
* ****** **************** *  . *

1028. spacer 12.4|4029189|32|CP022578|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1029. spacer 12.4|4029189|32|CP022578|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1030. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccgcaggtgccgccgtcgccgaccctgc	Protospacer
* ****** **************** *  . *

1031. spacer 12.4|4029189|32|CP022578|CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccgccgccggcgccgccggcgccgccggatc	Protospacer
 .* *******.******* ********* .*

1032. spacer 12.4|4029189|32|CP022578|CRT matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgccggtgccgccggtgccgccggtgc	Protospacer
* . *************** .********. *

1033. spacer 12.4|4029189|32|CP022578|CRT matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgccggtgccgccggcgccgcccggtg	Protospacer
*.**.************** ******* * .

1034. spacer 12.4|4029189|32|CP022578|CRT matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cacgccgccgttgccgccggcgccgccgccac	Protospacer
  * ****** ******** ******** * *

1035. spacer 12.4|4029189|32|CP022578|CRT matches to NC_028791 (Mycobacterium phage MOOREtheMARYer, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgccggtgccgccggcgccgcctggtg	Protospacer
*.**.************** ******* * .

1036. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP023779 (Nocardia terpenica strain NC_YFY_NT001 plasmid p_NC_YFY_NT001, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgcc--gccggccc	CRISPR spacer
gtccccggcggtcccgccgtcgcccgggtggt--	Protospacer
******* **** ***********  * .**.

1037. spacer 12.4|4029189|32|CP022578|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cttgccgccggcgccgccctcgccgccgaacc	Protospacer
 *. *******.****** *********. **

1038. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcggcgccgatgccgccggcgccgccggtca	Protospacer
* *  *****.******** *********.*

1039. spacer 12.4|4029189|32|CP022578|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctcggcgcgggggccgccgtcgccgccgtcgc	Protospacer
 **  *** ** **************** * *

1040. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccatcgccgccgtcgt	Protospacer
**. ****** *******.********* * .

1041. spacer 12.4|4029189|32|CP022578|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgttgccggtgccgccgtcggctccggcgc	Protospacer
*.* ..**************** * ***** *

1042. spacer 12.6|4029297|32|CP022578|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
atcgccaccagccgcgccagcggaatccgcgc	Protospacer
*******************.* **..* .* *

1043. spacer 13.6|4030672|28|CP022578|CRT matches to NC_022050 (Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence) position: , mismatch: 7, identity: 0.75

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
atcacggtgatgcgggtgccctgtggca	Protospacer
. **********  ***********

1044. spacer 14.4|4159339|33|CP022578|CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcgatgttggccccgccggccccgccgttg-	CRISPR spacer
tcggcgatggtggccccgcc-gtcccgtagctgg	Protospacer
.******** ********** *.****. *.**

1045. spacer 14.9|4159615|27|CP022578|CRT matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 7, identity: 0.741

tacagccacgctccagagccgccggct	CRISPR spacer
agccgccacgctccagagccgcctcgc	Protospacer
 .* *******************   .

1046. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgaccgcaccg	Protospacer
*** *****************. ..

1047. spacer 14.13|4159831|27|CP022578|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ttggcgccggcatcgccgaccagccgg	Protospacer
..******* ************* ..

1048. spacer 14.13|4159831|27|CP022578|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcgacgccgccatcgccgaccatcgcg	Protospacer
.**.******************

1049. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccggcgccgatgatgccggcaacgccgcc	Protospacer
*  . ***** *************.*** .

1050. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccggcgccgatgatgccggcaacgccgcc	Protospacer
*  . ***** *************.*** .

1051. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1052. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gctcacgccgttgatgccgacaacatcgcg	Protospacer
*    **************.*****.**

1053. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1054. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1055. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
ggcggcgccgttgatgccgaccacaccgga	Protospacer
*. . **************.* ******.

1056. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1057. spacer 8.2|3186729|30|CP022578|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1058. spacer 9.4|3214531|36|CP022578|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.778

ccacg-gcgccgctggcggtgtcccggccggcgtcgg	CRISPR spacer
-cgcgctcgccgggggcggtgtcccggccggcggcat	Protospacer
 *.**  *****  ******************* *.

1059. spacer 11.1|4009127|29|CP022578|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.724

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggtggctgccccgccgtcggtctcgct	Protospacer
 ************* *******. .*...

1060. spacer 11.1|4009127|29|CP022578|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggtggctgccccgccgtcggtctcgct	Protospacer
 ************* *******. .*...

1061. spacer 11.6|4009544|29|CP022578|CRT matches to NZ_CP048923 (Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttactgccgatgctgctttg	Protospacer
 **********.****** *****   .

1062. spacer 11.6|4009544|29|CP022578|CRT matches to MK937593 (Mycobacterium phage Flypotenuse, complete genome) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccaccgga	Protospacer
 ************.********..  *

1063. spacer 11.6|4009544|29|CP022578|CRT matches to MH536820 (Mycobacterium phage Glexan, complete genome) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccaccgga	Protospacer
 ************.********..  *

1064. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgccgtcgccggtgcttcgctc	Protospacer
. ************* *********.*   *.

1065. spacer 11.13|4010075|32|CP022578|CRT matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatctctc	Protospacer
. ************* ********* * . *.

1066. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgccgtcgccggtgcttcgctc	Protospacer
. ************* *********.*   *.

1067. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgtcggggtagccggcgccggtgaggtagtt	Protospacer
 **.****** *************     ***

1068. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tcaccgcggtcggcggcgccggtgccgggttg	Protospacer
*..*** ***** ************* *  *

1069. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP046571 (Xanthomonas albilineans strain Xa-FJ1 plasmid pXaFJ1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtcgctcgctcgccggcgccggcgccggcgtt	Protospacer
 *  *  * *************.*** *****

1070. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tcaccgcggtcggcggcgccggtgccgggttg	Protospacer
*..*** ***** ************* *  *

1071. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccggcagtgccgtggccgcggacat	Protospacer
 ************ ****** ****  **  .

1072. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccgttgccattcccgc	Protospacer
*** ********************. .    *

1073. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccgttcccgc	Protospacer
.** ********************* .    *

1074. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccgttcccgc	Protospacer
.** ********************* .    *

1075. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcgttgccgttgccgttcccac	Protospacer
*** ********.************ .    *

1076. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcgttgccgttgccgttcccgc	Protospacer
*** ********.************ .    *

1077. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccattgccgttcccgc	Protospacer
*** **************.****** .    *

1078. spacer 12.2|4029063|32|CP022578|CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gctgccgccggcattcccgctgccggcggggg	Protospacer
..************* ***.********..

1079. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1080. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1081. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1082. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1083. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1084. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1085. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1086. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1087. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1088. spacer 12.2|4029063|32|CP022578|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1089. spacer 12.2|4029063|32|CP022578|CRT matches to JN699011 (Mycobacterium phage Stinger, complete genome) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgacattgccgctgccggtgttgt	Protospacer
.*********.********.******.*   .

1090. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_KM406416 (Bifidobacterium breve strain JCM 7017 plasmid megaplasmid pMP7017, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccggtgttgccgttgccgtggtagt	Protospacer
.**********..************  * * .

1091. spacer 12.2|4029063|32|CP022578|CRT matches to NC_019018 (Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1092. spacer 12.2|4029063|32|CP022578|CRT matches to NC_011355 (Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1093. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtagtcgtcgacattgccgttgccggcgcgcg	Protospacer
.* *.**.**.***************** .*

1094. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttggccgccggcattgctgatgccggccacga	Protospacer
 * **************.* ******* *

1095. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1096. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattactgttgctgcagcgcg	Protospacer
***************.*.*****.*  * .*

1097. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc-----	CRISPR spacer
gttgccgccgccattgccattgcc-----acctttgg	Protospacer
.********* *******.*****     ***

1098. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcctccggtgccgccgccgccgccgatcg	Protospacer
  * ** ************.********..*

1099. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccggtgccgccgtctccgccgttgc	Protospacer
    ***************** ****** . *

1100. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attgccgccgttgccgccgttgccgccggggt	Protospacer
.*. ****** *********.********  .

1101. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccctccgccggcgccgccgtcgccgcccttgc	Protospacer
 .*.*******.***************  . *

1102. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgcccgcgccgccgtcgccgccgcggc	Protospacer
* . ***** *.****************   *

1103. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtaccgccgttgccgccgtcgcctccgtcac	Protospacer
  . ****** ************* *** * *

1104. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcaccgccgttgccgccggcgccgccgatcg	Protospacer
  * ****** ******** ********..*

1105. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggctgcgccggtgccgcccgcgccgccgatac	Protospacer
* *. *************  ********.. *

1106. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtagacgccggtaccgccgtcggcgccgcgca	Protospacer
**   *******.********* *****  *

1107. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgacgccgccgtcgccgcccgttc	Protospacer
*   ******..*************** *..*

1108. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcgtccgccggcgccgccggcgccgcccgttc	Protospacer
*. .*******.******* ******* *..*

1109. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccgccattgccgccgccgc	Protospacer
  . **************.*.******* * *

1110. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgcttccccggtgccgccgtcgcggcccgcgc	Protospacer
  *..* **************** *** ** *

1111. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtaccgccggtgccgcccccgccgccgaagc	Protospacer
* . ************** .********.  *

1112. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgacccgccggtgccgccgacgccacccgtgc	Protospacer
   **************** ****.** *. *

1113. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gacgccggcgatgccgccgtcgccgcctccgg	Protospacer
* * *** **.****************  *

1114. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctcgccgccgctgccgccgtcgccctggcgcc	Protospacer
 ** ****** ************* . *  **

1115. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cccgccgccgctgccgccgtccccgccgctgc	Protospacer
 .* ****** ********** ****** . *

1116. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgttgccgccgccgccgcctaccg	Protospacer
*   ****** ********.******* .**

1117. spacer 12.4|4029189|32|CP022578|CRT matches to MF141540 (Mycobacterium phage Avocado, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgcccgccggtgccgccggcgccgcgggtga	Protospacer
 . **************** ****** **.

1118. spacer 12.4|4029189|32|CP022578|CRT matches to KR080198 (Mycobacterium phage Cambiare, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgcccgccggtgccgccggcgccgcgggtga	Protospacer
 . **************** ****** **.

1119. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgcggccgatgccgccgccgccgccggtga	Protospacer
* * * ****.********.*********.

1120. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgccacgccggtgccgccggcgccgcctccag	Protospacer
  ** ************** *******  *

1121. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgccgtcgcggccggact	Protospacer
 .*  ********.********* ***** *.

1122. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccccaggtgccgccgtcgccgaccctgc	Protospacer
* **** * **************** *  . *

1123. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctgcaccgcggcgccgccgacgccgccggccg	Protospacer
 * * *  ***.******* ***********

1124. spacer 12.4|4029189|32|CP022578|CRT matches to NC_020275 (Mycobacterium intracellulare subsp. yongonense 05-1390 plasmid pMyong1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcccgcgccggtgccgacgtcgccgcgctgct	Protospacer
*.** *********** *********    *.

1125. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgc	Protospacer
    ***** *********.******** * *

1126. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ttccccgccggtgcggccgccgccggccacgg	Protospacer
 ************* ****.***** * .*

1127. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgc	Protospacer
    ***** *********.******** * *

1128. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggtgcgccggtgccgccgccgccgccgcgcc	Protospacer
   . **************.********  **

1129. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cttgccgccgtcgccgccgtcgccgcccgtgc	Protospacer
 *. ****** .*************** *. *

1130. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgatgccggtgtcggcgtcgccgccgggcg	Protospacer
*.*  .*******.** ************ *

1131. spacer 12.4|4029189|32|CP022578|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggacacgccggtggtgccgtcgccgccgaagc	Protospacer
*  * ******** .*************.  *

1132. spacer 12.4|4029189|32|CP022578|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1133. spacer 12.4|4029189|32|CP022578|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1134. spacer 12.4|4029189|32|CP022578|CRT matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1135. spacer 12.4|4029189|32|CP022578|CRT matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1136. spacer 12.4|4029189|32|CP022578|CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1137. spacer 12.4|4029189|32|CP022578|CRT matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1138. spacer 12.4|4029189|32|CP022578|CRT matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1139. spacer 12.4|4029189|32|CP022578|CRT matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1140. spacer 12.4|4029189|32|CP022578|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1141. spacer 12.4|4029189|32|CP022578|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1142. spacer 12.4|4029189|32|CP022578|CRT matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1143. spacer 12.4|4029189|32|CP022578|CRT matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1144. spacer 12.4|4029189|32|CP022578|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1145. spacer 12.4|4029189|32|CP022578|CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1146. spacer 12.4|4029189|32|CP022578|CRT matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1147. spacer 12.4|4029189|32|CP022578|CRT matches to MH338241 (Mycobacterium phage Tarynearal, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aacgtcgccgttgccgccgtcgccgccgcgac	Protospacer
. * .***** *****************   *

1148. spacer 12.4|4029189|32|CP022578|CRT matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1149. spacer 12.4|4029189|32|CP022578|CRT matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1150. spacer 12.4|4029189|32|CP022578|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1151. spacer 12.4|4029189|32|CP022578|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1152. spacer 12.4|4029189|32|CP022578|CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1153. spacer 12.4|4029189|32|CP022578|CRT matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1154. spacer 12.4|4029189|32|CP022578|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1155. spacer 12.4|4029189|32|CP022578|CRT matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1156. spacer 12.4|4029189|32|CP022578|CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1157. spacer 12.4|4029189|32|CP022578|CRT matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1158. spacer 12.4|4029189|32|CP022578|CRT matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1159. spacer 12.4|4029189|32|CP022578|CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1160. spacer 12.4|4029189|32|CP022578|CRT matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1161. spacer 12.4|4029189|32|CP022578|CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1162. spacer 12.4|4029189|32|CP022578|CRT matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1163. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP018471 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccggcgtcgccaccgccac	Protospacer
  . ************ *******.*** * *

1164. spacer 12.4|4029189|32|CP022578|CRT matches to NC_008712 (Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgaggccggtgacgccggcgccgccggcac	Protospacer
  *   ******* ***** ********** *

1165. spacer 12.4|4029189|32|CP022578|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgatgccgccgccgccgccgttca	Protospacer
*   ******.********.******** .*

1166. spacer 12.4|4029189|32|CP022578|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcggcgccggtgccgctgtcggcgccgctca	Protospacer
* *  ************.**** ***** .*

1167. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgttgccgccgttgccgccgctcg	Protospacer
*   ****** *********.******* .*

1168. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccaacgccggtggcgccttcgccgccgacgt	Protospacer
*.*  ******** **** *********.* .

1169. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgcggccgatgccgctgtcgccgccggtga	Protospacer
* * * ****.******.***********.

1170. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gactgtgctggtgccgccgtcgcagccggcga	Protospacer
* *. .**.************** ******

1171. spacer 12.4|4029189|32|CP022578|CRT matches to NC_008539 (Arthrobacter sp. FB24 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctggcggccgcggccgccgtcgccgccggctt	Protospacer
 *  * ****  ******************..

1172. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctggccgccggttccgccttcgccgccgccat	Protospacer
 *  ******** ***** ********* * .

1173. spacer 12.4|4029189|32|CP022578|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgggtgcgatgccgccgttgccgccggccc	Protospacer
*.*     **.*********.***********

1174. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP046330 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgacgcaccggtgccggcgccgccgccggcca	Protospacer
   * *.********* **.***********

1175. spacer 12.4|4029189|32|CP022578|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgtcggcggtgccgccgttgccgccggtgg	Protospacer
**. .** ************.********.

1176. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
caccccgccggtgccgccggtgccgc--gcttga	Protospacer
  ***************** .*****  **..

1177. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccgcgccggcgccgccgtcgccgctcgacg	Protospacer
..** ******.**************. * *

1178. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attggcgccggcgacgccgtcgccgccggttc	Protospacer
.*.  ******.* ***************..*

1179. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtggtggccggtgccgccgcggccgccggaca	Protospacer
**  . *************. ******** *

1180. spacer 12.4|4029189|32|CP022578|CRT matches to NC_008766 (Acidovorax sp. JS42 plasmid pAOVO02, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccggcgtcgccaccgccac	Protospacer
  . ************ *******.*** * *

1181. spacer 12.4|4029189|32|CP022578|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gacgacgccggtgccgccgacgccgacgatca	Protospacer
* *  ************** ***** **..*

1182. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP023550 (Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atcgccgccgttgccgccgtcgccgtcaccgt	Protospacer
.** ****** **************.*. * .

1183. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgccggagccgccgccgccgccgccgc	Protospacer
    ******* *******.******** * *

1184. spacer 12.4|4029189|32|CP022578|CRT matches to NC_006525 (Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgacgcaccggtgccggcgccgccgccggcca	Protospacer
   * *.********* **.***********

1185. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgctccgccggtgccgctgttgccgccgtcat	Protospacer
  *.*************.**.******* * .

1186. spacer 12.4|4029189|32|CP022578|CRT matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
accgccgccggtgccgccggtgccgccgcgct	Protospacer
..* *************** .*******  *.

1187. spacer 12.4|4029189|32|CP022578|CRT matches to MH669003 (Mycobacterium phage Girr, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagc	Protospacer
 *.  **.****************** **  *

1188. spacer 12.4|4029189|32|CP022578|CRT matches to MK016504 (Mycobacterium phage Whouxphf, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagc	Protospacer
 *.  **.****************** **  *

1189. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP021406 (Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1190. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
gtggatcgcggtgccgccgaagacggcgaacc	Protospacer
.* * ..**************. ******* *

1191. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP010872 (Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6003, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1192. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP040823 (Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1193. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP040823 (Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1194. spacer 12.6|4029297|32|CP022578|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 8, identity: 0.75

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
atggccacccgccgcgccaaccggatcgtcgg	Protospacer
** ****** *************...** *

1195. spacer 13.6|4030672|28|CP022578|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.714

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tctccggtgatgggggtgccctgtggaa	Protospacer
  . ********* *********** .

1196. spacer 14.4|4159339|33|CP022578|CRT matches to MN234213 (Gordonia phage Schiebs, complete genome) position: , mismatch: 8, identity: 0.758

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
agggaccagtcggccccgccggccccgccggtg	Protospacer
  **    **.******************* **

1197. spacer 14.4|4159339|33|CP022578|CRT matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
tcggcgatggtggcgccgccggcccggagttgg	Protospacer
.******** **** ********** *   * *

1198. spacer 14.5|4159393|36|CP022578|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 8, identity: 0.778

tacagctgaccaccggccccgccggcgcc--gccgttc	CRISPR spacer
gggagctgaccacgagccccgccggcgccaagcagt--	Protospacer
 . ********** .**************  ** **

1199. spacer 14.5|4159393|36|CP022578|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.778

tacagctgaccaccggccccgccggcgcc--gccgttc	CRISPR spacer
gggagctgaccaccagcccggccggcgccaagcagt--	Protospacer
 . ***********.**** *********  ** **

1200. spacer 14.18|4160212|36|CP022578|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 8, identity: 0.778

-tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
cggtagtcg-ccgccgtggccgccgtggccgccggcg	Protospacer
  ..**.*. ******* ******* ***********

1201. spacer 14.18|4160212|36|CP022578|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 8, identity: 0.778

-tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccgcacccg-tcgtcgtggccgccgaggccgccggcg	Protospacer
 ..** **. .**.*** *******************

1202. spacer 14.18|4160212|36|CP022578|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.778

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
tgccgctcaccgccgaagccgccgaggccgccggca	Protospacer
*.* **.  ******  ******************.

1203. spacer 3.7|1499938|30|CP022578|CRT matches to NZ_CP022197 (Celeribacter ethanolicus strain TSPH2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
cggagcgggttgttcgtcggcgtggagcga	Protospacer
 . .*********** *********.  *

1204. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to NZ_CP014964 (Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
tccaccaacatttcggcttgccgttcgttcc	Protospacer
    *****. ****************. *.

1205. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
cgcctcagcggttcggcttaccgttcgctta	Protospacer
 * ..**.***********.******** .

1206. spacer 5.1|2856753|31|CP022578|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
cgcctcagcggttcggcttaccgttcgctta	Protospacer
 * ..**.***********.******** .

1207. spacer 11.13|4010075|32|CP022578|CRT matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
acatggtcgtcgccggcgccagtgccagcgtt	Protospacer
 ... *  ************.***** *****

1208. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1209. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggttgccgtcgccggtgcttcgctc	Protospacer
. ********.**** *********.*   *.

1210. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1211. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tgccccgggtcgccggcgccgatgccgatgac	Protospacer
*  ** ***************.**** ..* .

1212. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gcgccggggtcgtcggcgccgttgcgcgccac	Protospacer
 .**********.******** *** .**  .

1213. spacer 11.13|4010075|32|CP022578|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gggccggggtcggcggcgccgatgcaggagag	Protospacer
  ********** ********.***  * *

1214. spacer 11.13|4010075|32|CP022578|CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggagtcgccgtcgccggtgcatcgctc	Protospacer
. *****.******* ********* *   *.

1215. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ctgtcggggtcgccgccgccggtgatgtccgt	Protospacer
.**.*********** ******** .  *  *

1216. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ttgccggtgacgccggcgccggtccggaggcg	Protospacer
******* * ************* *  . *.

1217. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgcgggtgcatcactg	Protospacer
. ************* *** ***** *   *

1218. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1219. spacer 11.13|4010075|32|CP022578|CRT matches to MH632120 (Mycobacterium phage Thonko, complete genome) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgtgccactcggcggcgtcggtgcctgcgtt	Protospacer
 **.   . *** *****.*************

1220. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccattcccgc	Protospacer
.** ********************. .    *

1221. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccgccattgccgttgccgttcccgc	Protospacer
.** ****** ************** .    *

1222. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcgttgccgttgccgttcccgc	Protospacer
.** ********.************ .    *

1223. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcgttgccgttgccgttcccgc	Protospacer
.** ********.************ .    *

1224. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccgttcccgc	Protospacer
.** **************.****** .    *

1225. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccgttcccgc	Protospacer
.** **************.****** .    *

1226. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1227. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1228. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1229. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1230. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1231. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ccagccggcgccattgccgttgccggcgtgat	Protospacer
 . **** ** ***************** . .

1232. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttggccgccggaattgcctttgccggaccgca	Protospacer
 * ******** ****** *******   .*

1233. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
atttccgccgccattgccgttgccaccagctg	Protospacer
*** ****** *************. *.. .

1234. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1235. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1236. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1237. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1238. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgccattgccattgccgccaccat	Protospacer
.********* *******.****** *.   .

1239. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccggcattggcgatgcccaacacca	Protospacer
 *************** ** **** .  * *

1240. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
accgaggccggcattggcgttgccgacgacag	Protospacer
*..*  ********** ********.***

1241. spacer 12.2|4029063|32|CP022578|CRT matches to CP003952 (Rhodococcus opacus PD630 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gccggcttcggcatcgccggtgccggcgaact	Protospacer
...* * .******.**** ***********.

1242. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccgttgccgccgttgccgccgttgc	Protospacer
  . ****** *********.******* . *

1243. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgaaccgccgttaccgccgtcgccgccgcgtc	Protospacer
    ****** *.***************  .*

1244. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtcgcgccggtgccgccgtcgtggccggaga	Protospacer
  .* *****************. *****

1245. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggttggccgctgcggccgtcgccgccggctc	Protospacer
   .. **** *** ***************.*

1246. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgatccgccgttgccgccgtcgcctccgttgc	Protospacer
   .****** ************* *** . *

1247. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gggaccgtcgctgccgccgtcgccgccctcga	Protospacer
*   ***.** ****************  *

1248. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccacccgtgccgccgtcgccgcccgaac	Protospacer
  . **.** ***************** *  *

1249. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgtccgccagagccgccgtcgccgcccgtgc	Protospacer
 . .*****.* *************** *. *

1250. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgccggtgccgccgccgcggccattgc	Protospacer
* . ***************.*** ***. . *

1251. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccgatgg	Protospacer
*.. ****** ********.********..

1252. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1253. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attgccgccggcgccgccggcgccgccattgc	Protospacer
.*. *******.******* *******. . *

1254. spacer 12.4|4029189|32|CP022578|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1255. spacer 12.4|4029189|32|CP022578|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1256. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtggcgccgtcgtcgccgcgcg	Protospacer
. *  ******** ********.*****  *

1257. spacer 12.4|4029189|32|CP022578|CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtggcgccgtcgtcgccgcgcg	Protospacer
. *  ******** ********.*****  *

1258. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgctggtgccgccgtcgccgcacaggg	Protospacer
*.**.***.*****************  .

1259. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1260. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1261. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1262. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcgcggccgatgccgccggcgccgccggtga	Protospacer
. * * ****.******** *********.

1263. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1264. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1265. spacer 12.4|4029189|32|CP022578|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcggccggtgcctccggcgccgccggaat	Protospacer
  * * ********* *** *********  .

1266. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1267. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1268. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1269. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1270. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1271. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1272. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1273. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1274. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1275. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tacatcgtcggtgccggcgtcgccgccgaggc	Protospacer
  * .**.******** ***********.  *

1276. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1277. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcggccggtgcctccggcgccgccggaat	Protospacer
  * * ********* *** *********  .

1278. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1279. spacer 12.4|4029189|32|CP022578|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggacgcccatgccgccgtcgccgccgccaa	Protospacer
*    **** .***************** *

1280. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1281. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1282. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1283. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021126 (Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caacgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1284. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1285. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1286. spacer 12.4|4029189|32|CP022578|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caacgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1287. spacer 12.4|4029189|32|CP022578|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcgcggccgatgccgccggcgccgccggtga	Protospacer
. * * ****.******** *********.

1288. spacer 12.4|4029189|32|CP022578|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1289. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gggtccgccgttgccaccgtcgccgccacctg	Protospacer
*  .****** ****.***********. *.

1290. spacer 12.4|4029189|32|CP022578|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgacgccggtgccgccgccgctgccggaga	Protospacer
* .  **************.***.*****

1291. spacer 12.4|4029189|32|CP022578|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1292. spacer 12.4|4029189|32|CP022578|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1293. spacer 12.4|4029189|32|CP022578|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1294. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgccccccaggtgccgccgtcgccgaccctgc	Protospacer
  **** * **************** *  . *

1295. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agctgcgccggtttcgccgtcgccgccgccgt	Protospacer
. *. ******* .************** * .

1296. spacer 12.4|4029189|32|CP022578|CRT matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcaaggccggtcccgccttcgccgccggctg	Protospacer
  *   ****** ***** ***********.

1297. spacer 12.4|4029189|32|CP022578|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tctggcgccggtgtcgtcgtcgccgccggact	Protospacer
 ..  ********.**.************ *.

1298. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccgatgg	Protospacer
*.. ****** ********.********..

1299. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccaacag	Protospacer
*.. ****** ********.*******..*

1300. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aatttcgccggggccgccgccgccgccggtct	Protospacer
. ...****** *******.*********.*.

1301. spacer 12.4|4029189|32|CP022578|CRT matches to NC_001759 (Streptomyces phaeochromogenes plasmid pJV1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgggccgccggtaccgccgtggccgccgtcgg	Protospacer
    ********.******* ******* *

1302. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aacaccgccgtcgccgccgtcgccgccgagat	Protospacer
. * ****** .****************.  .

1303. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccattgccggtgccgcccgcgccgccggatc	Protospacer
 .* ..************  ********* .*

1304. spacer 12.4|4029189|32|CP022578|CRT matches to MH051248 (Mycobacterium phage BigPhil, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1305. spacer 12.4|4029189|32|CP022578|CRT matches to MF668281 (Mycobacterium phage RitaG, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1306. spacer 12.4|4029189|32|CP022578|CRT matches to MN369749 (Mycobacterium phage MinionDave, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1307. spacer 12.4|4029189|32|CP022578|CRT matches to MT684597 (Mycobacterium phage Mandlovu, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1308. spacer 12.4|4029189|32|CP022578|CRT matches to KY012363 (Mycobacterium phage Empress, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1309. spacer 12.4|4029189|32|CP022578|CRT matches to MN585973 (Mycobacterium phage StAnnes, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1310. spacer 12.4|4029189|32|CP022578|CRT matches to MH077578 (Mycobacterium phage DillTech15, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1311. spacer 12.4|4029189|32|CP022578|CRT matches to MH020235 (Mycobacterium phage Batiatus, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1312. spacer 12.4|4029189|32|CP022578|CRT matches to KY471267 (Mycobacterium phage SassyB, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1313. spacer 12.4|4029189|32|CP022578|CRT matches to MG872841 (Mycobacterium phage Priscilla, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1314. spacer 12.5|4029243|32|CP022578|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
ctcggtgccggtgccgccgaggccggcgaaga	Protospacer
 *.* .  ************..*********

1315. spacer 12.5|4029243|32|CP022578|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
ctcggtgccggtgccgccgaggccggcgaaga	Protospacer
 *.* .  ************..*********

1316. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
cagggctgcggtggcgccgagaccggcgcaaa	Protospacer
   * ******** ******.******* *.

1317. spacer 12.5|4029243|32|CP022578|CRT matches to NZ_CP015221 (Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
tccgcctgcggtgccggcgataccggtggtga	Protospacer
 ..************* *** *****.*. *

1318. spacer 12.6|4029297|32|CP022578|CRT matches to NZ_CP013071 (Sphingobium indicum B90A plasmid pSRL1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
tccgccagcagccgcgccaacccagcgccttc	Protospacer
 .***** ************** ***   ..*

1319. spacer 12.6|4029297|32|CP022578|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
tgggaaaccagccgcggcaaccgcgccgatct	Protospacer
   *  ********** ****** *****.*.

1320. spacer 12.6|4029297|32|CP022578|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
gcaggcaacaggcgcgccaaccgagccgcagc	Protospacer
.. * ** *** ****************   *

1321. spacer 14.4|4159339|33|CP022578|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
gcgatgatgatcgccccgccggccccgcccgcc	Protospacer
 **..**** * *****************  .

1322. spacer 14.18|4160212|36|CP022578|CRT matches to NC_031262 (Mycobacterium phage Brocalys, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1323. spacer 14.18|4160212|36|CP022578|CRT matches to NC_004683 (Mycobacterium phage Che9c, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1324. spacer 14.18|4160212|36|CP022578|CRT matches to AY129333 (Mycobacterium virus Che9c, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1325. spacer 14.18|4160212|36|CP022578|CRT matches to MN234184 (Mycobacterium phage IdentityCrisis, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccagggaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1326. spacer 14.18|4160212|36|CP022578|CRT matches to KM083128 (Mycobacterium phage Sparky, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1327. spacer 14.18|4160212|36|CP022578|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 9, identity: 0.75

tacagccac--ccgccgttgccgccgaggccgccggcg	CRISPR spacer
--gggctgctgccgccgttgccgccgttgccgccggca	Protospacer
   .**..*  ***************  *********.

1328. spacer 14.18|4160212|36|CP022578|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 9, identity: 0.75

tacagccac--ccgccgttgccgccgaggccgccggcg	CRISPR spacer
--gggctgctgccgccgttgccgccgttgccgccggca	Protospacer
   .**..*  ***************  *********.

1329. spacer 1.7|431664|35|CP022578|CRT,PILER-CR,CRISPRCasFinder matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 10, identity: 0.714

gccccgtggatggcggatgcgttgtgcgcgcaagt	CRISPR spacer
accgtgtggatggcgaatgtgttgtgcgcggtgac	Protospacer
.** .**********.***.**********  ...

1330. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_KU140623 (Sinorhizobium sp. M14 plasmid pSinB, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gacgcaaggtcgccggcctcggtgcctgcgag	Protospacer
    *..********** .***********

1331. spacer 11.13|4010075|32|CP022578|CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gggccgcggtcgccggtgccggtgcgggttcc	Protospacer
  **** *********.********  *. ..

1332. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP048631 (Ancylobacter pratisalsi strain DSM 102029 plasmid pLGM, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ccgccgggggcgccggcgccggcgcgtcaagc	Protospacer
..******* ************.** *  . .

1333. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttaccattcccgc	Protospacer
.** *****************.**. .    *

1334. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccattcccgc	Protospacer
.** **************.*****. .    *

1335. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatctcgccggcattgccgttggcgccgcgat	Protospacer
. * .***************** ** ** . .

1336. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatctcgccggcattgccgttggcgccgcgat	Protospacer
. * .***************** ** ** . .

1337. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1338. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1339. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1340. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1341. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1342. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1343. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1344. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1345. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1346. spacer 12.2|4029063|32|CP022578|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1347. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1348. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1349. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1350. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccgccattgcctttgccaacagggt	Protospacer
 ********* ******* *****..*... .

1351. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1352. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013523 (Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1353. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1354. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cggtccgccggcattgtcgtcgccggccaggg	Protospacer
    ************.***.****** *.

1355. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1356. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1357. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1358. spacer 12.2|4029063|32|CP022578|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1359. spacer 12.2|4029063|32|CP022578|CRT matches to KU935731 (Mycobacterium phage Phrann, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1360. spacer 12.2|4029063|32|CP022578|CRT matches to MK224497 (Mycobacterium phage Henu3, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1361. spacer 12.2|4029063|32|CP022578|CRT matches to MT498061 (Mycobacterium phage Jung, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcacgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1362. spacer 12.2|4029063|32|CP022578|CRT matches to MH230879 (Mycobacterium phage Xavia, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1363. spacer 12.2|4029063|32|CP022578|CRT matches to MN585977 (Mycobacterium phage Atcoo, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1364. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccggagccgccgccgccgccgatgg	Protospacer
    ******* *******.********..

1365. spacer 12.4|4029189|32|CP022578|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtaccgccggtgccgccgctgccgccatagc	Protospacer
  . ***************..******.   *

1366. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgtcggtggcgccgtcgccgccctggc	Protospacer
    ***.***** *************    *

1367. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cctgccgcccgcgccgccgtcgccgccaggaa	Protospacer
 .. ***** *.***************.*

1368. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
catcccgccggcgccgccatcgccgcctatgg	Protospacer
  .********.******.******** ..

1369. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgacgccggtgccgacgtcgccgtcgccgg	Protospacer
  .  *********** ********.** *

1370. spacer 12.4|4029189|32|CP022578|CRT matches to MG812488 (Mycobacterium phage Frankie, complete genome) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tctgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 ..  **.****************** **  .

1371. spacer 14.5|4159393|36|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.722

tacagctgaccaccggccccgccggcgccgccgttc	CRISPR spacer
aagcctcggccaccggcgccgcctgcgccgccgttg	Protospacer
 *   ..*.******** ***** ***********

1372. spacer 14.5|4159393|36|CP022578|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.722

tacagctgaccaccggccccgccggcgccgccgttc	CRISPR spacer
gcccctcggccgccggccccgccggccccgccgttg	Protospacer
  *  ..*.**.************** ********

1373. spacer 11.13|4010075|32|CP022578|CRT matches to NZ_CP015743 (Shinella sp. HZN7 plasmid pShin-07, complete sequence) position: , mismatch: 11, identity: 0.656

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gcgccgtggtcgccggcgccgatgcggaaacc	Protospacer
 .**** **************.***  . ...

1374. spacer 12.2|4029063|32|CP022578|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 11, identity: 0.656

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggaaaagccgagattgccgttgccggcgacga	Protospacer
.  .  ****. *****************

1375. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 11, identity: 0.656

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aaagccgccgttgccgccgccgccgcccagtg	Protospacer
.   ****** ********.******* . .

1376. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1377. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1378. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1379. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1380. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1381. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1382. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1383. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1384. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1385. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1386. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1387. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1388. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1389. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1390. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1391. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1392. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1393. spacer 12.2|4029063|32|CP022578|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 12, identity: 0.625

attgccgccggcattgccgttgccggcgaacc-	CRISPR spacer
accagcg-cggcatcggcattgccggcggcaat	Protospacer
*... ** ******.* *.*********.

1394. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1395. spacer 12.4|4029189|32|CP022578|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctggccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1396. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1397. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctggccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1398. spacer 12.4|4029189|32|CP022578|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 13, identity: 0.594

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccgttgccgccgtcgcccccgtcgg---	Protospacer
   *.* ***..* .****.**.* ***.***

1399. spacer 12.4|4029189|32|CP022578|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1400. spacer 12.4|4029189|32|CP022578|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 13, identity: 0.594

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggggcgccgtcgccgccgtcgccgccgggga---	Protospacer
   * * ***.** .****.**.*****  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

429885 : 470247

Burkholderia_virus(40.0%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO06767.1\|429885_431147_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
AVO06768.1\|432474_433287_-	AAA family ATPase	NA	NA	NA	NA
AVO06769.1\|433283_434693_-\|transposase	transposase	NA	NA	NA	NA
AVO10068.1\|434763_435372_-	hypothetical protein	NA	NA	NA	NA
AVO06770.1\|435791_436103_-	hypothetical protein	NA	NA	NA	NA
AVO06771.1\|436207_436465_-	hypothetical protein	NA	NA	NA	NA
AVO06772.1\|436698_437853_-\|transposase	transposase	NA	NA	NA	NA
AVO06773.1\|438051_438243_-	hypothetical protein	NA	NA	NA	NA
AVO10069.1\|438239_438644_-	hypothetical protein	NA	NA	NA	NA
AVO06774.1\|438716_439082_-	histone acetyltransferase	NA	NA	NA	NA
AVO06775.1\|439221_439689_-	DUF1778 domain-containing protein	NA	NA	NA	NA
AVO06776.1\|439687_440731_+	DUF2293 domain-containing protein	NA	NA	NA	NA
AVO06777.1\|440773_441004_+	antitoxin MazE	NA	NA	NA	NA
AVO06778.1\|440987_441344_+	mRNA interferase MazF9	NA	NA	NA	NA
AVO06779.1\|441445_443095_-	hydrolase	NA	NA	NA	NA
AVO06780.1\|443113_443743_-	DUF3558 domain-containing protein	NA	NA	NA	NA
AVO06781.1\|443873_444200_+	hypothetical protein	NA	NA	NA	NA
AVO06782.1\|444203_445892_+	hypothetical protein	NA	NA	NA	NA
AVO06783.1\|445891_446455_+	hypothetical protein	NA	NA	NA	NA
AVO06784.1\|446599_447574_+	metallophosphoesterase	NA	NA	NA	NA
AVO06785.1\|447570_448254_+	4'-phosphopantetheinyl transferase	NA	NA	NA	NA
AVO06786.1\|448250_449147_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AVO06787.1\|449348_449930_+\|transposase	IS607 family transposase IS1602	F9VHY9	Thermus_phage	5.0e-18	30.6
AVO06788.1\|449929_451309_+\|transposase	transposase	A0A7P9	Microcystis_virus	9.3e-31	30.3
AVO06789.1\|451341_452547_+	lipid-transfer protein	NA	NA	NA	NA
AVO06790.1\|452572_453805_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AVO06791.1\|453865_454552_-	transcriptional regulator	NA	NA	NA	NA
AVO06792.1\|454636_456400_-	hypothetical protein	NA	NA	NA	NA
AVO10070.1\|456610_457606_+	bifunctional riboflavin kinase/FMN adenylyltransferase	NA	NA	NA	NA
AVO06793.1\|457762_458032_+	30S ribosomal protein S15	NA	NA	NA	NA
AVO06794.1\|458044_458560_+	hypothetical protein	NA	NA	NA	NA
AVO06795.1\|458913_461172_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
AVO06796.1\|461149_462466_+	peptidase M16	J3IZ03	Acanthamoeba_polyphaga_lentillevirus	5.4e-28	24.4
AVO06797.1\|462526_463561_+	nitronate monooxygenase	NA	NA	NA	NA
AVO06798.1\|463575_464691_-	alanine dehydrogenase	NA	NA	NA	NA
AVO06799.1\|464756_465296_+	AsnC family transcriptional regulator	NA	NA	NA	NA
AVO06800.1\|465327_465798_+	SRPBCC family protein	NA	NA	NA	NA
AVO06801.1\|465955_467026_+	metal-dependent hydrolase	NA	NA	NA	NA
AVO10071.1\|467207_468137_+	oxidoreductase	NA	NA	NA	NA
AVO10072.1\|468140_468602_-	N-acetyltransferase	NA	NA	NA	NA
AVO06802.1\|468754_469030_+	hypothetical protein	NA	NA	NA	NA
AVO06803.1\|468986_470247_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1

DBSCAN-SWA_2

4164620 : 4250792

Burkholderia_virus(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO09842.1\|4164620_4165882_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
AVO10509.1\|4166323_4167313_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase 2	NA	NA	NA	NA
AVO10510.1\|4167342_4169148_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AVO09843.1\|4169156_4170047_+	diterpene synthase	NA	NA	NA	NA
AVO09844.1\|4170051_4171557_+	type B diterpene cyclase	NA	NA	NA	NA
AVO10511.1\|4171595_4172249_-	haloacid dehalogenase	NA	NA	NA	NA
AVO09845.1\|4172356_4173784_-	amidase	NA	NA	NA	NA
AVO09846.1\|4173788_4174037_-	enoyl-CoA hydratase	NA	NA	NA	NA
AVO09847.1\|4174037_4174679_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AVO09848.1\|4174757_4174862_-	PE family protein	NA	NA	NA	NA
AVO09849.1\|4174915_4176091_-	trehalose-phosphatase	NA	NA	NA	NA
AVO09850.1\|4176132_4177473_-	wax ester/triacylglycerol synthase family O-acyltransferase	NA	NA	NA	NA
AVO09851.1\|4177664_4180904_+	error-prone DNA polymerase	A0A1C9LWS4	Streptomyces_phage	1.6e-118	32.4
AVO09852.1\|4180992_4181427_-	TIGR03667 family PPOX class F420-dependent oxidoreductase	NA	NA	NA	NA
AVO09853.1\|4181425_4182070_+	oxidoreductase	NA	NA	NA	NA
AVO10512.1\|4182070_4183846_-	PE family protein	NA	NA	NA	NA
AVO09854.1\|4184212_4184677_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
AVO09855.1\|4184912_4187543_+	ATP-binding protein	NA	NA	NA	NA
AVO09856.1\|4187539_4187932_+	dynein regulation protein LC7	NA	NA	NA	NA
AVO09857.1\|4187909_4188278_+	DUF742 domain-containing protein	NA	NA	NA	NA
AVO09858.1\|4188258_4188840_+	ATP/GTP-binding protein	NA	NA	NA	NA
AVO09859.1\|4188846_4189398_+	pentapeptide repeat protein MfpA	NA	NA	NA	NA
AVO09860.1\|4189394_4189763_-	hypothetical protein	NA	NA	NA	NA
AVO09861.1\|4189879_4191070_-	oxidoreductase	NA	NA	NA	NA
AVO09862.1\|4191111_4191369_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
AVO09863.1\|4191365_4191641_-	antitoxin	NA	NA	NA	NA
AVO09864.1\|4191764_4192610_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	NA	NA	NA	NA
AVO09865.1\|4192606_4192900_+	DUF3017 domain-containing protein	NA	NA	NA	NA
AVO09866.1\|4192913_4193303_-	DUF732 domain-containing protein	NA	NA	NA	NA
AVO09867.1\|4193417_4193678_+	oxidoreductase	NA	NA	NA	NA
AVO10513.1\|4193698_4193923_+	hypothetical protein	NA	NA	NA	NA
AVO09868.1\|4193820_4194192_+	FAD-binding oxidoreductase	A0A0B5JBT9	Pandoravirus	3.3e-15	56.4
AVO09869.1\|4194273_4195068_+	oxidoreductase	NA	NA	NA	NA
AVO09870.1\|4195311_4201512_+	PPE family protein	NA	NA	NA	NA
AVO09871.1\|4201406_4206461_+	PPE family protein	NA	NA	NA	NA
AVO09872.1\|4206797_4207085_+\|transposase	transposase	NA	NA	NA	NA
AVO09873.1\|4207301_4208120_+\|transposase	transposase	NA	NA	NA	NA
AVO10514.1\|4208156_4208603_-\|transposase	transposase	NA	NA	NA	NA
AVO10515.1\|4208699_4209191_+	hypothetical protein	NA	NA	NA	NA
AVO09874.1\|4209228_4218702_+	PPE family protein	NA	NA	NA	NA
AVO09875.1\|4218957_4219215_+	DUF3017 domain-containing protein	NA	NA	NA	NA
AVO09876.1\|4224603_4225584_+	hypothetical protein	NA	NA	NA	NA
AVO10516.1\|4231631_4232363_-	methyltransferase	NA	NA	NA	NA
AVO09877.1\|4232359_4233499_-	homoserine O-acetyltransferase	NA	NA	NA	NA
AVO09878.1\|4233510_4234860_-	bifunctional o-acetylhomoserine/o-acetylserine sulfhydrylase	A0A0B5JD48	Pandoravirus	2.5e-12	26.5
AVO09879.1\|4235142_4236372_+	isocitrate dehydrogenase (NADP(+))	NA	NA	NA	NA
AVO09880.1\|4236438_4237071_-	alpha/beta hydrolase	NA	NA	NA	NA
AVO09881.1\|4237355_4238366_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AVO09882.1\|4238386_4239256_+	inner membrane protein YhjD	NA	NA	NA	NA
AVO09883.1\|4239289_4239730_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
AVO10517.1\|4239748_4240228_-	hypothetical protein	NA	NA	NA	NA
AVO09884.1\|4240204_4241050_+	DUF732 domain-containing protein	NA	NA	NA	NA
AVO09885.1\|4241240_4242392_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
AVO09886.1\|4242388_4243897_-	MFS transporter	NA	NA	NA	NA
AVO09887.1\|4243992_4245210_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	8.0e-10	27.3
AVO09888.1\|4245278_4246646_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	9.0e-18	25.8
AVO10518.1\|4246654_4247593_+	RNA polymerase sigma factor SigJ	NA	NA	NA	NA
AVO09889.1\|4247525_4249055_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AVO09890.1\|4249076_4249256_-	hypothetical protein	NA	NA	NA	NA
AVO09891.1\|4249531_4250792_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022578

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection