CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP020383	Bacillus cereus strain FORC60 chromosome, complete genome	1 crisprs	cas3,csa3,WYL,c2c9_V-U4,cas14k,DinG,DEDDh	10	5	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020383_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020383_2

3634978-3635631

Orphan

Consensus_repeat	Method
TCAAGGNGTTCAAGGTAACACGGGNGC	CRT

12 spacers

The CRISPR arrays of CP020383_2

>merge|CP020383|2|3634978-3635631|CRT
TCAAGGTGTTCAAGGTAACACGGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCCACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACCGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCCACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACCGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACTGGACCTCAGGGTGTTCAAGGCAACACGGGTGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGCGCTACTGGCATAGGAGTTACTGGACCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACCGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACTGGACCTCAGGGTGTTCAAGGTAACACGGGCGCTACCGGACCTCAAGGCATTCAAGGACCAACGGGTGC

>CP020383|2|1|3634978-3635631|CRT
TCAAGGTGTTCAAGGTAACACGGGTGC	TACCGGCGCTACTGGACC
TCAAGGCGTTCAAGGTAACACGGGCGC	TACTGGTGCTACTGGACC
TCAAGGTGTTCAAGGTAACACGGGTGC	CACGGGTGCTACTGGTGCCACTGGACC
TCAAGGTGTTCAAGGTAACACGGGTGC	TACCGGTGCTACTGGACC
TCAAGGCGTTCAAGGTAACACGGGTGC	CACGGGTGCTACTGGTGCCACTGGACC
TCAAGGTGTTCAAGGTAACACGGGTGC	TACCGGTGCTACTGGACC
TCAAGGCGTTCAAGGTAACACGGGCGC	TACTGGTGCTACTGGACC
TCAAGGTGTTCAAGGTAACACGGGCGC	TACTGGTGCTACTGGACC
TCAAGGTGTTCAAGGTAACACGGGTGC	TACTGGACCTCAGGGTGTTCAAGGCAACACGGGTGCTACTGGACC
TCAAGGTGCTCAAGGTAACACGGGCGC	TACTGGCATAGGAGTTACTGGACCTACTGGACC
TCAAGGCGTTCAAGGTAACACGGGTGC	TACCGGTGCTACTGGACC
TCAAGGCGTTCAAGGTAACACGGGTGC	TACTGGACCTCAGGGTGTTCAAGGTAACACGGGCGCTACCGGACC
TCAAGGCATTCAAGGACCAACGGGTGC

Protein	Signature genes	Signature genes Name	Protein_function
CP020383.1\|AVR33563.1\|3629930_3630554_+\|membrane-protein,-putative	unknown	unknown	gnl\|CDD\|225415
CP020383.1\|AVR33577.1\|3641955_3642708_-\|fructose-operon-Transcriptional-repressor,-DeoR-family	unknown	unknown	gnl\|CDD\|224268
CP020383.1\|AVR33564.1\|3630653_3630791_+\|hypothetical-protein	unknown	unknown	unknown
CP020383.1\|AVR33558.1\|3625423_3626677_-\|Glutamine-synthetase-type-I	unknown	unknown	gnl\|CDD\|273198
CP020383.1\|AVR33573.1\|3637569_3637815_+\|hypothetical-protein	unknown	unknown	unknown
CP020383.1\|AVR33560.1\|3627197_3627314_+\|hypothetical-protein	unknown	unknown	unknown
CP020383.1\|AVR33562.1\|3628563_3629841_-\|GTP-binding-protein-HflX	unknown	unknown	gnl\|CDD\|274455
CP020383.1\|AVR33572.1\|3636435_3637389_-\|tRNA-dimethylallyltransferase	unknown	unknown	gnl\|CDD\|234626
CP020383.1\|AVR33566.1\|3631892_3632858_+\|site-specific-recombinase,-phage-integrase-family	unknown	unknown	gnl\|CDD\|271175
CP020383.1\|AVR33574.1\|3637877_3638828_-\|enterotoxin-/-cell-wall-binding-protein	unknown	unknown	gnl\|CDD\|226112
CP020383.1\|AVR33576.1\|3641047_3641959_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
CP020383.1\|AVR33578.1\|3642865_3644029_-\|NADH-dependent-butanol-dehydrogenase-A	unknown	unknown	gnl\|CDD\|341466
CP020383.1\|AVR33567.1\|3632971_3634672_+\|Flagellar-hook-length-control-protein-FliK	unknown	unknown	gnl\|CDD\|380180
CP020383.1\|AVR33580.1\|3644866_3644983_-\|hypothetical-protein	unknown	unknown	unknown
CP020383.1\|AVR33575.1\|3639177_3641034_-\|PTS-system,-fructose-specific-IIABC-component	unknown	unknown	gnl\|CDD\|236740
CP020383.1\|AVR33579.1\|3644146_3644686_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225204
CP020383.1\|AVR33565.1\|3630822_3631779_-\|Stage-V-sporulation-protein-SpoVK	unknown	unknown	gnl\|CDD\|163057
CP020383.1\|AVR33559.1\|3626725_3627115_-\|Transcriptional-regulator,-MerR-family	unknown	unknown	gnl\|CDD\|133380
CP020383.1\|AVR33571.1\|3636189_3636414_-\|RNA-binding-protein-Hfq	unknown	unknown	gnl\|CDD\|179001
CP020383.1\|AVR33561.1\|3627299_3628571_-\|Aluminum-resistance-protein	unknown	unknown	gnl\|CDD\|226585

Protein	Function_ID	Function_description	E-value
CP020383.1\|AVR33563.1\|3629930_3630554_+\|membrane-protein,-putative	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.79506e-60
CP020383.1\|AVR33577.1\|3641955_3642708_-\|fructose-operon-Transcriptional-repressor,-DeoR-family	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.60033e-82
CP020383.1\|AVR33558.1\|3625423_3626677_-\|Glutamine-synthetase-type-I	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
CP020383.1\|AVR33575.1\|3639177_3641034_-\|PTS-system,-fructose-specific-IIABC-component	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	9.11225e-143
CP020383.1\|AVR33562.1\|3628563_3629841_-\|GTP-binding-protein-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
CP020383.1\|AVR33572.1\|3636435_3637389_-\|tRNA-dimethylallyltransferase	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.02223e-164
CP020383.1\|AVR33566.1\|3631892_3632858_+\|site-specific-recombinase,-phage-integrase-family	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.53009e-12
CP020383.1\|AVR33561.1\|3627299_3628571_-\|Aluminum-resistance-protein	gnl\|CDD\|226585	COG4100, COG4100, Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism].	0
CP020383.1\|AVR33576.1\|3641047_3641959_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.80742e-141
CP020383.1\|AVR33578.1\|3642865_3644029_-\|NADH-dependent-butanol-dehydrogenase-A	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
CP020383.1\|AVR33567.1\|3632971_3634672_+\|Flagellar-hook-length-control-protein-FliK	gnl\|CDD\|380180	NF033172, N_to_GlyXaaXaa, collagen-like repeat preface domain-containing protein. All protein sequence used in the seed alignment for this model comes from the N-terminal region of proteins with extended collagen-like Gly-rich repeat regions, and occur in Firmicutes.	4.41871e-50
CP020383.1\|AVR33579.1\|3644146_3644686_-\|hypothetical-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.30886e-57
CP020383.1\|AVR33565.1\|3630822_3631779_-\|Stage-V-sporulation-protein-SpoVK	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	2.56237e-156
CP020383.1\|AVR33559.1\|3626725_3627115_-\|Transcriptional-regulator,-MerR-family	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
CP020383.1\|AVR33571.1\|3636189_3636414_-\|RNA-binding-protein-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
CP020383.1\|AVR33574.1\|3637877_3638828_-\|enterotoxin-/-cell-wall-binding-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.44092e-36

>CP020383.1|AVR33567.1|3632971_3634672_+|Flagellar-hook-length-control-protein-FliK
MSRYNDNQNKFSKPCFPSSAGRIPNTPSIPITKAQLRTFRAIIIDLTKIIPTLFANPSPKNIEDLIDTLNLLSKFICSLDATSSLKAQGLAIIKNLITILRNPTFVASAVFIELQNLINYLLYITKLFRIDPCTLQELLKLIAALQTALVNSASFIQGPTGPTGPAGATGATGATGPRGNTGATGATGPQGNTGATGATGATGPRGNTGATGATGPQGNTGATGATGATGPRGNTGATGATGPQGNTGATGATGATGPRGNTGATGATGPQGNTGATGATGATGPRGNTGATGATGPQGNTGATGATGPRGNTGATGATGPQGNTGATGATGPRGNTGATGATGPQGNTGATGATGPRGNTGATGATGPQGVQGNTGATGATGPQGNTGATGATGIGVTGPTGPSGGPPGPTGPQGPQGNTGATGATGPQGAQGPAGATGATGPQGVQGNTGATGATGPQGAQGPAGATGATGPQGVQGNTGATGATGPQGVQGNTGATATGPQGVQGNTGATGATGPQGQVTRVLPALLDLKVFKVTRVLPALLDLKVFKVTRVLPALLDLKVSR
>CP020383.1|AVR33566.1|3631892_3632858_+|site-specific-recombinase,-phage-integrase-family
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>CP020383.1|AVR33565.1|3630822_3631779_-|Stage-V-sporulation-protein-SpoVK
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETAIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKNDLIGISSMDLMLEEETHST
>CP020383.1|AVR33564.1|3630653_3630791_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMEHFHKVHQEKEKKE
>CP020383.1|AVR33563.1|3629930_3630554_+|membrane-protein,-putative
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSIHK
>CP020383.1|AVR33562.1|3628563_3629841_-|GTP-binding-protein-HflX
MMEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLNARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIETKMKKEMDCYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>CP020383.1|AVR33561.1|3627299_3628571_-|Aluminum-resistance-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTSAGLVDFEAVAAAIHNNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLIIS
>CP020383.1|AVR33560.1|3627197_3627314_+|hypothetical-protein
MIFYNFFMNFFILFSNRINHYFYTKKAAKIDSFPLRNY
>CP020383.1|AVR33559.1|3626725_3627115_-|Transcriptional-regulator,-MerR-family
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>CP020383.1|AVR33558.1|3625423_3626677_-|Glutamine-synthetase-type-I
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQAIKKEKKKEIQTFRFGFFYFIKK
>CP020383.1|AVR33571.1|3636189_3636414_-|RNA-binding-protein-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>CP020383.1|AVR33572.1|3636435_3637389_-|tRNA-dimethylallyltransferase
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKAEMDGIPHYMIDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNARRVIRALEIFHMTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRASLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>CP020383.1|AVR33573.1|3637569_3637815_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTLHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>CP020383.1|AVR33574.1|3637877_3638828_-|enterotoxin-/-cell-wall-binding-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVFSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPARTNTPVKNNTVVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPAGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>CP020383.1|AVR33575.1|3639177_3641034_-|PTS-system,-fructose-specific-IIABC-component
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEETEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKSESIEGEKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAVMLGIWKKKVQ
>CP020383.1|AVR33576.1|3641047_3641959_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVSSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLQTEGVTTNFVQVDEDTRINVKIKGEEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPVSIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGVKYVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>CP020383.1|AVR33577.1|3641955_3642708_-|fructose-operon-Transcriptional-repressor,-DeoR-family
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVIEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKRQTNVIEADKQ
>CP020383.1|AVR33578.1|3642865_3644029_-|NADH-dependent-butanol-dehydrogenase-A
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTTSVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCEAVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFNVETDGKTDREIALEGIQALRQFWTSIEAPVTLSDYAIGENEIDLMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>CP020383.1|AVR33579.1|3644146_3644686_-|hypothetical-protein
MDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>CP020383.1|AVR33580.1|3644866_3644983_-|hypothetical-protein
MWFRFLMIGFFSLTAISLMGYQVSEIFQAYSDTFFNKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3633520-3633537	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3633601-3633618	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3633682-3633699	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3633844-3633861	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3633916-3633933	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634330-3634347	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634420-3634437	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634507-3634524	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634548-3634565	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634593-3634610	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634638-3634655	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634727-3634744	0	1.0
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634105-3634122	0	1.0
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634682-3634699	0	1.0
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634817-3634843	0	1.0
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634817-3634843	0	1.0
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634105-3634122	0	1.0
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634682-3634699	0	1.0
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634105-3634122	0	1.0
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634682-3634699	0	1.0
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	CP020383.1	3635641-3635673	0	1.0
CP020383_2	2.1\|3635005\|18\|CP020383\|CRT	3635005-3635022	18	CP020383.1	3634240-3634257	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3633763-3633780	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3633988-3634005	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634060-3634077	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634240-3634257	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634781-3634798	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634826-3634843	1	0.944
CP020383_2	2.2\|3635050\|18\|CP020383\|CRT	3635050-3635067	18	CP020383.1	3634880-3634897	1	0.944
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634673-3634699	1	0.963
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633484-3633501	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633520-3633537	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633601-3633618	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633682-3633699	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633844-3633861	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3633916-3633933	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634105-3634122	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634285-3634302	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634330-3634347	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634375-3634392	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634420-3634437	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634507-3634524	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634548-3634565	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634593-3634610	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634638-3634655	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634682-3634699	1	0.944
CP020383_2	2.4\|3635149\|18\|CP020383\|CRT	3635149-3635166	18	CP020383.1	3634727-3634744	1	0.944
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634673-3634699	1	0.963
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633484-3633501	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633520-3633537	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633601-3633618	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633682-3633699	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633844-3633861	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3633916-3633933	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634105-3634122	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634285-3634302	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634330-3634347	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634375-3634392	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634420-3634437	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634507-3634524	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634548-3634565	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634593-3634610	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634638-3634655	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634682-3634699	1	0.944
CP020383_2	2.6\|3635248\|18\|CP020383\|CRT	3635248-3635265	18	CP020383.1	3634727-3634744	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3633763-3633780	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3633988-3634005	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634060-3634077	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634240-3634257	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634781-3634798	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634826-3634843	1	0.944
CP020383_2	2.7\|3635293\|18\|CP020383\|CRT	3635293-3635310	18	CP020383.1	3634880-3634897	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3633763-3633780	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3633988-3634005	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634060-3634077	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634240-3634257	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634781-3634798	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634826-3634843	1	0.944
CP020383_2	2.8\|3635338\|18\|CP020383\|CRT	3635338-3635355	18	CP020383.1	3634880-3634897	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633484-3633501	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633520-3633537	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633601-3633618	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633682-3633699	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633844-3633861	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3633916-3633933	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634105-3634122	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634285-3634302	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634330-3634347	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634375-3634392	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634420-3634437	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634507-3634524	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634548-3634565	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634593-3634610	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634638-3634655	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634682-3634699	1	0.944
CP020383_2	2.11\|3635515\|18\|CP020383\|CRT	3635515-3635532	18	CP020383.1	3634727-3634744	1	0.944
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3633871-3633897	2	0.926
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3633943-3633969	2	0.926
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634015-3634041	2	0.926
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634051-3634077	2	0.926
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634096-3634122	2	0.926
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP020383.1	3634231-3634257	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3633871-3633897	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3633943-3633969	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634015-3634041	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634051-3634077	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634096-3634122	2	0.926
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP020383.1	3634231-3634257	2	0.926

1. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3633520-3633537, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

2. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3633601-3633618, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

3. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3633682-3633699, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

4. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3633844-3633861, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

5. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3633916-3633933, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

6. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634330-3634347, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

7. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634420-3634437, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

8. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634507-3634524, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

9. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634548-3634565, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

10. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634593-3634610, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

11. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634638-3634655, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

12. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634727-3634744, mismatch: 0, identity: 1.0

taccggcgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******************

13. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

14. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

15. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634817-3634843, mismatch: 0, identity: 1.0

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccactggacc	Protospacer
***************************

16. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634817-3634843, mismatch: 0, identity: 1.0

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccactggacc	Protospacer
***************************

17. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

18. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

19. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

20. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 0, identity: 1.0

tactggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
******************

21. spacer 2.10|3635455|33|CP020383|CRT matches to position: 3635641-3635673, mismatch: 0, identity: 1.0

tactggcataggagttactggacctactggacc	CRISPR spacer
tactggcataggagttactggacctactggacc	Protospacer
*********************************

22. spacer 2.1|3635005|18|CP020383|CRT matches to position: 3634240-3634257, mismatch: 1, identity: 0.944

taccggcgctactggacc	CRISPR spacer
tactggcgctactggacc	Protospacer
***.**************

23. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3633763-3633780, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

24. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3633988-3634005, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

25. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634060-3634077, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

26. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634240-3634257, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggcgctactggacc	Protospacer
******.***********

27. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634781-3634798, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

28. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634826-3634843, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

29. spacer 2.2|3635050|18|CP020383|CRT matches to position: 3634880-3634897, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

30. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634673-3634699, mismatch: 1, identity: 0.963

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgctactggacc	Protospacer
******************.********

31. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633484-3633501, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

32. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633520-3633537, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

33. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633601-3633618, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

34. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633682-3633699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

35. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633844-3633861, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

36. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3633916-3633933, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

37. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

38. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634285-3634302, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

39. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634330-3634347, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

40. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634375-3634392, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

41. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634420-3634437, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

42. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634507-3634524, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

43. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634548-3634565, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

44. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634593-3634610, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

45. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634638-3634655, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

46. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

47. spacer 2.4|3635149|18|CP020383|CRT matches to position: 3634727-3634744, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

48. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634673-3634699, mismatch: 1, identity: 0.963

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgctactggacc	Protospacer
******************.********

49. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633484-3633501, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

50. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633520-3633537, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

51. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633601-3633618, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

52. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633682-3633699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

53. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633844-3633861, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

54. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3633916-3633933, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

55. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

56. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634285-3634302, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

57. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634330-3634347, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

58. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634375-3634392, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

59. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634420-3634437, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

60. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634507-3634524, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

61. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634548-3634565, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

62. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634593-3634610, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

63. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634638-3634655, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

64. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

65. spacer 2.6|3635248|18|CP020383|CRT matches to position: 3634727-3634744, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

66. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3633763-3633780, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

67. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3633988-3634005, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

68. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634060-3634077, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

69. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634240-3634257, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggcgctactggacc	Protospacer
******.***********

70. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634781-3634798, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

71. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634826-3634843, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

72. spacer 2.7|3635293|18|CP020383|CRT matches to position: 3634880-3634897, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

73. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3633763-3633780, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

74. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3633988-3634005, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

75. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634060-3634077, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgctaccggacc	Protospacer
************.*****

76. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634240-3634257, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggcgctactggacc	Protospacer
******.***********

77. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634781-3634798, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

78. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634826-3634843, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

79. spacer 2.8|3635338|18|CP020383|CRT matches to position: 3634880-3634897, mismatch: 1, identity: 0.944

tactggtgctactggacc	CRISPR spacer
tactggtgccactggacc	Protospacer
*********.********

80. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633484-3633501, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

81. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633520-3633537, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

82. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633601-3633618, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

83. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633682-3633699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

84. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633844-3633861, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

85. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3633916-3633933, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

86. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634105-3634122, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

87. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634285-3634302, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

88. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634330-3634347, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

89. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634375-3634392, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggtgccactggacc	Protospacer
*********.********

90. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634420-3634437, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

91. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634507-3634524, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

92. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634548-3634565, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

93. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634593-3634610, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

94. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634638-3634655, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

95. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634682-3634699, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
tactggtgctactggacc	Protospacer
***.**************

96. spacer 2.11|3635515|18|CP020383|CRT matches to position: 3634727-3634744, mismatch: 1, identity: 0.944

taccggtgctactggacc	CRISPR spacer
taccggcgctactggacc	Protospacer
******.***********

97. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3633871-3633897, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

98. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3633943-3633969, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

99. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634015-3634041, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

100. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634051-3634077, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgctaccggacc	Protospacer
******************.**.*****

101. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634096-3634122, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggcgctactggtgctactggacc	Protospacer
******.***********.********

102. spacer 2.3|3635095|27|CP020383|CRT matches to position: 3634231-3634257, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggcgctactggacc	Protospacer
***************.**.********

103. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3633871-3633897, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

104. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3633943-3633969, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

105. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634015-3634041, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctaccggtgccactgggcc	Protospacer
************.***********.**

106. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634051-3634077, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgctaccggacc	Protospacer
******************.**.*****

107. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634096-3634122, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggcgctactggtgctactggacc	Protospacer
******.***********.********

108. spacer 2.5|3635194|27|CP020383|CRT matches to position: 3634231-3634257, mismatch: 2, identity: 0.926

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggcgctactggacc	Protospacer
***************.**.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29816-29842	3	0.889
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3663-3689	3	0.889
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	GU070616	Salmonella phage PVP-SE1, complete genome	52814-52840	3	0.889
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	JX181824	Salmonella phage SSE-121, complete genome	14495-14521	3	0.889
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29816-29842	3	0.889
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3663-3689	3	0.889
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	GU070616	Salmonella phage PVP-SE1, complete genome	52814-52840	3	0.889
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	JX181824	Salmonella phage SSE-121, complete genome	14495-14521	3	0.889
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376842-2376868	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250467-1250493	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN693405	Marine virus AFVG_25M416, complete genome	18958-18984	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN693333	Marine virus AFVG_25M417, complete genome	18958-18984	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN693092	Marine virus AFVG_25M37, complete genome	19060-19086	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN694665	Marine virus AFVG_250M495, complete genome	19215-19241	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376842-2376868	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250467-1250493	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN693405	Marine virus AFVG_25M416, complete genome	18958-18984	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN693333	Marine virus AFVG_25M417, complete genome	18958-18984	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN693092	Marine virus AFVG_25M37, complete genome	19060-19086	4	0.852
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN694665	Marine virus AFVG_250M495, complete genome	19215-19241	4	0.852
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	179155-179181	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15748-15774	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	16720-16746	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	177759-177785	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15745-15771	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	17638-17664	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	180169-180195	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN204498	Streptomyces phage Saftant, complete genome	18528-18554	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434215-434241	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN693099	Marine virus AFVG_25M184, complete genome	13930-13956	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN163280	Klebsiella phage KpGranit, complete genome	86385-86411	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MT724048	Staphylococcus phage SAP3, partial genome	27085-27111	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MH616795	Microviridae sp. isolate ctbh757, complete genome	1053-1079	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	179155-179181	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15748-15774	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	16720-16746	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	177759-177785	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15745-15771	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	17638-17664	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	180169-180195	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN204498	Streptomyces phage Saftant, complete genome	18528-18554	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434215-434241	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN693099	Marine virus AFVG_25M184, complete genome	13930-13956	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN163280	Klebsiella phage KpGranit, complete genome	86385-86411	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MT724048	Staphylococcus phage SAP3, partial genome	27085-27111	5	0.815
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MH616795	Microviridae sp. isolate ctbh757, complete genome	1053-1079	5	0.815
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN693921	Marine virus AFVG_250M344, complete genome	20776-20802	6	0.778
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MN694446	Marine virus AFVG_250M343, complete genome	20994-21020	6	0.778
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251981-252007	6	0.778
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2046-2072	6	0.778
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MK613348	Roseobacter phage CRP-6, complete genome	35821-35847	6	0.778
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN693921	Marine virus AFVG_250M344, complete genome	20776-20802	6	0.778
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MN694446	Marine virus AFVG_250M343, complete genome	20994-21020	6	0.778
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251981-252007	6	0.778
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2046-2072	6	0.778
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MK613348	Roseobacter phage CRP-6, complete genome	35821-35847	6	0.778
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14917-14943	7	0.741
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14920-14946	7	0.741
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14917-14943	7	0.741
CP020383_2	2.3\|3635095\|27\|CP020383\|CRT	3635095-3635121	27	MT711887	Pseudomonas phage Stalingrad, complete genome	8160-8186	7	0.741
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14917-14943	7	0.741
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14920-14946	7	0.741
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14917-14943	7	0.741
CP020383_2	2.5\|3635194\|27\|CP020383\|CRT	3635194-3635220	27	MT711887	Pseudomonas phage Stalingrad, complete genome	8160-8186	7	0.741
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9291-9323	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9444-9476	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21470-21502	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21623-21655	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8994-9026	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9111-9143	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9327-9359	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9552-9584	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9867-9899	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10110-10142	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10893-10925	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21173-21205	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21290-21322	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21506-21538	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21731-21763	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22046-22078	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22289-22321	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23072-23104	8	0.758
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10461-10493	8	0.758
CP020383_3	3.1\|5143407\|31\|CP020383\|CRISPRCasFinder	5143407-5143437	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9138-9170	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9174-9206	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10002-10034	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21317-21349	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21353-21385	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22181-22213	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10362-10394	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10704-10736	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10785-10817	9	0.727
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	MN693263	Marine virus AFVG_25M296, complete genome	14295-14327	9	0.727
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	9	0.735
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	9	0.735
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8886-8918	10	0.697
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9210-9242	10	0.697
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9363-9395	10	0.697
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21065-21097	10	0.697
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21389-21421	10	0.697
CP020383_2	2.10\|3635455\|33\|CP020383\|CRT	3635455-3635487	33	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21542-21574	10	0.697
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
CP020383_3	3.2\|5143461\|34\|CP020383\|CRISPRCasFinder	5143461-5143494	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 2.3|3635095|27|CP020383|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgcaactggacc	Protospacer
.** ************** ********

2. spacer 2.3|3635095|27|CP020383|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgcaactggacc	Protospacer
.** ************** ********

3. spacer 2.3|3635095|27|CP020383|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 3, identity: 0.889

-cacgggtgctactggtgccactggacc	CRISPR spacer
acaaggg-gctactggtgccacaggacc	Protospacer
 ** *** ************** *****

4. spacer 2.3|3635095|27|CP020383|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 3, identity: 0.889

-cacgggtgctactggtgccactggacc	CRISPR spacer
acaaggg-gctactggtgccacaggacc	Protospacer
 ** *** ************** *****

5. spacer 2.5|3635194|27|CP020383|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgcaactggacc	Protospacer
.** ************** ********

6. spacer 2.5|3635194|27|CP020383|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgcaactggacc	Protospacer
.** ************** ********

7. spacer 2.5|3635194|27|CP020383|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 3, identity: 0.889

-cacgggtgctactggtgccactggacc	CRISPR spacer
acaaggg-gctactggtgccacaggacc	Protospacer
 ** *** ************** *****

8. spacer 2.5|3635194|27|CP020383|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 3, identity: 0.889

-cacgggtgctactggtgccactggacc	CRISPR spacer
acaaggg-gctactggtgccacaggacc	Protospacer
 ** *** ************** *****

9. spacer 2.3|3635095|27|CP020383|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
gacgggtgctactggtgccaccggcgc	Protospacer
 ********************.**  *

10. spacer 2.3|3635095|27|CP020383|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
gacgggtgctactggtgccaccggcgc	Protospacer
 ********************.**  *

11. spacer 2.3|3635095|27|CP020383|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggagc	Protospacer
 ** **************.****** *

12. spacer 2.3|3635095|27|CP020383|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggagc	Protospacer
 ** **************.****** *

13. spacer 2.3|3635095|27|CP020383|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aaccggtgctactggtgctactggatc	Protospacer
 ** **************.******.*

14. spacer 2.3|3635095|27|CP020383|CRT matches to MN694665 (Marine virus AFVG_250M495, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgctactggttcaactggagc	Protospacer
 *************** * ****** *

15. spacer 2.5|3635194|27|CP020383|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
gacgggtgctactggtgccaccggcgc	Protospacer
 ********************.**  *

16. spacer 2.5|3635194|27|CP020383|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
gacgggtgctactggtgccaccggcgc	Protospacer
 ********************.**  *

17. spacer 2.5|3635194|27|CP020383|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggagc	Protospacer
 ** **************.****** *

18. spacer 2.5|3635194|27|CP020383|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggagc	Protospacer
 ** **************.****** *

19. spacer 2.5|3635194|27|CP020383|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aaccggtgctactggtgctactggatc	Protospacer
 ** **************.******.*

20. spacer 2.5|3635194|27|CP020383|CRT matches to MN694665 (Marine virus AFVG_250M495, complete genome) position: , mismatch: 4, identity: 0.852

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgctactggttcaactggagc	Protospacer
 *************** * ****** *

21. spacer 2.3|3635095|27|CP020383|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

22. spacer 2.3|3635095|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
attgggagctactggtgctactggacc	Protospacer
  .*** ***********.********

23. spacer 2.3|3635095|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tgcgggtgctactggggctactggagc	Protospacer
..************* **.****** *

24. spacer 2.3|3635095|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

25. spacer 2.3|3635095|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
attgggagctactggtgctactggacc	Protospacer
  .*** ***********.********

26. spacer 2.3|3635095|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tgcgggtgctactggggctactggagc	Protospacer
..************* **.****** *

27. spacer 2.3|3635095|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

28. spacer 2.3|3635095|27|CP020383|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgccactggtgccacgggcgc	Protospacer
 ********.*********** **  *

29. spacer 2.3|3635095|27|CP020383|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
taccggtgctacgggtgccactggcgc	Protospacer
.** ******** ***********  *

30. spacer 2.3|3635095|27|CP020383|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgctactgggtc	Protospacer
.** **************.*****..*

31. spacer 2.3|3635095|27|CP020383|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgctactggttc	Protospacer
.** **************.***** .*

32. spacer 2.3|3635095|27|CP020383|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
taaaggtgatactggagccactggacc	Protospacer
.* .**** ****** ***********

33. spacer 2.3|3635095|27|CP020383|CRT matches to MH616795 (Microviridae sp. isolate ctbh757, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggcac	Protospacer
 ** **************.*****  *

34. spacer 2.5|3635194|27|CP020383|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

35. spacer 2.5|3635194|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
attgggagctactggtgctactggacc	Protospacer
  .*** ***********.********

36. spacer 2.5|3635194|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tgcgggtgctactggggctactggagc	Protospacer
..************* **.****** *

37. spacer 2.5|3635194|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

38. spacer 2.5|3635194|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
attgggagctactggtgctactggacc	Protospacer
  .*** ***********.********

39. spacer 2.5|3635194|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tgcgggtgctactggggctactggagc	Protospacer
..************* **.****** *

40. spacer 2.5|3635194|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
gtctggtgctactggagccactggtcc	Protospacer
  * *********** ******** **

41. spacer 2.5|3635194|27|CP020383|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgccactggtgccacgggcgc	Protospacer
 ********.*********** **  *

42. spacer 2.5|3635194|27|CP020383|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
taccggtgctacgggtgccactggcgc	Protospacer
.** ******** ***********  *

43. spacer 2.5|3635194|27|CP020383|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgctactgggtc	Protospacer
.** **************.*****..*

44. spacer 2.5|3635194|27|CP020383|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
tactggtgctactggtgctactggttc	Protospacer
.** **************.***** .*

45. spacer 2.5|3635194|27|CP020383|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
taaaggtgatactggagccactggacc	Protospacer
.* .**** ****** ***********

46. spacer 2.5|3635194|27|CP020383|CRT matches to MH616795 (Microviridae sp. isolate ctbh757, complete genome) position: , mismatch: 5, identity: 0.815

cacgggtgctactggtgccactggacc	CRISPR spacer
aactggtgctactggtgctactggcac	Protospacer
 ** **************.*****  *

47. spacer 2.3|3635095|27|CP020383|CRT matches to MN693921 (Marine virus AFVG_250M344, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccaagcttca	Protospacer
********************     *

48. spacer 2.3|3635095|27|CP020383|CRT matches to MN694446 (Marine virus AFVG_250M343, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccaagcttca	Protospacer
********************     *

49. spacer 2.3|3635095|27|CP020383|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgctactggcgctactggcgt	Protospacer
 **************.**.*****  .

50. spacer 2.3|3635095|27|CP020383|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
tggaggtgctaccggtgctactggacc	Protospacer
.. .********.*****.********

51. spacer 2.3|3635095|27|CP020383|CRT matches to MK613348 (Roseobacter phage CRP-6, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
tacgggtgctactggcgcaactggcgg	Protospacer
.**************.** *****

52. spacer 2.5|3635194|27|CP020383|CRT matches to MN693921 (Marine virus AFVG_250M344, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccaagcttca	Protospacer
********************     *

53. spacer 2.5|3635194|27|CP020383|CRT matches to MN694446 (Marine virus AFVG_250M343, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
cacgggtgctactggtgccaagcttca	Protospacer
********************     *

54. spacer 2.5|3635194|27|CP020383|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
aacgggtgctactggcgctactggcgt	Protospacer
 **************.**.*****  .

55. spacer 2.5|3635194|27|CP020383|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
tggaggtgctaccggtgctactggacc	Protospacer
.. .********.*****.********

56. spacer 2.5|3635194|27|CP020383|CRT matches to MK613348 (Roseobacter phage CRP-6, complete genome) position: , mismatch: 6, identity: 0.778

cacgggtgctactggtgccactggacc	CRISPR spacer
tacgggtgctactggcgcaactggcgg	Protospacer
.**************.** *****

57. spacer 2.3|3635095|27|CP020383|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

58. spacer 2.3|3635095|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

59. spacer 2.3|3635095|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

60. spacer 2.3|3635095|27|CP020383|CRT matches to MT711887 (Pseudomonas phage Stalingrad, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
tccgggtgctactggtgccactctggt	Protospacer
. ********************  . .

61. spacer 2.5|3635194|27|CP020383|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

62. spacer 2.5|3635194|27|CP020383|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

63. spacer 2.5|3635194|27|CP020383|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
aggtggtgctactggtgctactggatt	Protospacer
 .  **************.******..

64. spacer 2.5|3635194|27|CP020383|CRT matches to MT711887 (Pseudomonas phage Stalingrad, complete genome) position: , mismatch: 7, identity: 0.741

cacgggtgctactggtgccactggacc	CRISPR spacer
tccgggtgctactggtgccactctggt	Protospacer
. ********************  . .

65. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggacctactggacc	Protospacer
*.    .*.*****.******************

66. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggacctactggacc	Protospacer
*.    .*.*****.******************

67. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggacctactggacc	Protospacer
*.    .*.*****.******************

68. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggacctactggacc	Protospacer
*.    .*.*****.******************

69. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

70. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

71. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggagctactggacc	Protospacer
*.  * .*.*****.******* **********

72. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

73. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

74. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

75. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

76. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

77. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

78. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggagctactggacc	Protospacer
*.  * .*.*****.******* **********

79. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

80. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

81. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

82. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

83. spacer 2.10|3635455|33|CP020383|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.758

tactggcataggagttactggacctactggacc	CRISPR spacer
tggagctacaggagctactggatctactggacc	Protospacer
*.  * .*.*****.*******.**********

84. spacer 3.1|5143407|31|CP020383|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

85. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggatctactggacc	Protospacer
*.    .*.*****.*******.**********

86. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggagctacaggagctactggagctactggacc	Protospacer
 .  * .*.*****.******* **********

87. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggagctacaggagctactggatctactggacc	Protospacer
 .  * .*.*****.*******.**********

88. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
tggacctacaggagctactggatctactggacc	Protospacer
*.    .*.*****.*******.**********

89. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggagctacaggagctactggagctactggacc	Protospacer
 .  * .*.*****.******* **********

90. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggagctacaggagctactggatctactggacc	Protospacer
 .  * .*.*****.*******.**********

91. spacer 2.10|3635455|33|CP020383|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggacctactggacc	Protospacer
 .    .*.*****.******************

92. spacer 2.10|3635455|33|CP020383|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
tggatctacaggagctactggagctactggacc	Protospacer
*.    .*.*****.******* **********

93. spacer 2.10|3635455|33|CP020383|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 9, identity: 0.727

tactggcataggagttactggacctactggacc	CRISPR spacer
aggagctacaggagctactggagctactggacc	Protospacer
 .  * .*.*****.******* **********

94. spacer 2.10|3635455|33|CP020383|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 9, identity: 0.727

tactggca----taggagttactggacctactggacc	CRISPR spacer
----aggaccttcaggtggtactggacctactggacc	Protospacer
    .* *    .*** * ******************

95. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

96. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

97. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

98. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

99. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

100. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

101. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

102. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

103. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

104. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

105. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

106. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

107. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

108. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

109. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

110. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

111. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

112. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

113. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

114. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

115. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

116. spacer 2.10|3635455|33|CP020383|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

tactggcataggagttactggacctactggacc	CRISPR spacer
aggatctacaggagctactggatctactggacc	Protospacer
 .    .*.*****.*******.**********

117. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

118. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

119. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

120. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

121. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

122. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

123. spacer 3.2|5143461|34|CP020383|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

258300 : 266248

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR30149.1\|258300_258585_+	Heat shock protein 60 family co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
AVR30150.1\|258623_260258_+	Heat shock protein 60 family chaperone GroEL	A0A219YK78	uncultured_virus	1.5e-157	58.0
AVR30151.1\|260664_262203_+	GMP synthase [glutamine-hydrolyzing], amidotransferase subunit/ATP pyrophosphatase subunit	A0A1V0SH76	Hokovirus	8.8e-22	31.7
AVR30152.1\|262587_263913_+	Hypoxanthine/guanine permease PbuG	A0A0R6PHV4	Moraxella_phage	6.4e-45	30.1
AVR30153.1\|264057_264759_+	Phosphate regulon transcriptional regulatory protein PhoB, SphR	W8CYM9	Bacillus_phage	7.3e-40	36.9
AVR30154.1\|264838_266248_+	sensor histidine kinase	W8CYF6	Bacillus_phage	5.1e-32	30.3

DBSCAN-SWA_2

311817 : 320193

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR30175.1\|311817_313125_+	Adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
AVR30176.1\|313213_313933_+	Phosphoribosylaminoimidazole-succinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
AVR30177.1\|313925_314180_+	Phosphoribosylformylglycinamidine synthase, PurS subunit	NA	NA	NA	NA
AVR30178.1\|314176_314860_+	Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit	NA	NA	NA	NA
AVR30179.1\|314843_317063_+	Phosphoribosylformylglycinamidine synthase, synthetase subunit	A6N228	Microbacterium_phage	2.6e-163	41.2
AVR30180.1\|317047_318463_+	Amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.6e-54	35.2
AVR30181.1\|318568_319609_+	Phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
AVR30182.1\|319605_320193_+	Phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_3

1086114 : 1111012

uncultured_Caudovirales_phage(40.0%)

coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR30940.1\|1086114_1086963_+\|protease	CAAX amino terminal protease family protein	NA	NA	NA	NA
AVR30941.1\|1086964_1087321_+	hypothetical protein	NA	NA	NA	NA
AVR30942.1\|1087460_1087652_+	hypothetical protein	NA	NA	NA	NA
AVR30943.1\|1087880_1089149_+	peptidase, M48 family	NA	NA	NA	NA
AVR30944.1\|1089285_1091013_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-11	47.0
AVR30945.1\|1091046_1091193_-	hypothetical protein	NA	NA	NA	NA
AVR30946.1\|1091451_1092108_+	S-layer protein, putative	A0A0E3DEP6	Bacillus_phage	4.8e-09	23.9
AVR30947.1\|1092350_1093013_+	S-layer protein, putative	NA	NA	NA	NA
AVR30948.1\|1093232_1094822_+	Malate synthase	NA	NA	NA	NA
AVR30949.1\|1094845_1096123_+	Isocitrate lyase	NA	NA	NA	NA
AVR30950.1\|1096232_1097024_-	trifolitoxin immunity domain protein	NA	NA	NA	NA
AVR30951.1\|1097043_1097538_-	hypothetical protein	NA	NA	NA	NA
AVR30952.1\|1097821_1098025_+	Cold shock protein CspA	A0A1W6JNX5	Morganella_phage	1.6e-16	63.6
AVR30953.1\|1098222_1098426_-	hypothetical protein	NA	NA	NA	NA
AVR30954.1\|1098783_1098957_-	hypothetical protein	NA	NA	NA	NA
AVR30955.1\|1099132_1099252_+	hypothetical protein	NA	NA	NA	NA
AVR30956.1\|1099241_1099823_+	Competence transcription factor	NA	NA	NA	NA
AVR30957.1\|1100257_1100851_+	Alkaline phosphatase like protein	NA	NA	NA	NA
AVR30958.1\|1100907_1101471_+	Signal peptidase I	NA	NA	NA	NA
AVR30959.1\|1101587_1105103_+	ATP-dependent nuclease, subunit B	NA	NA	NA	NA
AVR30960.1\|1105099_1108825_+	ATP-dependent nuclease, subunit A	G3MA40	Bacillus_virus	5.8e-19	25.1
AVR30961.1\|1108837_1109125_+	hypothetical protein	NA	NA	NA	NA
AVR30962.1\|1109262_1109478_-\|coat	Protein GerPF, spore coat assembly, mutations lead to super-dormant spore	A0A2H4J3A3	uncultured_Caudovirales_phage	3.4e-25	80.9
AVR30963.1\|1109520_1109907_-\|coat	Protein GerPE, spore coat assembly, mutations lead to super-dormant spore	NA	NA	NA	NA
AVR30964.1\|1109922_1110117_-\|coat	Protein GerPD, spore coat assembly, mutations lead to super-dormant spore	NA	NA	NA	NA
AVR30965.1\|1110123_1110738_-\|coat	Protein GerPC, spore coat assembly, mutations lead to super-dormant spore	NA	NA	NA	NA
AVR30966.1\|1110805_1111012_-\|coat	Protein GerPB, spore coat assembly, mutations lead to super-dormant spore	NA	NA	NA	NA

DBSCAN-SWA_4

1841275 : 1849390

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR31742.1\|1841275_1842583_+	NLP/P60 family protein	A0A1V0DZX6	Clostridioides_phage	7.5e-14	31.9
AVR31743.1\|1842682_1843447_-	hydrolase, alpha/beta fold family	NA	NA	NA	NA
AVR31744.1\|1843687_1845448_+	Lipid A export ATP-binding/permease protein MsbA	W8CYL7	Bacillus_phage	9.1e-273	98.0
AVR31745.1\|1845524_1846211_+	Two-component system response regulator QseB	W8CYM9	Bacillus_phage	4.7e-124	98.7
AVR31746.1\|1846207_1847281_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.4e-186	97.8
AVR31747.1\|1847508_1848228_+	3-oxoacyl-[acyl-carrier protein] reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
AVR31748.1\|1848517_1849390_+	Aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	2.8e-65	44.4

DBSCAN-SWA_5

3051538 : 3060428

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR32960.1\|3051538_3052300_-	ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-35	40.5
AVR32961.1\|3052548_3053301_-	Sensory transduction protein kinase	W8CYF6	Bacillus_phage	3.8e-18	31.2
AVR32962.1\|3053620_3054307_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.2e-41	40.4
AVR32963.1\|3054498_3055449_-	Beta-lactamase class A	A0A1B0VBP7	Salmonella_phage	1.6e-53	43.6
AVR32964.1\|3055550_3055670_-	hypothetical protein	NA	NA	NA	NA
AVR32965.1\|3055731_3056262_+	Mobile element protein	NA	NA	NA	NA
AVR32966.1\|3056258_3057101_+	Mobile element protein	A0A1B1P773	Bacillus_phage	1.4e-93	65.3
AVR32967.1\|3057214_3057643_-	hypothetical protein	NA	NA	NA	NA
AVR32968.1\|3058316_3060428_+	hypothetical protein	A0A291I9M6	Lactobacillus_phage	2.2e-31	28.0

DBSCAN-SWA_6

3548314 : 3588923

Bacillus_phage(34.88%)

portal,lysis,capsid,tail,protease,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR33444.1\|3548314_3548986_+\|protease	SOS-response repressor and protease LexA	A0A1B2APZ1	Phage_Wrath	1.2e-18	62.2
AVR33445.1\|3549076_3549880_-	hypothetical protein	NA	NA	NA	NA
AVR33446.1\|3549880_3550423_-	hypothetical protein	NA	NA	NA	NA
AVR33447.1\|3550415_3550739_-	Transcriptional regulator, PadR family	NA	NA	NA	NA
AVR33448.1\|3551110_3551341_-	hypothetical protein	A0A1B1P7Q9	Bacillus_phage	1.5e-23	73.7
AVR33449.1\|3551402_3552299_-	Phage N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	4.6e-79	52.1
AVR33450.1\|3552571_3553414_-	peptidase, M23/M37 family	A0A218KCJ1	Bacillus_phage	6.1e-33	47.7
AVR33451.1\|3553532_3554522_-	lipoprotein, NLP/P60 family	A0A223LKM8	Bacillus_phage	1.7e-34	43.9
AVR33452.1\|3554757_3555144_-	Phage protein	A0A288WG73	Bacillus_phage	3.4e-47	71.4
AVR33453.1\|3555118_3555256_-	hypothetical protein	NA	NA	NA	NA
AVR33454.1\|3555262_3556129_-	Phage replication protein	A0A2H4J394	uncultured_Caudovirales_phage	1.5e-95	63.0
AVR33455.1\|3556281_3556476_-	hypothetical protein	A0A1C8E9A1	Bacillus_phage	1.7e-15	71.0
AVR33456.1\|3556487_3557246_-	Antirepressor	A0A2H4JBC7	uncultured_Caudovirales_phage	3.2e-97	69.4
AVR33457.1\|3557448_3557661_-	Putative phage-related DNA binding protein	A6M975	Geobacillus_virus	1.6e-11	63.0
AVR33458.1\|3557851_3558523_+\|protease	SOS-response repressor and protease LexA	A0A2H4J441	uncultured_Caudovirales_phage	5.2e-35	41.5
AVR33459.1\|3559442_3560327_+	hypothetical protein	J7KDG8	Streptococcus_phage	2.0e-34	37.5
AVR33460.1\|3560320_3560626_+	hypothetical protein	J7KJ12	Streptococcus_phage	1.5e-13	43.3
AVR33461.1\|3560763_3560976_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	1.8e-18	68.6
AVR33462.1\|3561209_3561362_-	hypothetical protein	NA	NA	NA	NA
AVR33463.1\|3561521_3562190_+	lipoprotein, putative	NA	NA	NA	NA
AVR33464.1\|3562229_3562373_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	5.6e-08	82.9
AVR33465.1\|3562455_3562788_+	hypothetical protein	A0A1B1P7R0	Bacillus_phage	3.1e-25	60.7
AVR33466.1\|3562816_3562909_+	hypothetical protein	A0A0S2MV85	Bacillus_phage	4.9e-05	80.0
AVR33467.1\|3562956_3563202_-	hypothetical protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	2.5e-35	97.5
AVR33468.1\|3563198_3563357_-	hypothetical protein	A0A2H4J839	uncultured_Caudovirales_phage	4.6e-19	98.1
AVR33469.1\|3563461_3563632_-	hypothetical protein	A0A2H4J852	uncultured_Caudovirales_phage	2.4e-13	92.9
AVR33470.1\|3563747_3564680_-	Phage N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	3.3e-157	84.5
AVR33471.1\|3564679_3565105_-\|lysis	Holin, toxin secretion/phage lysis	A0A1B1P787	Bacillus_phage	6.3e-71	98.6
AVR33472.1\|3565144_3572287_-	prophage LambdaBa01, minor structural protein	A0A1Z1LZM3	Bacillus_phage	1.1e-281	31.6
AVR33473.1\|3572283_3573756_-\|tail	Phage tail fiber	D2XPZ5	Bacillus_virus	1.3e-216	71.1
AVR33474.1\|3573797_3575975_-	Phage tape measure	A0A2I7SCT8	Paenibacillus_phage	1.1e-22	69.7
AVR33475.1\|3576126_3576240_-	hypothetical protein	NA	NA	NA	NA
AVR33476.1\|3576239_3576497_-	prophage LambdaBa04, tape measure protein	D2XR26	Bacillus_phage	6.4e-34	84.5
AVR33477.1\|3576749_3577964_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.9e-192	88.8
AVR33478.1\|3577979_3578141_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	2.0e-22	94.3
AVR33479.1\|3578194_3578557_-	Phage protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.2e-47	74.8
AVR33480.1\|3578561_3579155_-\|tail	Phage major tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	1.2e-91	83.6
AVR33481.1\|3579155_3579485_-	Phage protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.4e-46	82.6
AVR33482.1\|3579481_3579838_-	Phage protein	D2XR21	Bacillus_phage	1.2e-30	60.3
AVR33483.1\|3579830_3580130_-	hypothetical protein	R9TPZ2	Paenibacillus_phage	5.7e-10	39.4
AVR33484.1\|3580126_3580399_-	Phage DNA packaging protein	R9TMB7	Paenibacillus_phage	3.2e-20	56.2
AVR33485.1\|3580401_3580692_-	hypothetical protein	A6XMJ7	Bacillus_virus	8.3e-06	36.6
AVR33486.1\|3580728_3581892_-\|capsid	Phage major capsid protein	H7BUQ0	unidentified_phage	2.2e-81	55.1
AVR33487.1\|3581905_3582490_-\|head,protease	Phage head maturation protease	A0A2I7SBY1	Paenibacillus_phage	1.4e-39	50.0
AVR33488.1\|3582455_3583667_-\|portal	Phage portal protein	J9QE83	Clostridium_phage	5.9e-138	59.6
AVR33489.1\|3583682_3585371_-\|terminase	Phage terminase, large subunit	A0A290GJW3	Caldibacillus_phage	7.5e-240	70.8
AVR33490.1\|3585367_3585742_-	Phage protein	R9TQ46	Paenibacillus_phage	2.1e-17	46.7
AVR33491.1\|3585908_3586205_-	Phage protein	R9TNN2	Paenibacillus_phage	1.0e-27	60.4
AVR33492.1\|3586395_3586995_-	hypothetical protein	NA	NA	NA	NA
AVR33493.1\|3587175_3587337_+	hypothetical protein	NA	NA	NA	NA
AVR33494.1\|3587608_3588031_+	Phage protein	A0A1L2JY34	Aeribacillus_phage	4.0e-41	59.1
AVR33495.1\|3588119_3588545_-	hypothetical protein	NA	NA	NA	NA
AVR33496.1\|3588644_3588923_-	hypothetical protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	9.0e-10	43.8

DBSCAN-SWA_7

3597750 : 3616816

Bacillus_phage(61.54%)

lysis,integrase

attL 3595758:3595773|attR 3615105:3615120

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3595758:3595773	attL	NA	NA	NA	NA
AVR33507.1\|3597750_3598002_-	hypothetical protein	A0A290FZJ4	Caldibacillus_phage	2.6e-16	58.8
AVR33508.1\|3597998_3598166_-	hypothetical protein	NA	NA	NA	NA
AVR33509.1\|3598247_3598355_-	hypothetical protein	NA	NA	NA	NA
AVR33510.1\|3598481_3599201_-	hypothetical protein	NA	NA	NA	NA
AVR33511.1\|3599321_3599696_-	group-specific protein	A0A0M4R397	Bacillus_phage	1.0e-40	66.7
AVR33512.1\|3599700_3599988_-	hypothetical protein	A6M999	Geobacillus_virus	1.9e-34	71.3
AVR33513.1\|3600088_3600253_+	hypothetical protein	A0A288WGN0	Bacillus_phage	2.0e-09	55.6
AVR33514.1\|3600393_3601140_-	Thymidylate synthase thyX	A0A2P1JUN2	Bacillus_phage	1.3e-79	63.5
AVR33515.1\|3601178_3601751_-	Dimeric dUTPase	A0A0A7AQI4	Bacillus_phage	2.9e-79	72.7
AVR33516.1\|3601750_3601849_-	hypothetical protein	NA	NA	NA	NA
AVR33517.1\|3601845_3601968_-	hypothetical protein	NA	NA	NA	NA
AVR33518.1\|3601970_3602600_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	2.0e-28	41.4
AVR33519.1\|3602596_3602767_-	hypothetical protein	NA	NA	NA	NA
AVR33520.1\|3602763_3602952_-	hypothetical protein	NA	NA	NA	NA
AVR33521.1\|3602975_3603695_-	DNA replication protein DnaC	U5PWH5	Bacillus_phage	2.0e-32	38.8
AVR33522.1\|3603741_3604506_-	Replication protein O	A0A1W6JNI1	Staphylococcus_phage	4.3e-62	52.1
AVR33523.1\|3604502_3604775_-	hypothetical protein	A0A0M4S680	Bacillus_phage	8.5e-37	79.8
AVR33524.1\|3604788_3605460_-	Phage protein	A0A1B1P7F0	Bacillus_phage	5.2e-27	40.6
AVR33525.1\|3605456_3605939_-	Phage protein	E5DV79	Deep-sea_thermophilic_phage	3.1e-34	48.1
AVR33526.1\|3605953_3606118_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	1.3e-11	64.8
AVR33527.1\|3606189_3606507_-	hypothetical protein	NA	NA	NA	NA
AVR33528.1\|3606496_3606658_-	hypothetical protein	NA	NA	NA	NA
AVR33529.1\|3606657_3606924_-	hypothetical protein	S5MC08	Brevibacillus_phage	6.6e-26	57.0
AVR33530.1\|3607028_3607757_-	Phage antirepressor protein	A0A288WFT2	Bacillus_phage	2.8e-50	49.1
AVR33531.1\|3607753_3607954_-	Phage repressor	A0A0C5AJQ3	Paenibacillus_phage	1.9e-09	50.9
AVR33532.1\|3608229_3608643_+	Phage transcriptional regulator, Cro/CI family	A0A0M4QX29	Bacillus_phage	1.3e-25	47.9
AVR33533.1\|3608665_3609094_+	Phage repressor protein	Q9T201	Bacillus_phage	9.0e-33	52.2
AVR33534.1\|3609110_3609278_+	hypothetical protein	NA	NA	NA	NA
AVR33535.1\|3609319_3610465_+\|integrase	Phage integrase, phage integrase family	A0A0M5M609	Bacillus_phage	7.4e-66	38.0
AVR33536.1\|3611162_3612047_+	hypothetical protein	J7KDG8	Streptococcus_phage	2.0e-34	37.5
AVR33537.1\|3612040_3612346_+	hypothetical protein	J7KJ12	Streptococcus_phage	1.5e-13	43.3
AVR33538.1\|3612464_3612695_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	4.4e-18	68.1
AVR33539.1\|3612928_3613081_-	hypothetical protein	NA	NA	NA	NA
AVR33540.1\|3613240_3613399_+	hypothetical protein	NA	NA	NA	NA
AVR33541.1\|3613452_3613908_+	hypothetical protein	NA	NA	NA	NA
AVR33542.1\|3613958_3614090_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
AVR33543.1\|3614171_3614504_+	hypothetical protein	A0A1B1P7R0	Bacillus_phage	3.1e-25	60.7
AVR33544.1\|3614671_3614917_-	hypothetical protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	2.5e-35	97.5
AVR33545.1\|3614913_3615072_-	hypothetical protein	A0A2H4J839	uncultured_Caudovirales_phage	4.6e-19	98.1
AVR33546.1\|3615175_3615292_-	hypothetical protein	NA	NA	NA	NA
3615105:3615120	attR	NA	NA	NA	NA
AVR33547.1\|3616390_3616816_-\|lysis	Holin, toxin secretion/phage lysis	A0A1B1P787	Bacillus_phage	6.3e-71	98.6

DBSCAN-SWA_8

3697401 : 3752702

Bacillus_phage(43.48%)

portal,capsid,tRNA,tail,terminase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR33630.1\|3697401_3697944_-\|coat	Outer spore coat protein E	NA	NA	NA	NA
AVR33631.1\|3698067_3698499_-	hypothetical protein	NA	NA	NA	NA
AVR33632.1\|3698502_3700032_-\|tRNA	tRNA-i(6)A37 methylthiotransferase	NA	NA	NA	NA
AVR33633.1\|3700225_3700351_-	hypothetical protein	NA	NA	NA	NA
AVR33634.1\|3700462_3701329_-	2-oxoglutarate oxidoreductase, beta subunit	NA	NA	NA	NA
AVR33635.1\|3701315_3703073_-	2-oxoglutarate oxidoreductase, alpha subunit	NA	NA	NA	NA
AVR33636.1\|3703297_3704221_-	Microsomal dipeptidase	NA	NA	NA	NA
AVR33637.1\|3704280_3704541_-\|coat	Stage V sporulation protein, spore core dehydratation and coat assembly, SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
AVR33638.1\|3704690_3705485_-	Phosphoesterase	NA	NA	NA	NA
AVR33639.1\|3705647_3707210_-	Hydrolase, HAD superfamily	NA	NA	NA	NA
AVR33640.1\|3707692_3708724_-	RecA protein	A0A0S2MVG1	Bacillus_phage	1.1e-137	74.0
AVR33641.1\|3708867_3710106_-	Molybdopterin binding motif, CinA N-terminal domain / CinA type S C-terminal domain	NA	NA	NA	NA
AVR33642.1\|3710126_3710705_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AVR33643.1\|3710769_3711681_-	monosaccharide ABC transport system clustered Transcriptional regulator	NA	NA	NA	NA
AVR33644.1\|3711702_3712488_-	ACT domain protein	NA	NA	NA	NA
AVR33645.1\|3712626_3712875_-	hypothetical protein	NA	NA	NA	NA
AVR33646.1\|3712950_3713664_-	3-oxoacyl-[acyl-carrier protein] reductase like protein, monosaccharide transporter clustered	NA	NA	NA	NA
AVR33647.1\|3713764_3715051_-	peptidase, M16 family	A0A2H4UVM3	Bodo_saltans_virus	7.7e-11	28.9
AVR33648.1\|3715051_3716326_-\|protease	Zinc protease	A0A1X9I714	Streptococcus_phage	2.0e-56	30.3
AVR33649.1\|3716535_3717495_-	monosaccharide ABC transport system, permease component 2	NA	NA	NA	NA
AVR33650.1\|3717495_3718554_-	monosaccharide ABC transport system, permease component Iab	NA	NA	NA	NA
AVR33651.1\|3718546_3720079_-	monosaccharide ABC transport system, ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.7e-12	27.8
AVR33652.1\|3720196_3721282_-	monosaccharide ABC transport system, substrate-binding component	NA	NA	NA	NA
AVR33653.1\|3721374_3722061_-	Zn-dependent hydrolase clustered Transcriptional regulator	NA	NA	NA	NA
AVR33654.1\|3722637_3725019_-	Cell division protein FtsK	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
AVR33655.1\|3725231_3725435_-	hypothetical protein	NA	NA	NA	NA
AVR33656.1\|3725431_3726181_-	Translocation-enhancing protein TepA	NA	NA	NA	NA
AVR33657.1\|3726282_3727953_-	Ribonuclease J2, endoribonuclease in RNA processing	NA	NA	NA	NA
AVR33658.1\|3728518_3728662_+	hypothetical protein	NA	NA	NA	NA
AVR33659.1\|3728689_3729568_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AVR33660.1\|3729579_3730812_-	Aspartokinase	NA	NA	NA	NA
AVR33661.1\|3730835_3731882_-	Aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AVR33662.1\|3732032_3732209_-	Dipicolinate synthase subunit B	NA	NA	NA	NA
AVR33663.1\|3732621_3733311_+	hypothetical protein	NA	NA	NA	NA
AVR33664.1\|3733341_3733458_+	hypothetical protein	NA	NA	NA	NA
AVR33665.1\|3733490_3733583_+	hypothetical protein	NA	NA	NA	NA
AVR33666.1\|3733976_3734483_+	hypothetical protein	NA	NA	NA	NA
AVR33667.1\|3734681_3735491_-	Phage lysin, glycosyl hydrolase, family 25	D2XR33	Bacillus_phage	3.8e-133	82.9
AVR33668.1\|3735490_3735718_-	hypothetical protein	A0A2H4JGN9	uncultured_Caudovirales_phage	2.0e-23	98.6
AVR33669.1\|3735757_3736126_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	3.8e-32	60.7
AVR33670.1\|3736137_3740781_-	prophage LambdaBa01, minor structural protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	47.8
AVR33671.1\|3740777_3742235_-\|tail	Phage tail fiber	A0A0A7AQV1	Bacillus_phage	4.9e-171	59.3
AVR33672.1\|3742276_3744691_-	hypothetical protein	A0A2H4JC82	uncultured_Caudovirales_phage	2.2e-123	79.4
AVR33673.1\|3744944_3746156_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.8e-187	85.9
AVR33674.1\|3746171_3746333_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	4.3e-20	86.8
AVR33675.1\|3746386_3746749_-	Phage protein	A0A2H4JAG8	uncultured_Caudovirales_phage	3.7e-56	89.2
AVR33676.1\|3746753_3747881_-\|capsid	Phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	6.5e-139	95.1
AVR33677.1\|3747900_3748677_-\|protease	Prophage Clp protease-like protein	A0A0A7RWX3	Clostridium_phage	1.9e-57	57.7
AVR33678.1\|3748660_3749767_-\|portal	Phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	8.2e-187	90.4
AVR33679.1\|3749832_3751491_-\|terminase	Phage terminase, large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	6.6e-257	79.2
AVR33680.1\|3751487_3751823_-	Terminase small subunit, Bacteriophage A118	A0A1B1P762	Bacillus_phage	2.3e-07	31.2
AVR33681.1\|3751976_3752312_-	HNH endonuclease	D2XR61	Bacillus_phage	9.4e-54	91.9
AVR33682.1\|3752304_3752478_-	hypothetical protein	A0A1B1P8J7	Bacillus_phage	1.2e-20	82.5
AVR33683.1\|3752483_3752702_-	Phage protein	D2XR60	Bacillus_phage	6.2e-22	76.4

DBSCAN-SWA_9

3756542 : 3772102

Bacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR33687.1\|3756542_3757085_-	Mobile element protein	W8CYP1	Bacillus_phage	3.6e-87	90.0
AVR33688.1\|3757084_3757567_-	Phage-related protein	H0USV3	Bacillus_phage	2.5e-71	83.1
AVR33689.1\|3757594_3757744_-	Phage protein	A0A1B0T6D0	Bacillus_phage	1.6e-05	71.4
AVR33690.1\|3757889_3758087_-	hypothetical protein	NA	NA	NA	NA
AVR33691.1\|3758208_3758451_-	hypothetical protein	NA	NA	NA	NA
AVR33692.1\|3758882_3759026_+	hypothetical protein	NA	NA	NA	NA
AVR33693.1\|3759737_3759917_-	hypothetical protein	A0A288WFR3	Bacillus_phage	4.1e-24	84.7
AVR33694.1\|3760279_3760417_-	Phage protein	NA	NA	NA	NA
AVR33695.1\|3760851_3761490_-	hypothetical protein	A0A1X9SFR2	Bacillus_phage	2.4e-50	47.2
AVR33696.1\|3761529_3762009_-	phage protein	O64162	Bacillus_phage	2.7e-46	58.0
AVR33697.1\|3762046_3762238_-	phage-like protein	D2XR48	Bacillus_phage	2.9e-15	66.7
AVR33698.1\|3762310_3762673_-	hypothetical protein	D2XR47	Bacillus_phage	1.1e-55	90.0
AVR33699.1\|3762657_3762837_-	hypothetical protein	D2XR45	Bacillus_phage	9.2e-16	87.0
AVR33700.1\|3762839_3764150_-	Replicative DNA helicase	D2XR44	Bacillus_phage	1.6e-234	95.4
AVR33701.1\|3764158_3765109_-	Phage replication protein	D2XR43	Bacillus_phage	3.6e-74	60.1
AVR33702.1\|3765110_3765287_-	hypothetical protein	NA	NA	NA	NA
AVR33703.1\|3765388_3765673_-	hypothetical protein	D2XR42	Bacillus_phage	4.3e-23	54.3
AVR33704.1\|3765862_3766087_+	Phage protein	Q9T1I9	Lactobacillus_phage	4.0e-16	63.2
AVR33705.1\|3766078_3766288_-	hypothetical protein	NA	NA	NA	NA
AVR33706.1\|3766472_3766694_-	hypothetical protein	NA	NA	NA	NA
AVR33707.1\|3766707_3767295_-	hypothetical protein	D2XR41	Bacillus_phage	2.2e-74	69.2
AVR33708.1\|3767385_3767559_-	hypothetical protein	NA	NA	NA	NA
AVR33709.1\|3767686_3767875_-	hypothetical protein	A0A2H4J4N8	uncultured_Caudovirales_phage	1.2e-10	54.2
AVR33710.1\|3768030_3768465_+	hypothetical protein	D2XR39	Bacillus_phage	7.2e-30	53.9
AVR33711.1\|3768477_3768912_+	hypothetical protein	D2XR38	Bacillus_phage	1.3e-60	77.8
AVR33712.1\|3768952_3769588_+	Exonuclease SbcC	NA	NA	NA	NA
AVR33713.1\|3769621_3770353_+	hypothetical protein	NA	NA	NA	NA
AVR33714.1\|3770554_3772102_+	Site-specific recombinase	I3VYZ3	Thermoanaerobacterium_phage	2.7e-143	53.6

DBSCAN-SWA_10

4394316 : 4459874

Anomala_cuprea_entomopoxvirus(14.29%)

coat,lysis,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR34390.1\|4394316_4395150_-\|tRNA	HemX protein, negative effector of steady-state concentration of glutamyl-tRNA reductase	NA	NA	NA	NA
AVR34391.1\|4395167_4396502_-\|tRNA	Glutamyl-tRNA reductase	NA	NA	NA	NA
AVR34392.1\|4396918_4397371_+	Organic hydroperoxide resistance transcriptional regulator	NA	NA	NA	NA
AVR34393.1\|4397373_4397790_+	Organic hydroperoxide resistance protein	NA	NA	NA	NA
AVR34394.1\|4397823_4398420_-	GTP-binding protein EngB	NA	NA	NA	NA
AVR34395.1\|4398416_4400747_-\|protease	ATP-dependent protease La Type I	A0A0R6PGP8	Moraxella_phage	1.2e-176	43.5
AVR34396.1\|4400929_4402600_-\|protease	ATP-dependent protease La LonB Type I	E3T4F6	Cafeteria_roenbergensis_virus	9.6e-14	33.0
AVR34397.1\|4402706_4403966_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-148	66.3
AVR34398.1\|4404230_4405508_-	Cell division trigger factor	NA	NA	NA	NA
AVR34399.1\|4405817_4406816_-	TPR repeat protein	NA	NA	NA	NA
AVR34400.1\|4407013_4407262_-	hypothetical protein	NA	NA	NA	NA
AVR34401.1\|4407288_4407453_+	hypothetical protein	NA	NA	NA	NA
AVR34402.1\|4407548_4407668_-	hypothetical protein	NA	NA	NA	NA
AVR34403.1\|4407781_4408396_+	hypothetical protein	NA	NA	NA	NA
AVR34404.1\|4408480_4408681_-	hypothetical protein	NA	NA	NA	NA
AVR34405.1\|4409346_4409850_-	phosphoesterase	NA	NA	NA	NA
AVR34406.1\|4409863_4410472_-	dHAPTP, dITP, XTP-specific Nucleoside 5-triphosphatase RdgB	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	1.0e-13	33.3
AVR34407.1\|4410483_4411221_-	Ribonuclease PH	NA	NA	NA	NA
AVR34408.1\|4411349_4412399_-\|lysis	Germination (Cortex hydrolysis) and sporulation protein GerM	NA	NA	NA	NA
AVR34409.1\|4412580_4413390_-	Glutamate racemase	NA	NA	NA	NA
AVR34410.1\|4413427_4413544_-	hypothetical protein	NA	NA	NA	NA
AVR34411.1\|4413603_4414929_-	L-Proline/Glycine betaine transporter ProP	NA	NA	NA	NA
AVR34412.1\|4415475_4416159_+	ThiJ/PfpI family protein	NA	NA	NA	NA
AVR34413.1\|4416207_4416846_-	Transcriptional regulator, TetR family	NA	NA	NA	NA
AVR34414.1\|4417167_4417830_-	ThiJ/PfpI family protein	NA	NA	NA	NA
AVR34415.1\|4417936_4418161_-\|coat	Major transcriptional regulator, spore coat formation GerE	A0A290GJH9	Caldibacillus_phage	1.2e-15	78.7
AVR34416.1\|4418326_4419622_-	Xanthine permease	NA	NA	NA	NA
AVR34417.1\|4419596_4419686_-	hypothetical protein	NA	NA	NA	NA
AVR34418.1\|4419719_4420961_-	Cytosine deaminase	NA	NA	NA	NA
AVR34419.1\|4421144_4421330_+	Stress-responsive transcriptional regulator PspC	NA	NA	NA	NA
AVR34420.1\|4421391_4421964_-	HigA protein, antitoxin to HigB	NA	NA	NA	NA
AVR34421.1\|4422064_4423030_+	membrane protein, putative	NA	NA	NA	NA
AVR34422.1\|4423173_4423839_+	Aquaporin Z	NA	NA	NA	NA
AVR34423.1\|4423899_4424331_-	Rrf2 family transcriptional regulator, group III	NA	NA	NA	NA
AVR34424.1\|4424449_4425676_-	membrane protein, putative	NA	NA	NA	NA
AVR34425.1\|4425678_4426563_-	ABC transporter, ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.6e-23	30.0
AVR34426.1\|4426905_4427733_+	Acid phosphatase	NA	NA	NA	NA
AVR34427.1\|4427759_4428548_-	Flagellar motor rotation protein MotB	NA	NA	NA	NA
AVR34428.1\|4428537_4429332_-	Flagellar motor rotation protein MotA	NA	NA	NA	NA
AVR34429.1\|4429598_4430378_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AVR34430.1\|4430414_4430861_-	4-hydroxybenzoyl-CoA thioesterase family active site	NA	NA	NA	NA
AVR34431.1\|4430953_4431715_-	Succinate dehydrogenase iron-sulfur protein	NA	NA	NA	NA
AVR34432.1\|4431707_4433501_-	Succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
AVR34433.1\|4433514_4434141_-	Succinate dehydrogenase cytochrome b558 subunit	NA	NA	NA	NA
AVR34434.1\|4434441_4434891_+	hypothetical protein	NA	NA	NA	NA
AVR34435.1\|4435006_4436791_-	Excinuclease ABC subunit C	NA	NA	NA	NA
AVR34436.1\|4436940_4437255_-	Thioredoxin	A0A1V0SD63	Indivirus	8.7e-09	41.0
AVR34437.1\|4437466_4438444_-	Electron transfer flavoprotein, alpha subunit	NA	NA	NA	NA
AVR34438.1\|4438480_4439254_-	Electron transfer flavoprotein, beta subunit	NA	NA	NA	NA
AVR34439.1\|4439332_4440109_-	Enoyl-CoA hydratase	NA	NA	NA	NA
AVR34440.1\|4440120_4440708_-	Fatty acid degradation regulator YsiA, TetR family	NA	NA	NA	NA
AVR34441.1\|4440814_4442563_-	Acetoacetyl-CoA synthetase / Long-chain-fatty-acid--CoA ligase	Q75ZG1	Hepacivirus	4.3e-57	30.4
AVR34442.1\|4442689_4443817_-	Flagellar hook-length control protein FliK	NA	NA	NA	NA
AVR34443.1\|4444362_4445337_+	Ferrichrome-binding periplasmic protein precursor	NA	NA	NA	NA
AVR34444.1\|4445344_4447381_+	iron compound ABC transporter, permease protein	NA	NA	NA	NA
AVR34445.1\|4447578_4448478_-	hypothetical protein	NA	NA	NA	NA
AVR34446.1\|4448631_4449135_+	DinB family protein	NA	NA	NA	NA
AVR34447.1\|4449271_4449604_+\|coat	spore coat protein C, putative	NA	NA	NA	NA
AVR34448.1\|4449667_4450363_-	Bacitracin transport permease protein BCRB	NA	NA	NA	NA
AVR34449.1\|4450387_4451260_-	hypothetical protein	NA	NA	NA	NA
AVR34450.1\|4451294_4451999_-	Bacitracin transport permease protein BCRB	NA	NA	NA	NA
AVR34451.1\|4452033_4452150_-	hypothetical protein	NA	NA	NA	NA
AVR34452.1\|4452187_4453111_-	bacitracin ABC transporter, ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-46	44.4
AVR34453.1\|4453237_4454173_-	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	5.6e-11	25.9
AVR34454.1\|4454174_4454867_-	DNA-binding response regulator	B5LWA6	Feldmannia_species_virus	8.0e-07	28.8
AVR34455.1\|4455035_4455209_+	hypothetical protein	NA	NA	NA	NA
AVR34456.1\|4455209_4455404_+	hypothetical protein	NA	NA	NA	NA
AVR34457.1\|4455442_4456642_-	50S methyltransferase RlmI	W6LLI2	Streptococcus_phage	1.6e-71	41.2
AVR34458.1\|4456937_4457261_+	Heme-degrading monooxygenase IsdG	NA	NA	NA	NA
AVR34459.1\|4457333_4458098_-	NPQTN specific sortase B	NA	NA	NA	NA
AVR34460.1\|4458130_4458901_-	Heme transporter, ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.8e-14	28.2
AVR34461.1\|4458890_4459874_-	Heme transporter IsdDEF, permease component IsdF	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	27.2

DBSCAN-SWA_11

5283206 : 5334344

Catovirus(15.38%)

holin,lysis,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVR35319.1\|5283206_5283923_-\|lysis	Autolysis response regulater LytR	NA	NA	NA	NA
AVR35321.1\|5284141_5285341_-	Niacin transporter NiaP	NA	NA	NA	NA
AVR35320.1\|5285309_5285450_+	hypothetical protein	NA	NA	NA	NA
AVR35322.1\|5285555_5286296_-	N-acetylmannosaminyltransferase	NA	NA	NA	NA
AVR35323.1\|5286317_5287427_-	Poly(glycerol-phosphate) alpha-glucosyltransferase	NA	NA	NA	NA
AVR35324.1\|5287522_5288995_-	hypothetical protein	NA	NA	NA	NA
AVR35325.1\|5289489_5290122_+	membrane protein, putative	NA	NA	NA	NA
AVR35326.1\|5290369_5291557_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.6e-09	30.2
AVR35327.1\|5291647_5292961_-	membrane protein, putative	NA	NA	NA	NA
AVR35328.1\|5293259_5293772_+	cytosolic long-chain acyl-CoA thioester hydrolase family protein	NA	NA	NA	NA
AVR35329.1\|5293768_5293885_-	hypothetical protein	NA	NA	NA	NA
AVR35330.1\|5293985_5294714_+	glycosyl transferase domain protein	NA	NA	NA	NA
AVR35331.1\|5294720_5295071_+	hypothetical protein	NA	NA	NA	NA
AVR35332.1\|5295425_5296406_+	Beta-1,3-glucosyltransferase	A0A1V0SAH6	Catovirus	1.6e-13	33.3
AVR35333.1\|5296503_5297925_+	Oligosaccharide translocase, flippase	NA	NA	NA	NA
AVR35334.1\|5297917_5298058_+	hypothetical protein	NA	NA	NA	NA
AVR35335.1\|5298234_5300901_+	hypothetical protein	NA	NA	NA	NA
AVR35336.1\|5300998_5301937_+	Glycosyltransferase	A8CG95	Salmonella_phage	2.4e-62	42.0
AVR35337.1\|5302092_5303646_+	ABC transporter ATP-binding protein uup	A0A2K9L0W2	Tupanvirus	6.6e-49	28.9
AVR35338.1\|5303697_5304573_-	RND multidrug efflux transporter coupled TetR family transcriptional regulator	NA	NA	NA	NA
AVR35339.1\|5304713_5307830_+	RND multidrug efflux transporter, Acriflavin resistance protein	S5VTK5	Leptospira_phage	9.1e-74	25.1
AVR35340.1\|5307858_5308824_-	Peptide methionine sulfoxide reductase MsrAB	NA	NA	NA	NA
AVR35341.1\|5308915_5309869_-	membrane protein, putative	NA	NA	NA	NA
AVR35342.1\|5310281_5310974_-	LrgA-associated membrane protein LrgB	NA	NA	NA	NA
AVR35343.1\|5311009_5311441_-\|holin	Antiholin-like protein LrgA	NA	NA	NA	NA
AVR35344.1\|5311573_5312314_-\|lysis	Autolysis response regulater LytR	NA	NA	NA	NA
AVR35345.1\|5312291_5314061_-\|lysis	Autolysis histidine kinase LytS	Q9EYF3	Enterobacteria_phage	1.7e-64	30.6
AVR35346.1\|5314387_5315686_+	Major facilitator superfamily (MFS) transport protein	NA	NA	NA	NA
AVR35347.1\|5315738_5317307_-\|holin	High-affinity choline uptake protein BetT	A0A2I7QNT1	Vibrio_phage	4.3e-16	23.9
AVR35348.1\|5317668_5318739_-	Nitric oxide synthase oxygenase	NA	NA	NA	NA
AVR35349.1\|5318956_5319583_+	Manganese superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.6e-57	53.2
AVR35350.1\|5319671_5320550_-	Isoflavone_redu, Isoflavone reductase	NA	NA	NA	NA
AVR35351.1\|5320658_5321249_-	AmiS_UreI, AmiS/UreI family transporter	NA	NA	NA	NA
AVR35352.1\|5321694_5322711_-	UDP-glucose 4-epimerase	A0A2K9L1R4	Tupanvirus	3.6e-96	51.6
AVR35353.1\|5322895_5323543_-	putative membrane protein hemolysin III like protein	NA	NA	NA	NA
AVR35354.1\|5323707_5324268_+	hypothetical protein	NA	NA	NA	NA
AVR35355.1\|5324308_5325754_-	ATP-dependent RNA helicase YxiN	A0A1V0SBR7	Catovirus	4.5e-60	34.4
AVR35356.1\|5326226_5327213_+	GMP reductase	G3MBI2	Bacillus_virus	3.4e-160	84.7
AVR35357.1\|5327348_5329166_+	Oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	1.3e-120	39.2
AVR35358.1\|5329205_5330084_-	Molybdenum cofactor biosynthesis enzyme, Fe-S oxidoreductase	NA	NA	NA	NA
AVR35359.1\|5330303_5332322_-	sporulation kinase	NA	NA	NA	NA
AVR35360.1\|5332390_5332870_-	50S methyltransferase RlmH	NA	NA	NA	NA
AVR35361.1\|5332929_5333115_-	hypothetical protein	NA	NA	NA	NA
AVR35362.1\|5333168_5334344_-\|protease	Serine protease, DegP/HtrA, do-like	W5SAB9	Pithovirus	1.0e-09	31.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage