CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	0 crisprs	NA	3
CP028538	Enterobacter hormaechei strain SCEH020042 chromosome, complete genome	2 crisprs	RT,cas3,DEDDh,WYL,csa3,DinG,cas14j	6
CP028536	Enterobacter hormaechei strain SCEH020042 plasmid pNDM5_020042, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP028538_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028538_1

1028125-1028255

Orphan

Consensus_repeat	Method
ATATACGGGAAAAACCCGTATGTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP028538_1

>merge|CP028538|1|1028125-1028255|CRISPRCasFinder
ATATACGGGAAAAACCCGTATGTTCAGATGTTGGTTAACTGGATATACAGGAAAAACCCGTATGTCTGCATGATGATATACAGGAAAAACCCGTATGTTTCGGCATGATATACGGGAAAAACCTGTACTAT

>CP028538|1|1|1028125-1028255|CRISPRCasFinder
ATATACGGGAAAAACCCGTATGTT	CAGATGTTGGTTAACTGG
ATATACAGGAAAAACCCGTATGTC	TGCATGATGATATACAGGAAAAACCCGTATGTTTCGGCATG
ATATACGGGAAAAACCTGTACTAT

Protein	Signature genes	Signature genes Name	Protein_function
CP028538.2\|AVZ13205.1\|1036066_1036738_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
CP028538.2\|AVZ13192.1\|1023430_1023970_+\|lysozyme	unknown	unknown	gnl\|CDD\|226295
CP028538.2\|AVZ13200.1\|1032205_1032421_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13198.1\|1030972_1031209_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13189.1\|1021757_1022675_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP028538.2\|AVZ13206.1\|1037031_1038282_-\|integrase	unknown	unknown	gnl\|CDD\|271184
CP028538.2\|AVZ13188.1\|1020291_1021761_-\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13195.1\|1026185_1026557_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13204.1\|1034158_1036024_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378260
CP028538.2\|AVZ13199.1\|1031198_1031549_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13203.1\|1033965_1034166_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13190.1\|1022671_1023034_-\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
CP028538.2\|AVZ13196.1\|1026635_1027253_-\|integrase	unknown	unknown	gnl\|CDD\|271192
CP028538.2\|AVZ13194.1\|1025434_1025713_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13193.1\|1023966_1024329_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13191.1\|1023219_1023450_+\|holin	unknown	unknown	gnl\|CDD\|368216
CP028538.2\|AVZ13202.1\|1032793_1033834_+\|phage-capsid-protein	unknown	unknown	gnl\|CDD\|377147
CP028538.2\|AVZ13201.1\|1032417_1032777_+\|hypothetical-protein	unknown	unknown	unknown
CP028538.2\|AVZ13187.1\|1018262_1020257_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|281845
CP028538.2\|AVZ13197.1\|1029570_1030404_+\|ArsR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236768

Protein	Function_ID	Function_description	E-value
CP028538.2\|AVZ13205.1\|1036066_1036738_-\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	3.63192e-29
CP028538.2\|AVZ13192.1\|1023430_1023970_+\|lysozyme	gnl\|CDD\|226295	COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only].	2.68111e-56
CP028538.2\|AVZ13190.1\|1022671_1023034_-\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	8.47612e-11
CP028538.2\|AVZ13206.1\|1037031_1038282_-\|integrase	gnl\|CDD\|271184	cd01184, INT_C_like_1, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain containing six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	9.14179e-36
CP028538.2\|AVZ13196.1\|1026635_1027253_-\|integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	3.13399e-19
CP028538.2\|AVZ13189.1\|1021757_1022675_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	1.08764e-81
CP028538.2\|AVZ13191.1\|1023219_1023450_+\|holin	gnl\|CDD\|368216	pfam04971, Phage_holin_2_1, Bacteriophage P21 holin S. Phage_holin_2_1 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Members of this family fall into the holin superfamily II, and Phage 21 S holin is the prototype for this superfamily. It has two transmembrane segments with both the N- and C-termini on the cytoplasmic side of the inner membrane in E. coli. Holins are a diverse family of proteins that cause bacterial membrane lysis during late-protein synthesis. It is thought that the temporal precision of holin-mediated lysis may occur through the build up of a holin oligomer which causes the lysis.	6.87301e-29
CP028538.2\|AVZ13202.1\|1032793_1033834_+\|phage-capsid-protein	gnl\|CDD\|377147	pfam03864, Phage_cap_E, Phage major capsid protein E. Major capsid protein E is involved with the stabilisation of the condensed form of the DNA molecule in phage heads.	0.00924117
CP028538.2\|AVZ13187.1\|1018262_1020257_+\|hypothetical-protein	gnl\|CDD\|281845	pfam03906, Phage_T7_tail, Phage T7 tail fibre protein. The bacteriophage T7 tail complex consists of a conical tail-tube surrounded by six kinked tail-fibers, which are oligomers of the viral protein gp17.	1.25972e-12
CP028538.2\|AVZ13197.1\|1029570_1030404_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|236768	PRK10819, PRK10819, transport protein TonB; Provisional.	0.000240718
CP028538.2\|AVZ13204.1\|1034158_1036024_+\|hypothetical-protein	gnl\|CDD\|378260	pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058). This domain, found in various prokaryotic proteins, has no known function.	0.000123017

>CP028538.2|AVZ13196.1|1026635_1027253_-|integrase
MAISKGAKRTDGLESAEQVKIVVEEIAKKSQTVADLFLIGVETQLRGVDMRSWRWDELNIGSKVLRITQDKTKEAVEVELTETAREVLKARYNERGNNVYVFQNDSNRSKGKPISRSKIHAEIQYAVDKLKMRGLLPPDAVIAMHSARKTVATIAHNNNEDLEVISKMLGHRSTEHTRAYLGITQAKVDALRTKYSTGIKRGTHV
>CP028538.2|AVZ13195.1|1026185_1026557_+|hypothetical-protein
MLRVIMLIVSILALPETLGCSFIVFLFVNNWLSKQEAIAIARIIAVEMRSSGYIDSFELRVSRFGAKKFFSMFGEFYLNQFDPDTRERKYQGDVSLQGVGNVYCEFTYDHYKFTKCTLTAGVF
>CP028538.2|AVZ13194.1|1025434_1025713_+|hypothetical-protein
MYQDNTNSRGMVMTNKQLRIHYGFHGKHKEKIIEWDGCDQINTVLSALVEDLNIPTATQTVNLLEHGIDDVFFFDEVSKKWEEIPTKWLARA
>CP028538.2|AVZ13193.1|1023966_1024329_+|hypothetical-protein
MTIKAKLLALAVLLAFFVGTFYVGYLKGWYAHSEHVNSQAKAKQKKAEKAVAIGEQKAAAASAEGKVIYRTIYRDVVKYVNDPNHVKCDFDAHAVQLRQRALDAANSISGFDAGAVQGSE
>CP028538.2|AVZ13192.1|1023430_1023970_+|lysozyme
MASSKTKLSAAVLGLVLAGAPATVILDQFLNEKEGNSLTAYRDGGGIWTICRGATMVDGKPVVQGMKLTQAKCDQVNAIERNKALAWVDRNIKVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRMNAGDRKGACEAIRWWIKDGGRDCRLTKGQKNGCYGQVERRDQESALACWGIDQ
>CP028538.2|AVZ13191.1|1023219_1023450_+|holin
MNNLSDVAAGLSYGTSIGSFGYWLLQLLDKVSPSQWAAIGVLASILFGLLTYLTNLYFKIKDDRRKEARGNGFQQD
>CP028538.2|AVZ13190.1|1022671_1023034_-|GtrA-family-protein
MLKLFSKYLTVGVLNTAIHWFVFAIGVYIFSVNQATANFLAFATAVTFSFFANAAFTFKSKPKVKGYFLFVTFMGLMSVLVGKLSDYYQIAPIITLVEFSLISLICGFFYSKHIVFREEK
>CP028538.2|AVZ13189.1|1021757_1022675_-|glycosyltransferase
MKISLVVPVFNEEDAIPIFYKTVREFEDLQQYEVEIVFINDGSKDATEAIINSIAISDPLVKPLSFTRNFGKEPALFAGLDHATGDAIIPIDVDLQDPIEVIPHLINKWVAGADMVLAKRTDRSTDGRLKRKTAEWFYKLHNKISNPQIEENVGDFRLMSREVVENIKLMPERNLFMKGVLSWVGGSTDVVEYARAERVAGNTKFNGWKLWNLALEGITSFSTFPLRIWTYIGLLVAGLAFLYGTWMIIDTIAFGNPVRGYPSLLVSVLFLGGIQLIGIGVLGEYIGRIYIESKQRPKYLIKGKK
>CP028538.2|AVZ13188.1|1020291_1021761_-|hypothetical-protein
MKFIFCKRHLIYFIALIVLTIFYATLSRNILPSSDAVSVMLEGKDVASGNLGLAGWYLSTVSFYFTEVIWYALATKLTGYSSHQAYIIPALMYSCLVLIAFYLSREKLGSVWALIFSIGIPSAFASLNTLIPVIHIGTYVYTLISYILIEKYTNKKELKYLVAFILLATLTCFSDDISNYILIAPLFLSGLFFCVKNKSLYNLYVVMAVLIAYALAKAMQYYASISGLFILPGIPSPQFIDFDLIGKNLYLFTEGMLRYTGSFFFGKSPSEPEAIKSVILLIVFALFCTHTYKALRISYKISIVDMSLCVACLIMIPAFVLSNRPIDVWSIRYLVPFFIFAPIIIGRAKTTNGLIYYILAVFLVVFLAYGSGFSQRTDHSNDILNKLKTTLRENGLKDGYGSFWFASSLSIDGDLKVAPLDVNRVLNIFACNKWLSKNDWYSTGGNFIIIDDDQMRDIALKEVGNPVKVIKTGDKSIFIYNKNITYSCQ
>CP028538.2|AVZ13187.1|1018262_1020257_+|hypothetical-protein
MSVPNQTPYIIYNANGLTTVFPFEFYIINSGDIQVTINGTVITSGYTVSGVGNIGGGDVIFITPPASGSVVMLERVVPTYRLTDYQDNGDLLADTVNKDFDRLWMAIQRYGIHLGLALRRPLFGGPFDAEGYRIEKLADPVNAQDAVTKKYLESVSLAQVLRVPEASVGLVPSLDLRRNKLLAFNNSGDPIPVLPESGSASDVLIELAKPTGSSLIGYKYPSTGSVSRTVQDKLDDFVFLEDFGGKANDINVDNSLAFIRAFAESPRVRLRTPGVYYMKTRDVVLPANWHVEGSGFNTELKYPGTDTTFTIFTANGTGPEDANQIQGGVFRNIVISADVSLASAFVFRHLKHALWDRCFFYNAGTIMDNFHYIDYIFCQRWGSPFYGAATLNTEKHLSEMPRWLNCFSSSSPIDLIDTTDSVLANSIFYGGEFVVRQRYTAPGLLPGDKTYGFPIHINHCVMDAVRGSALDLDRLAYFTITGNLISAGRDLEKDGVLITNSVSGTFSDNVITYSGAFGLRAANLYQCNFGGNILNGNKTGGMSLSNSKQCTVSGGTMGTSYSYGGYYVQPVGFTDPANNCTDITLMGIQLDDDLSVKISIDTNPASRNRILACRGVPDTFYSGPTSARPSPVGMGFTYFDTTLGLQIQWNATAGKWQRSDGTIV
>CP028538.2|AVZ13197.1|1029570_1030404_+|ArsR-family-transcriptional-regulator
MTDIINSKVFSFTNTEDAFNECTRITNLKTGVTVSLSPTNKQLFVRIRHRFHNFVKKRGGKYYDNIDQLGESVGVKYDAASDGIKKLKAVGLISGTIKGRSYQWESVADLTPEDFLFERDINAMKRKTAPEWVDCLKHPVFGNAKEDVAPEVQEEKQQSVPEADPMCEFDDTPEEEAPAPEKVEPAPKPKPTKKPAARKAPDKQQTLSPFEFKTPRDERFDGITFNRLNDASDRFLVFQDYDLPYLVLFESQGKLTNPKAIEHLKMKRNLFERTGRL
>CP028538.2|AVZ13198.1|1030972_1031209_+|hypothetical-protein
MSPDEMGALQDILNSCPGAFWKPRKIKIFNVDSSNLHKWQILNFSSYEHYCGWLSVNHLNNLTRDFDTLFDTKEHYDS
>CP028538.2|AVZ13199.1|1031198_1031549_+|hypothetical-protein
MTLNTMDTVNIVNIVNTLINSFHDIWHLPALRLVNKAWCERTPSALLEAIQYTEEAITALEHWNAAVEHLVQMNGDTVTVDQAWRIANDMEELALAMEHITVELGELAIQIAEECA
>CP028538.2|AVZ13200.1|1032205_1032421_+|hypothetical-protein
MFLLNNRDRILKYKSEVIQVNPELIAKVAEMAGCTVEEIEKAVEQYFPSEDTPQLSMQERIAIKSKEIKQQ
>CP028538.2|AVZ13201.1|1032417_1032777_+|hypothetical-protein
MIVDLTELFPIRKSFTDVVSYATDSFAVVEGRVFDLPADIQCADVIGADGALYTSGDNAFVVVSDFVSAGDGKTVNVLRAPNVGSFVALKADNLNAANHAAAITTLESKGFVCRPFFTS
>CP028538.2|AVZ13202.1|1032793_1033834_+|phage-capsid-protein
MTKIVIGREMVDLAPIFQALPERNYLMNALDLFDGVGVQNPKVVVTQLLDDNYSLFNTPQSRYSSNHDTTARQNGKEYLVEIPWFAREDTFKPVDVQGKRVQGTDYEQTVTDLYTEYTGKHKIAYLRTRESYLARCLFKGEVYTPATDDLLISYAELFGVVPMTASVSAATAAQDFDAILDKVQAAAGGLAGQIERVIVFAKPAAFSQIRFSDSMSKAFQYVAPYDDRNLFYQRHELLPGVSTFSLPGSPVDFVKVTDTLILAQMPDDADMVAVPVFSKGSGSTNPYQNIYGAASGNFALIDAAPAEYYSWGYLSERGDAYHVMHENSALPVNHALGMQVKITITA
>CP028538.2|AVZ13203.1|1033965_1034166_+|hypothetical-protein
MELILKSNRGLHVRLSADDAEGLLKVSQLCELLEISYTGVRARIFRGETVEAAIHHFLDQKGGGDA
>CP028538.2|AVZ13204.1|1034158_1036024_+|hypothetical-protein
MLDINVASIKTTVSFVVDKQSLAEARKAGDDLKKYFEKIADPKIRFQAQKQRRQKARQQADDARFNDKPRDTKEMKAQRAAEKQKVRDEKANLKAKQQLQKRQEVAELRLRHAGLQISGIKGKYELDPKSQYEALRFIRQQTEEFAKGNLTSDRMNASIRERVTLLRREAAQQAKVTQAQRTQYAAAATKLKAQKGGNAPIVGGGVLGSLALTAGSLGVGQRIVDKGNDNLELVRMSERVKTNPNAIKTMVAWGQQHGVDSANTSKAVDNMKDVRERLAMTVNDAQMKKGEWKGGDGGITSIMNKFGWSKDQISKFQDSPLDFVQATVNEGQRRGMSQAQIGTLIESLGDDLMHYTDMFMNNGAEYNKTLKTLVESGQTLNDEQIRQVSAYGDLSVAMGNLMNGVDNQLFTGWMKGFADGGDDLVRKTKIITEAAGMLGEGLGNLSKEITGFVGEISSVVSDINKGLKERFPVWFAEKDKPAAQALYDGAVTGSANSAADWVQDKTGFDTRSVGHAVKDWLGIDDQPTGTAVEQYSLNGDSLPGGSLRDSAISSLTSTNSAPSYNLAPVFNLNLEASVPLTIASDSSRLADYVDFTAKASQAAFTQSLTLSALSGQSSTGG
>CP028538.2|AVZ13205.1|1036066_1036738_-|EAL-domain-containing-protein
MDTTFIADPIVSIDERLLGVELLTRFIASDGRPLHPEFVISSWDLDRKRLFLYEQCGNIATMQTWFERKNLFCTLNIDQKMAFLIRHDYILRQTFESMPFIKLELSEHFPGLDKGLKSPLLKSLSQGVNGLWLDDLGAGNANVVSLIEGYFEVVKIDRIFFNEQVKKPTFNQLIASIKKHCGKVIIEGIENREHLGILREVGVWGLQGYLFKSVPFKNVDLLL
>CP028538.2|AVZ13206.1|1037031_1038282_-|integrase
MKYKPDQYIISDSYGVYYVRISIPVWLRNAFGGRKTLVRSLKTSDLRVARRKRDVIADEFHHIRQIAEPPKPDSLQDTISYLKSVAKYAKAAPKASAPIIYQCPSLIKMLEIYLMHNADRLKMGTLSKTRKAVELFLNYLRKKDVELNDINRTTVTGWLDHLRETKAVQTVANYLSAMANIFDLASSRYQDAPPLESNVFRGHKLNTAQSRQSYEAFTEEDITKLISAFNKLGEDELRDVTTIAAYSGMRINEIASLKSDNICEVEGVLCFEVTEGKTRNAARLVPLHSAIRTMVLERCQKPHNGFLFYRASVTKREDGKRSSWHVNRFGRLKRDILPGQENKVFHSIRHLVAQTLDRGGVGRDKLTPVPEDRIALLLGHSRGETESFKTYSKNAASPVELQQYIELLRYSKIDNP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028538_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028538_2

1614796-1614909

Orphan

Consensus_repeat	Method
GCCGGGTAAACGCAGTGCCACCCGGCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028538_2

>merge|CP028538|2|1614796-1614909|CRISPRCasFinder
GCCGGGTAAACGCAGTGCCACCCGGCAAAAAGCCCGGTGGCGCTAACGCTTACCGGGCCTACGAAGAGCCAACATGTACAAAGTAGGCCGGGTAAACGCAGTGCCACCCGGCAA

>CP028538|2|2|1614796-1614909|CRISPRCasFinder
GCCGGGTAAACGCAGTGCCACCCGGCAA	AAAGCCCGGTGGCGCTAACGCTTACCGGGCCTACGAAGAGCCAACATGTACAAAGTAG
GCCGGGTAAACGCAGTGCCACCCGGCAA

Protein	Signature genes	Signature genes Name	Protein_function
CP028538.2\|AVZ13721.1\|1606835_1607276_+\|type-III-secretion-system-invasion-protein-IagB	unknown	unknown	gnl\|CDD\|185228
CP028538.2\|AVZ13727.1\|1615910_1617563_-\|hydroxylamine-reductase	unknown	unknown	gnl\|CDD\|235391
CP028538.2\|AVZ13718.1\|1602497_1602983_+\|type-II-secretion-system-protein-M	unknown	unknown	gnl\|CDD\|377391
CP028538.2\|AVZ13722.1\|1607410_1609237_+\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|381595
CP028538.2\|AVZ13734.1\|1626153_1626474_+\|ATP-dependent-Clp-protease-adapter-ClpS	unknown	unknown	gnl\|CDD\|178809
CP028538.2\|AVZ13728.1\|1617707_1618607_-\|lysine-exporter-LysO-family-protein	unknown	unknown	gnl\|CDD\|225287
CP028538.2\|AVZ13731.1\|1622541_1623657_+\|macrolide-transporter-subunit-MacA	unknown	unknown	gnl\|CDD\|183211
CP028538.2\|AVZ13724.1\|1611934_1612936_-\|low-specificity-L-threonine-aldolase	unknown	unknown	gnl\|CDD\|236710
CP028538.2\|AVZ16634.1\|1609381_1610395_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
CP028538.2\|AVZ13717.1\|1601367_1602501_+\|type-II-secretion-system-protein-GspL	unknown	unknown	gnl\|CDD\|273768
CP028538.2\|AVZ13726.1\|1614931_1615900_-\|NADH-oxidoreductase	unknown	unknown	gnl\|CDD\|236735
CP028538.2\|AVZ13725.1\|1612974_1614693_-\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
CP028538.2\|AVZ13723.1\|1610487_1611924_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187556
CP028538.2\|AVZ13719.1\|1602979_1603777_+\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|224900
CP028538.2\|AVZ13732.1\|1623653_1625594_+\|MacB-family-efflux-pump-subunit	unknown	unknown	gnl\|CDD\|182528
CP028538.2\|AVZ13729.1\|1619770_1621429_+\|ATP-dependent-endonuclease	unknown	unknown	gnl\|CDD\|226121
CP028538.2\|AVZ13720.1\|1604030_1606733_+\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|214753
CP028538.2\|AVZ16635.1\|1618783_1619479_-\|aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
CP028538.2\|AVZ13730.1\|1621425_1622382_-\|DUF535-domain-containing-protein	unknown	unknown	gnl\|CDD\|377343
CP028538.2\|AVZ13733.1\|1625664_1625886_-\|cold-shock-like-protein-CspD	unknown	unknown	gnl\|CDD\|184960

Protein	Function_ID	Function_description	E-value
CP028538.2\|AVZ13721.1\|1606835_1607276_+\|type-III-secretion-system-invasion-protein-IagB	gnl\|CDD\|185228	PRK15328, PRK15328, type III secretion system invasion protein IagB.	1.24199e-87
CP028538.2\|AVZ13727.1\|1615910_1617563_-\|hydroxylamine-reductase	gnl\|CDD\|235391	PRK05290, PRK05290, hybrid cluster protein; Provisional.	0
CP028538.2\|AVZ13718.1\|1602497_1602983_+\|type-II-secretion-system-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	1.47125e-27
CP028538.2\|AVZ13722.1\|1607410_1609237_+\|PKD-domain-containing-protein	gnl\|CDD\|381595	cd00325, chitinase_GH19, Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.	4.22012e-72
CP028538.2\|AVZ13734.1\|1626153_1626474_+\|ATP-dependent-Clp-protease-adapter-ClpS	gnl\|CDD\|178809	PRK00033, clpS, ATP-dependent Clp protease adaptor protein ClpS; Reviewed.	9.90991e-48
CP028538.2\|AVZ13728.1\|1617707_1618607_-\|lysine-exporter-LysO-family-protein	gnl\|CDD\|225287	COG2431, COG2431, Predicted membrane protein [Function unknown].	2.90935e-117
CP028538.2\|AVZ13731.1\|1622541_1623657_+\|macrolide-transporter-subunit-MacA	gnl\|CDD\|183211	PRK11578, PRK11578, macrolide transporter subunit MacA; Provisional.	0
CP028538.2\|AVZ13724.1\|1611934_1612936_-\|low-specificity-L-threonine-aldolase	gnl\|CDD\|236710	PRK10534, PRK10534, L-threonine aldolase; Provisional.	0
CP028538.2\|AVZ16634.1\|1609381_1610395_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	1.04343e-52
CP028538.2\|AVZ13717.1\|1601367_1602501_+\|type-II-secretion-system-protein-GspL	gnl\|CDD\|273768	TIGR01709, Type_II_secretion_system_protein_L, type II secretion system protein L. This model represents GspL, protein L of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	2.52707e-40
CP028538.2\|AVZ13726.1\|1614931_1615900_-\|NADH-oxidoreductase	gnl\|CDD\|236735	PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional.	0
CP028538.2\|AVZ13725.1\|1612974_1614693_-\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
CP028538.2\|AVZ13723.1\|1610487_1611924_-\|SDR-family-oxidoreductase	gnl\|CDD\|187556	cd05245, SDR_a2, atypical (a) SDRs, subgroup 2. This subgroup contains atypical SDRs, one member is identified as Escherichia coli protein ybjT, function unknown. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that generally matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.0648e-140
CP028538.2\|AVZ13719.1\|1602979_1603777_+\|prepilin-peptidase	gnl\|CDD\|224900	COG1989, PulO, Type II secretory pathway, prepilin signal peptidase PulO and related peptidases [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	1.98468e-41
CP028538.2\|AVZ13732.1\|1623653_1625594_+\|MacB-family-efflux-pump-subunit	gnl\|CDD\|182528	PRK10535, PRK10535, macrolide ABC transporter ATP-binding protein/permease MacB.	0
CP028538.2\|AVZ13729.1\|1619770_1621429_+\|ATP-dependent-endonuclease	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	0
CP028538.2\|AVZ13720.1\|1604030_1606733_+\|glycoside-hydrolase	gnl\|CDD\|214753	smart00636, Glyco_18, Glyco_18 domain.	7.43979e-123
CP028538.2\|AVZ16635.1\|1618783_1619479_-\|aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	1.82782e-146
CP028538.2\|AVZ13730.1\|1621425_1622382_-\|DUF535-domain-containing-protein	gnl\|CDD\|377343	pfam04393, DUF535, Protein of unknown function (DUF535). Family member Shigella flexneri VirK is a virulence protein required for the expression, or correct membrane localization of IcsA (VirG) on the bacterial cell surface,. This family also includes Pasteurella haemolytica lapB, which is thought to be membrane-associated.	6.56154e-124
CP028538.2\|AVZ13733.1\|1625664_1625886_-\|cold-shock-like-protein-CspD	gnl\|CDD\|184960	PRK14998, PRK14998, cold shock-like protein CspD; Provisional.	1.04122e-47

>CP028538.2|AVZ13725.1|1612974_1614693_-|ubiquinone-dependent-pyruvate-dehydrogenase
MKQTVAAYIAKTLEQAGVKRIWGVTGDSLNGLSDSLNKMKTIEWMPTRHEEVAAFAAGAEAQLTGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAILNRGVSVVVLPGDVALKAAPETATTHWYSAPQPTITPADEELKKLAQLLRYSSNIALMCGSGCAGAHKELVEFAAKLKAPVVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLILLGTQFPYRAFYPTDAKIIQIDINPGSIGAHSKVDMALIGDIKSTLAALLPLLEEKTDRKFLDKALSDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFADDDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAKATAPERQVVAMCGDGGFSMLMGDFLSVAQMKLPLKIVVFNNSVLGFVAMEMKAGGYLTDGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFAIDGPVLVDVVVAKEELAIPPQIKLEQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
>CP028538.2|AVZ13724.1|1611934_1612936_-|low-specificity-L-threonine-aldolase
MIDLRSDTVTRPGRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAPDGTLPLDKVAAKIKADDIHFARTKLLSLENTHNGKVLPREYLKAAWDFTRERKLGLHVDGARIFNAVVEYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGSADYIRRANRWRKMTGGGMRQAGILAAAGLYALKNNVSRLKDDHDNAAWMAAQLHEIGADVMRHDTNMLFVRVGNEHAAALGEFMKARGVLINASPVVRLVMHLDVNREQLTEVVKHWQAFLQR
>CP028538.2|AVZ13723.1|1610487_1611924_-|SDR-family-oxidoreductase
MPQRILVLGASGYIGQHLTTALSQQGHQVLAVARNTERLQKLHLPGVTCHNVDLNWPKALPALLEGVDTLYYLVHSMGEGGDFIAHERQVAMNVRDTLLQTPVKQVIFLSSLQAPENEQSDHLRARQLTAETLRSARIPVTELRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTTPIALENLLHYLVALLDHPAAAHRVLEAAGPEVLSYQAQFEHFMRVSGRRRWLVPVPFPTRWISVWFLNVITSVPPTTAKALIQGLKHDLLADDRELRALIPQELIPFDDAVRNTLKEEEKLVNSSDWGYDAQAFARWRPEYGYYPKQAGCTVKTTASLSALWDVVNQIGGKERYFFGNILWQTRGSLDLLVGHRLAKGRPAAPYLNVGDTVDSWKVIIVEPEKQLALLFGMKAPGLGRLCFTLKDKGVHRELDVRAWWHPHGMPGLFYWLLMIPAHLFIFRGMAKRIAQLAEEKRESN
>CP028538.2|AVZ16634.1|1609381_1610395_-|NAD(P)-dependent-oxidoreductase
MKVLVTGATSGLGRNAVEFLRNKGISVRATGRNEAMGKLLQKMGAEFVHADLTELVSSQAKVMLAGIDTLWHCSSFTSPWGTQEAFDLANVRATRRLGEWAVAWGVRNFIHISSPSLYFDYHHHRDIQEDFRPARFACEFARSKAAGEEVIDLLAQSNPHTRFTVLRPQSLFGPHDKVFIPRLAQMMHHYGSVLLPRGGDALVDMTYYENAVHAMWLASQPECDKLVSGRAYNITNGEPCTLRSIVQRLIDELKIDCRIRSVPYPMLDMIARSMERFGSKSAKEPALTHYGVSKLNFDFTLDISRAENELGYKPIISLDEGIVRTAAWLRDHGKLHR
>CP028538.2|AVZ13722.1|1607410_1609237_+|PKD-domain-containing-protein
MNKRTLLSVLVAGACVAPFMAQAASLQATTGEPYTMKASDLAKKEHELTNFPLMASVKETIQTLDNAQVELIEPGRAANPDNVKRVEGIVKASDWEYLFPLRAQAYTYSNFLKAVGKFPALCKTYNDGRDSDAICRKELATMFAHFAQETGGHESWRPEAEWRQALVHVREMGWSEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNYNYGPFSEAMYGDVRTLLDKPELVADTWLNLASAIFFFAYPQPPKPSMLQVIDGTWQPNDHDKANGLVPGFGVTTQIINGGVECGGPTEIAQSQNRIKYYKEFANYLKVPVPANEVLGCANMKQFDEGGAGALKIYWEQDWGWSADTPDGKTYSCQLVGYQTPFSAFKEGDYSKCVQKFYNVNIVNDDGSSVTPDETPVTPTPTPSEDVTPAPTPAPVPDETPVEPVAVNHAPVAQIAGPIGAVEAGAQVSLSAEGSTDADGNKLTYTWRSQDGQTVTGEDKAVVTFKAPESATAQQYEVSLTVSDGELSSTTSYLLNVKAKAATPSGEDTSYPAWSANSKYNAGDIVNNHGKLFQCKPFPYSGWCNSAPTYYEPGAGLAWAEAWTAL
>CP028538.2|AVZ13721.1|1606835_1607276_+|type-III-secretion-system-invasion-protein-IagB
MKKLILLLLIISQGALANCWDKAARYYHVDPYLLYAIANVESGMNPYAVGKNRDGTRDVGLMQINSSHFTALESRGIDEYRLMTEPCTSIMVGASILSGMIRVYGYNWEAVGAYNAGLKKENYPQRMKYAHKVWAKYQQLKLAARD
>CP028538.2|AVZ13720.1|1604030_1606733_+|glycoside-hydrolase
MKFMKPKYLALFIAAATSSAFAAAPGTPSITSGNDKFALVEVDQAAQDYNNLIKVHKEGVDVKVEWNVWSGDAPTSAKVLLDGKTVWTGAGSAAGSATFKVKKGGRYQEQVELCNDSGCTKSASKLIIVADTDGSHLLPLNTPLLENNKAFAQHTDKVVGAYFPEWGVYDRNFSADKIPVANINHLLYGFIPICGGDGINDSAKSSGALESLKRACAGRQDYTVAIHDPWAALQKPQKGVSNWDDPYKGNYGQLMAMKKAHPDLKILPSIGGWTLSDPFYQMDNKVLRDRFVASVKDFLTTWKVFDGVDIDWEFPGGGGENAKLGNPQTDKATYTALMHDLRQMLNELSAETGRTYELTTAIGAGKDKIEDVDYNTTQQYLDHIFLMSYDFYGAWSNTDLGHQTALYGASWKPDTNYTTDNAVKAMLEQGVKPGKIVVGAGMYGRGWTGVHGYTGDNPFTGTATGPIKGTWENGIVDYRQIVNQMLGKPGWEYKYDEAAEAPYVFNKSTGELVTYDNARSVMAKGKYVLNKNLGGLFAWSIESDNGDILNAMNESLLGGSSIPDLPVETNHAPMASAADQNVTGPATVTLDGSASSDQDDDALTYKWTQVSGPSVTIANSTKAKASFSVPAVTSDQNLVFRLTVTDAKGLSNAVDVQVVNKAPKANQAPVINAMEAVTVQSGEAISLHAQASDPDGDALTYSWSVPADMNATGTDSANVRITAPEVHNTSSYTLSVIVTDGKTSVQSDVQVTVEPKPADEVTPPADDVTPPADDVTPPADDVTPPADDTAGSCDAPVDANASKYAAWDASKIYNNGDTVSFDHLVWKAKYWTQGNQPGFGMDAWELVSNVKMNWRSDLVYNGGDTTTYEGNVYRAKWWTRGDNPANSDVWVKEGASTDCK
>CP028538.2|AVZ13719.1|1602979_1603777_+|prepilin-peptidase
MNTFTLMREACPLGFPMMSAILGGIMGSFLGVVAERVPGMVMDEEGSGNLLFPASHCPVCQHTLAAWENIPLLSWLLLRGRCHQCGSAIPLRLFLVELFSALFFGITAWCMPDVQALFSLWLLAAFLLPLAMIDWQHQLLPDCLTQPLLWAGLVLHAIDHTLPLRAALFGAVAGYLSLWLLYWAFRLIAGREGLGYGDFKLLAALGAWCGWQALPSIELAAALSGIVGYFAVNNLNKNNLTISFGPYLAFSGIVVFISQQFAFTF
>CP028538.2|AVZ13718.1|1602497_1602983_+|type-II-secretion-system-protein-M
MKERIAQLKSRYQNYSAREKIILKICAVAIVGAAVYYTGVIPLDNMIQNSKSTLKRQKETLNWMRSEIDKNHLQVQLVKTNNPRTVVENSAHEINLSLTDVRQEGQTLSFVVNRVNVYELKSWLREINQTSGVTLQKINLTPVDHLSDVKAQVQLTWSKSA
>CP028538.2|AVZ13717.1|1601367_1602501_+|type-II-secretion-system-protein-GspL
MKQVLFVRPDSREGGKIMCCESGSERVEVLDSLEMLAEHPLATRVCLLLPASDMIFRHFTLPKKVASQAMAFSWMAEETLIGDVDNLHWTVLYKKGADVDAVAIDADRLRAALTRCHEAGLNVIQALPDAWLLPVAAGGSTLVAQDKGYWLRLSPHVAGEMEGTLLPLLMQKAGDGEVCCYGDAPADVHVDVQHAWQHPLVLIQPQWKTCRVNLLHGEFSLKAGHGQAAKSMKAAMIAAGLLSVGLLLGPRIAMGWMLVQQENRVQQEIVQVYQHHFPSMRQQTNIKYHFGQSLKKQSKGFFLQLEELEKARQSVPAMEIDLLEYDAQQNTLTLSVSAQSQPALQAFVNQTSENFDFTLQPVSTTEPYTAMIAGKHK
>CP028538.2|AVZ13726.1|1614931_1615900_-|NADH-oxidoreductase
MTMPTSQCPWRMQVHHIQQETPDVWTLSLLCHDYYPYRAGQYALVSVRNSADTLRAYTISSTPGVSEYITLTVRRIDDGAGSRWLTRDVKRGDYIWLSDAQGEFTCDDKKEDKFLLLAAGCGVTPIMSMRRWLAKYRPQADVQVIFSVRSPEDVIFAEEWRNYPVTLVAEHNATHGFVAGRLSREMLQSVPDIADRTVMTCGPAPYMEIVEKEVKALGVTRFFKEQFFTPVAAAATSGMKFTKLQPAQTFFGRVGTTLLEALESNNVPVAAACRAGVCGCCKTKVVSGEYTVTSTMTLTDAEIAEGYVLACSCHPQGDLVLA
>CP028538.2|AVZ13727.1|1615910_1617563_-|hydroxylamine-reductase
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIAALQGLSAWAFKAREYGLVDHYVDSFAPRAFFSTLTNVNFDSPRIVGYAREAIALREALKAQCLNADASARVDNPMAELQLVSDDLGELQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNDIYAQYHKIMAWLGTWPSDMNALLECSMEIGQMNFKVMSILDAGETSTYGHPTPTQVNVKATEGKCILISGHDLKDLYNLLKQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVSHLEGDDFGPVIAQAQQMAGFPYSEIPHLITVGFGRETLLGAADSLIDLVSREKLRHIFLIGGCDGARGERNYFTDFATRVPEDCLILTLACGKYRFNKLDFGNIEGLPRLVDAGQCNDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPDLLAILNEKFGLRSVTNVEDDMKQLLSA
>CP028538.2|AVZ13728.1|1617707_1618607_-|lysine-exporter-LysO-family-protein
MFSGLLIILLPLIVGYLIPLRHESALKLINRFLSWIVYVILFFMGISLAFLDNLATNLLSILHYSAVTVVVILLCNIAALFWLERTIPWKNHHHQEKLPSRIAMALESLKLCGVVVLGFLLGLTGWAFLQHATEASEYTLIFLLFLIGIQLRNNGMTLKQIVLNRRGMMVAVIVVASSMAGGVINAFILDLPLKTSLAMASGFGWYSLSGILLTESFGPVIGSAAFFNDLARELIAIMLIPGLVRRSRSTALGLCGATSMDFTLPVLQRSGGLEMVPAAIVHGFILSLLVPILMAFFSA
>CP028538.2|AVZ16635.1|1618783_1619479_-|aquaporin-Z
MFRKLAAECFGTFWLVFGGCGSAVLAAAFPELGIGFVGVALAFGLTVLTMAFAVGHISGGHFNPAVTLGLWAGGRFPAKDIIGYIIAQVIGGIIAAAVLYVIASGKAGFDAAASGFASNGFGEHSPGGYSMLSAIVIEIVLTAGFLLVIHGATDKYAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWLFWVMPIIGGILGGVLYRTLLEKRD
>CP028538.2|AVZ13729.1|1619770_1621429_+|ATP-dependent-endonuclease
MLLERVEIVGFRGINRLSLQLEQNNVLIGENAWGKSSLLDALTLLLSPEENLYHFVHDDFWFPPGDVNGREKHLHIILTFRESEPGRHRVRRFRPMSPCWVPCEDGFQRIFYRLEGEMAQNDGVLTLREFLDEKGNPIPLDNIDELARHLIRLSPVLRLRDARFMRRIRNGTVPNMPEVEVTARELDFLARELVSRPQNLTDGQIRQGLSAMVQLLEHYFSEQGTGQARHRLMRRRSHDEQRSWRYLDIINRMIDRPSGRTHRVILLGLFSTLLQAKGTVRLDRDARPLLLVEDPETRLHPIMLSVAWHLLNLLPLQRVTTTNSGELLSLTPVEYVCRLVRESSRVTAYRLGPGGLNAEDGRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLKPLIKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNNDREEEREHLTTLPAMDMEHFMYRQGFDDVFHRVAMIPVDVPMNMRRVIAKAIHRSSKPDLAIEVATEAGRRGVESVPTLLRKMFSRVLWLARGRAD
>CP028538.2|AVZ13730.1|1621425_1622382_-|DUF535-domain-containing-protein
MSSIVDTPYSTLSQPKSGWQLFKSLASGSLTPGLAWQNPAYRRKFMLRSLATPFTTARLLGNLAKQPRLMQILRVQPGLPCRLHRPWLTVNMGRQNTLDALDNHYQMMSRHLPASLLNGYLSSQGITLVTLTGKEEQQFSVRLSADAFLDKEGEATLTFCDHQNTVLAELTFTLCKYQGNSTLFIGGMQGAKAHVPHEHIQLATKACHGLFPKRLLVEAVMTLAGAFPVEQILAVSNATHIYRSWRYRKKKEGKLLADYDSFWRSLGGQQQENGNFALPLTMPRKPMEEIASKKRSEYRRRYILLDSLHQQVSQATAR
>CP028538.2|AVZ13731.1|1622541_1623657_+|macrolide-transporter-subunit-MacA
MNLKGKRRKLFLLLAVVVLAGGFWLWKVLNAPVPQYQTLIVRPGELQQNVLATGKLDALRKVDVGAQVSGQLKTLSVEIGDKVKKGQLLGVIDPEQAQNQIREVEATLMELRAQRAQAQAERNLAQVTLSRQQALAKTQAISKQDLDTAATELAVKQAQIGTIDAQIKRNQASQDTAKTNLDYTQIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPQTRYEGMLKDILPTPEKVNDAIFYYARFEVPNPQGVLRLDMTAQVHIQLTGVKNVLTVPLSALGESAGDNRYKVKVLRNGETREREVVIGARNDTDVVVVKGLEEGEEVVTSESLPGAAQ
>CP028538.2|AVZ13732.1|1623653_1625594_+|MacB-family-efflux-pump-subunit
MTALLELNDIRRSYPSGDGPVEVLKGISLRVEAGEMVAIVGASGSGKSTLMNILGCLDKPTSGTYRVAGTDVSTLDGDALAKLRREHFGFIFQRYHLLSHLSAAQNVEVPAVYAGVERKKRLERAKALLTRLGLAERVDYQPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILHQLRDQGHTVIIVTHDPQVAAQAERIIEIHDGELVSNPPPRQSRAAAAKEALPAATGWGQFSSGFREALTMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQLVLADIRAIGTNTIDVYPGKDFGDDEPQYQQALKYDDLAAIQKQPWVNSATPAVSQNLRLRYGNIDVAASANGVSGDYFNVYGMTFSEGATFNAEQLAGRAQVVVLDANSRRQLFPNKTNVVGEVILVGNMPATVIGVAEEKQSMFGSSKILRVWLPYTTISGRIMGQSWLNSITVRVKEGYDSGLAEQQLERLLTLRHGKKDFFTWNMDGLLKTAEKTTRTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGAMGIALSMMIAFALQLFLPGWEIGFSPMAILTAFLCSTFTGILFGWLPARNAARLDPVDALARE
>CP028538.2|AVZ13733.1|1625664_1625886_-|cold-shock-like-protein-CspD
MEMGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVRFDVHQGPKGNHASLIVPVEAEAVA
>CP028538.2|AVZ13734.1|1626153_1626474_+|ATP-dependent-Clp-protease-adapter-ClpS
MGKTNDWLDFDQLAEDKVRDALKPPSMYKVMLMNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYRGKAICGIFTAEVAETKVAMVNDYARENEHPLLCTLEKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

985312 : 1027253

uncultured_Caudovirales_phage(30.0%)

integrase,tail,holin

attL 995053:995067|attR 1031950:1031964

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ13155.1\|985312_986416_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-59	39.9
AVZ13156.1\|986427_987681_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.2e-97	46.6
AVZ13157.1\|988021_989194_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	1.6e-111	50.3
AVZ13158.1\|989190_989379_-	AlpA family phage regulatory protein	NA	NA	NA	NA
AVZ13159.1\|989375_990761_-	DEAD/DEAH box helicase	Q3LZN8	Bacteriophage	3.2e-212	74.0
AVZ13160.1\|990911_991214_-	VRR-NUC domain-containing protein	B6SD64	Bacteriophage	8.8e-27	68.2
AVZ13161.1\|991214_991454_-	hypothetical protein	A0A1V0E5L1	Salmonella_phage	1.1e-32	88.3
AVZ13162.1\|991446_991665_-	ANR family transcriptional regulator	NA	NA	NA	NA
AVZ13163.1\|991730_992489_-	DNA-binding protein	NA	NA	NA	NA
AVZ13164.1\|992545_994612_-	DNA polymerase	Q775A3	Bordetella_phage	5.1e-275	68.1
AVZ13165.1\|994689_995238_-	DUF2815 family protein	Q775A5	Bordetella_phage	7.6e-69	67.6
995053:995067	attL	NA	NA	NA	NA
AVZ13166.1\|995252_996554_-	DUF2800 domain-containing protein	B6SCX9	Bacteriophage	1.3e-135	57.1
AVZ13167.1\|996556_997450_-	hypothetical protein	NA	NA	NA	NA
AVZ13168.1\|998133_998763_-	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	1.4e-34	41.7
AVZ13169.1\|998872_999097_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVZ13170.1\|999100_1001269_+	replication protein	B6SCY1	Bacteriophage	6.8e-169	70.9
AVZ13171.1\|1001579_1001855_+	hypothetical protein	NA	NA	NA	NA
AVZ13172.1\|1002132_1002552_+	hypothetical protein	NA	NA	NA	NA
AVZ13173.1\|1002566_1002797_+	hypothetical protein	NA	NA	NA	NA
AVZ13174.1\|1002800_1004426_+\|tail	phage tail protein	A0A2H4J3N6	uncultured_Caudovirales_phage	1.2e-173	58.8
AVZ13175.1\|1004422_1004656_+	hypothetical protein	NA	NA	NA	NA
AVZ13176.1\|1004642_1005479_+	hypothetical protein	A0A2H4JEQ5	uncultured_Caudovirales_phage	4.3e-47	43.1
AVZ13177.1\|1005546_1005963_+	hypothetical protein	R9TRJ4	Aeromonas_phage	6.9e-46	80.9
AVZ13178.1\|1006180_1007092_+	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	9.2e-43	37.6
AVZ13179.1\|1007149_1007713_+	hypothetical protein	A0A2H4JID6	uncultured_Caudovirales_phage	9.6e-51	51.3
AVZ13180.1\|1007714_1009706_+	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	1.6e-188	49.4
AVZ13181.1\|1009707_1010157_+	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	2.0e-22	43.0
AVZ13182.1\|1010159_1010627_+	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	2.1e-06	44.7
AVZ13183.1\|1010629_1013338_+	lytic transglycosylase	G9L6D3	Escherichia_phage	0.0e+00	64.0
AVZ13184.1\|1013337_1016229_+	hypothetical protein	G9L6D4	Escherichia_phage	0.0e+00	75.8
AVZ13185.1\|1016293_1016635_+	hypothetical protein	A0A2H4J7H0	uncultured_Caudovirales_phage	7.4e-22	52.7
AVZ13186.1\|1016631_1018242_+	transcriptional regulator	A0A2H4JCA3	uncultured_Caudovirales_phage	1.4e-224	70.3
AVZ13187.1\|1018262_1020257_+	hypothetical protein	G3M191	Escherichia_virus	1.5e-106	43.6
AVZ13188.1\|1020291_1021761_-	hypothetical protein	NA	NA	NA	NA
AVZ13189.1\|1021757_1022675_-	glycosyltransferase	U5P087	Shigella_phage	6.6e-158	89.5
AVZ13190.1\|1022671_1023034_-	GtrA family protein	U5P0S6	Shigella_phage	5.1e-29	56.7
AVZ13191.1\|1023219_1023450_+\|holin	holin	A5LH82	Enterobacteria_phage	3.5e-23	71.4
AVZ13192.1\|1023430_1023970_+	lysozyme	H6WRZ4	Salmonella_phage	3.3e-93	90.4
AVZ13193.1\|1023966_1024329_+	hypothetical protein	R9TPM9	Aeromonas_phage	3.9e-13	45.3
AVZ13194.1\|1025434_1025713_+	hypothetical protein	NA	NA	NA	NA
AVZ13195.1\|1026185_1026557_+	hypothetical protein	NA	NA	NA	NA
AVZ13196.1\|1026635_1027253_-\|integrase	integrase	A0A1V0E036	Clostridioides_phage	3.9e-05	23.5
1031950:1031964	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2126014 : 2137378

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ14206.1\|2126014_2127478_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	1.9e-45	30.3
AVZ14207.1\|2127522_2127726_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	4.4e-14	56.7
AVZ14208.1\|2128013_2128445_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	1.5e-16	35.2
AVZ14209.1\|2128479_2129166_-	GntR family transcriptional regulator	NA	NA	NA	NA
AVZ14210.1\|2129256_2130003_-	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
AVZ14211.1\|2130146_2132180_+	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	3.8e-20	22.4
AVZ14212.1\|2132793_2133021_-	hypothetical protein	NA	NA	NA	NA
AVZ14213.1\|2133583_2133802_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	8.3e-19	62.7
AVZ14214.1\|2134169_2134859_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.7e-81	60.5
AVZ14215.1\|2135122_2135362_-	DinI family protein	K7PKM2	Enterobacterial_phage	1.5e-32	91.1
AVZ14216.1\|2135688_2136108_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	7.2e-35	56.7
AVZ14217.1\|2136109_2137378_+	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	1.6e-226	90.8

DBSCAN-SWA_3

2432859 : 2492711

Cronobacter_phage(32.14%)

head,coat,lysis,terminase,integrase

attL 2479084:2479098|attR 2503701:2503715

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ14461.1\|2432859_2433531_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.2e-79	59.9
AVZ14462.1\|2433523_2434792_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	5.8e-229	91.5
AVZ14463.1\|2434791_2435109_-	hypothetical protein	K7PGV5	Enterobacterial_phage	7.1e-11	44.0
AVZ14464.1\|2435473_2436598_+	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	4.9e-22	26.5
AVZ14465.1\|2436627_2438877_-	SGNH/GDSL hydrolase family protein	W6PEG9	Cronobacter_phage	4.8e-109	36.5
AVZ14466.1\|2438933_2441414_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	0.0e+00	91.0
AVZ14467.1\|2441400_2441766_-	peptidoglycan endopeptidase	F1C5F2	Cronobacter_phage	5.4e-63	90.8
AVZ14468.1\|2441779_2442250_-	hypothetical protein	F1C5F1	Cronobacter_phage	1.0e-77	92.3
AVZ14469.1\|2442249_2442747_-	hypothetical protein	F1C5F0	Cronobacter_phage	2.8e-86	89.7
AVZ14470.1\|2442746_2446265_-	hypothetical protein	R9TMK1	Aeromonas_phage	9.5e-104	37.2
AVZ14471.1\|2446301_2447045_-	hypothetical protein	G0ZNE7	Cronobacter_phage	2.0e-64	53.1
AVZ14472.1\|2447095_2447851_-	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	2.9e-58	53.0
AVZ14473.1\|2447909_2448293_-	hypothetical protein	F1C5E4	Cronobacter_phage	1.7e-38	57.5
AVZ14474.1\|2448289_2448658_-	HK97 gp10 family phage protein	F1C5E3	Cronobacter_phage	3.0e-45	74.6
AVZ14475.1\|2448660_2449017_-	hypothetical protein	G0ZNE2	Cronobacter_phage	3.6e-27	55.6
AVZ14476.1\|2449016_2449190_-	50S ribosomal protein L13	I6R0P9	Salmonella_phage	1.7e-11	51.9
AVZ14477.1\|2449243_2449792_-	HNH endonuclease	K9L517	Pectobacterium_phage	9.4e-35	42.2
AVZ14478.1\|2449893_2450277_-	hypothetical protein	F1C5E2	Cronobacter_phage	7.5e-47	75.6
AVZ14479.1\|2450353_2450719_-	hypothetical protein	NA	NA	NA	NA
AVZ14480.1\|2450728_2451826_-\|coat	phage coat protein	F1C5E1	Cronobacter_phage	4.5e-161	77.7
AVZ14481.1\|2451836_2452271_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.4e-49	72.2
AVZ14482.1\|2452274_2453660_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	1.8e-151	59.3
AVZ14483.1\|2453729_2454245_-	hypothetical protein	NA	NA	NA	NA
AVZ14484.1\|2454284_2455274_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	3.6e-109	66.1
AVZ14485.1\|2455221_2456673_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	2.5e-196	74.2
AVZ14486.1\|2456684_2458160_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	2.7e-230	77.2
AVZ14487.1\|2458169_2458619_-	DUF2280 domain-containing protein	I6S1P9	Salmonella_phage	1.5e-54	82.9
AVZ14488.1\|2458651_2459290_-	hypothetical protein	I6S676	Salmonella_phage	5.9e-113	91.0
AVZ14489.1\|2459293_2459512_-	hypothetical protein	NA	NA	NA	NA
AVZ14490.1\|2459691_2460237_-	KilA-N domain-containing protein	A0A1V0E5P7	Salmonella_phage	2.5e-56	64.9
AVZ14491.1\|2460588_2461050_-\|lysis	lysis protein	M9NYX9	Enterobacteria_phage	3.1e-55	75.2
AVZ14492.1\|2461046_2461349_-	hypothetical protein	A0A289ZTW9	Serratia_phage	5.0e-14	49.5
AVZ14493.1\|2461345_2461840_-	lysozyme	M9P0E5	Enterobacteria_phage	3.2e-90	98.2
AVZ14494.1\|2461817_2462042_-\|lysis	lysis protein	M9NZI9	Enterobacteria_phage	2.1e-33	95.9
AVZ14495.1\|2462347_2463037_-	antiterminator	I6PDF8	Cronobacter_phage	5.5e-56	51.1
AVZ14496.1\|2463033_2463150_-	hypothetical protein	NA	NA	NA	NA
AVZ14497.1\|2463146_2463506_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	2.6e-65	98.3
AVZ14498.1\|2463502_2463793_-	DUF1364 domain-containing protein	K7PGZ6	Enterobacteria_phage	1.8e-45	91.6
AVZ14499.1\|2463785_2463956_-	NinE family protein	K7P7K0	Enterobacteria_phage	9.0e-21	94.3
AVZ14500.1\|2463955_2464411_-	hypothetical protein	I6PD71	Cronobacter_phage	1.1e-60	67.5
AVZ14501.1\|2465108_2465882_+	hypothetical protein	NA	NA	NA	NA
AVZ14502.1\|2465958_2466258_-	protein ren	M1FPD5	Enterobacteria_phage	7.4e-18	53.7
AVZ16662.1\|2466254_2467034_-	replication protein	A0A193GYX1	Enterobacter_phage	1.4e-95	64.2
AVZ14503.1\|2467030_2467759_-	helix-turn-helix domain-containing protein	H9C164	Pectobacterium_phage	2.5e-35	66.7
AVZ14504.1\|2467892_2468438_-	hypothetical protein	K7P7P2	Enterobacteria_phage	2.6e-93	96.1
AVZ14505.1\|2468468_2468696_-	helix-turn-helix domain-containing protein	Q76H55	Enterobacteria_phage	3.4e-23	70.4
AVZ16663.1\|2468807_2469512_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	1.0e-102	78.6
AVZ14506.1\|2469598_2470033_+	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
AVZ14507.2\|2470497_2470917_+	hypothetical protein	NA	NA	NA	NA
AVZ14508.1\|2470921_2471527_+	hypothetical protein	A0A2C9D0J8	Yersinia_phage	3.2e-28	36.1
AVZ14509.1\|2471848_2472058_+	cell division protein FtsZ	M9NZE2	Enterobacteria_phage	5.7e-33	94.2
AVZ14510.1\|2472128_2473097_+	hypothetical protein	A0A077KCC0	Edwardsiella_phage	1.5e-38	75.4
AVZ14511.1\|2473104_2473389_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.1e-47	93.6
AVZ14512.1\|2473398_2474316_+	recombinase RecT	M9NZA6	Enterobacteria_phage	7.5e-170	99.3
AVZ14513.1\|2474312_2474993_+	exonuclease	M9NZE1	Enterobacteria_phage	2.0e-127	95.1
AVZ14514.1\|2474989_2475418_+	regulator	M9NYX4	Enterobacteria_phage	1.5e-72	95.8
AVZ14515.1\|2475578_2476244_+	DNA methyltransferase	G8C7S6	Escherichia_phage	2.5e-114	93.3
AVZ16664.1\|2476249_2476468_+	hypothetical protein	NA	NA	NA	NA
AVZ14516.1\|2476559_2476775_+	TraR/DksA family transcriptional regulator	A0A0N7C211	Escherichia_phage	2.5e-15	59.4
AVZ14517.1\|2476776_2477415_+	HNH endonuclease	A0A173GC65	Salmonella_phage	3.7e-30	43.2
AVZ14518.1\|2477520_2477769_+	DNA-binding protein	S4TND0	Salmonella_phage	2.6e-16	53.1
AVZ14519.1\|2477800_2479087_+	DUF3596 domain-containing protein	Q6HA01	Enterobacteria_phage	5.5e-134	55.3
2479084:2479098	attL	NA	NA	NA	NA
AVZ14520.1\|2479118_2480543_-	aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
AVZ14521.1\|2480682_2482107_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AVZ14522.1\|2482189_2482378_-	cold-shock protein	NA	NA	NA	NA
AVZ14523.1\|2482771_2484166_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AVZ14524.1\|2484171_2485182_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AVZ14525.1\|2485181_2485310_+	DUF2474 domain-containing protein	NA	NA	NA	NA
AVZ14526.1\|2485434_2485872_+	heat shock protein HslJ	NA	NA	NA	NA
AVZ16665.1\|2485873_2486140_-	DUF333 domain-containing protein	NA	NA	NA	NA
AVZ14527.1\|2486411_2489936_+	pyruvate:ferredoxin (flavodoxin) oxidoreductase	NA	NA	NA	NA
AVZ14528.1\|2490323_2491451_+	porin OmpS2	Q1MVN1	Enterobacteria_phage	5.2e-120	60.3
AVZ14529.1\|2491484_2491907_-	GFA family protein	NA	NA	NA	NA
AVZ14530.1\|2491910_2492108_-	hypothetical protein	NA	NA	NA	NA
AVZ16666.1\|2492414_2492711_+\|integrase	integrase	A0A0U2JGI6	Escherichia_phage	2.3e-19	56.5
2503701:2503715	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2752760 : 2842809

104

Enterobacteria_phage(24.14%)

protease,tRNA,head,tail,capsid,holin,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ14755.1\|2752760_2753642_-\|protease	protease HtpX	NA	NA	NA	NA
AVZ14756.1\|2753835_2755884_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.8e-82	32.6
AVZ14757.1\|2755903_2756590_-	RNA chaperone ProQ	NA	NA	NA	NA
AVZ14758.1\|2756686_2757184_-	GAF domain-containing protein	NA	NA	NA	NA
AVZ16677.1\|2757316_2758600_+	paraquat-inducible protein A	NA	NA	NA	NA
AVZ14759.1\|2758568_2761202_+	PqiB family protein	NA	NA	NA	NA
AVZ16678.2\|2761258_2762722_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
AVZ14760.1\|2762826_2763066_+	DUF1480 family protein	NA	NA	NA	NA
AVZ14761.1\|2763100_2763745_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	1.5e-55	49.8
AVZ14762.1\|2763912_2764893_+	DUF535 domain-containing protein	NA	NA	NA	NA
AVZ14763.1\|2765261_2765600_-	DUF2511 domain-containing protein	NA	NA	NA	NA
AVZ14764.1\|2765616_2766486_-	copper resistance D family protein	NA	NA	NA	NA
AVZ14765.1\|2766487_2766859_-	CopC domain-containing protein YobA	NA	NA	NA	NA
AVZ14766.1\|2766996_2767227_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	7.0e-16	61.8
AVZ14767.1\|2767338_2767977_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AVZ14768.1\|2768001_2768664_+	exodeoxyribonuclease X	NA	NA	NA	NA
AVZ14769.1\|2768645_2770721_-	oligopeptidase B	NA	NA	NA	NA
AVZ14770.1\|2770796_2771447_-	tellurite resistance TerB family protein	NA	NA	NA	NA
AVZ14771.1\|2771619_2772798_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
AVZ14772.1\|2772859_2774278_-	hypothetical protein	NA	NA	NA	NA
AVZ14773.1\|2775702_2776344_-	keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase	NA	NA	NA	NA
AVZ14774.1\|2776383_2778195_-	phosphogluconate dehydratase	NA	NA	NA	NA
AVZ14775.1\|2778429_2779905_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	4.6e-76	36.2
AVZ14776.1\|2780259_2781129_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AVZ14777.1\|2781243_2782686_+	pyruvate kinase	NA	NA	NA	NA
AVZ14778.1\|2782729_2783701_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
AVZ14779.1\|2783820_2785140_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	40.9
AVZ14780.1\|2785155_2786115_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
AVZ14781.1\|2786177_2786933_+	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	6.7e-15	30.2
AVZ14782.1\|2786929_2787715_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
AVZ14783.1\|2787767_2788778_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	3.6e-08	24.5
AVZ14784.1\|2788786_2789401_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AVZ14785.1\|2789481_2790003_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	5.8e-10	34.2
AVZ14786.1\|2790037_2790778_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AVZ14787.1\|2790805_2791249_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
AVZ14788.1\|2791250_2793023_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AVZ14789.1\|2793021_2793213_+	hypothetical protein	NA	NA	NA	NA
AVZ14790.1\|2793286_2793853_+	hydrolase	NA	NA	NA	NA
AVZ14791.1\|2794217_2794484_+	DinI family protein	K7PKR6	Enterobacteria_phage	4.7e-40	94.3
AVZ14792.1\|2794577_2795861_-\|tail	phage tail protein	K7PHF0	Enterobacteria_phage	1.4e-145	63.3
AVZ14793.1\|2795919_2796153_-	cor protein	E4WL42	Enterobacteria_phage	6.6e-30	77.6
AVZ14794.1\|2796260_2796932_-	hypothetical protein	A0A2P0WA07	Enterobacter_phage	1.2e-87	73.5
AVZ14795.1\|2796932_2797247_-	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
AVZ14796.1\|2797289_2800847_-	DUF1983 domain-containing protein	Q9MCU0	Escherichia_phage	0.0e+00	72.0
AVZ14797.1\|2800900_2801485_-\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	1.1e-54	53.1
AVZ14798.1\|2801484_2802195_-	peptidase P60	F1C573	Cronobacter_phage	4.3e-96	69.4
AVZ14799.1\|2802197_2802956_-\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	1.0e-95	64.0
AVZ14800.1\|2802952_2803291_-\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	7.3e-38	59.8
AVZ14801.1\|2803293_2806758_-\|tail	phage tail tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	0.0e+00	93.5
AVZ14802.1\|2807088_2808012_+\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	3.8e-177	99.7
AVZ14803.1\|2808037_2808268_-	cor protein	Q5G8V7	Enterobacteria_phage	8.5e-22	69.6
AVZ14804.1\|2808388_2808667_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	2.8e-43	96.7
AVZ14805.1\|2808675_2809059_-\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	6.7e-64	94.4
AVZ14806.1\|2809067_2809511_-	hypothetical protein	K7PHL2	Enterobacterial_phage	1.6e-72	94.5
AVZ14807.1\|2809570_2809918_-	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	3.8e-58	99.1
AVZ14808.1\|2809914_2810364_-	HK97 gp10 family phage protein	K7P6X4	Enterobacteria_phage	1.9e-73	98.0
AVZ14809.1\|2810360_2810699_-\|head,tail	head-tail adaptor protein	K7P7L2	Enterobacteria_phage	5.4e-57	96.4
AVZ14810.1\|2810698_2811025_-	hypothetical protein	K7PGU9	Enterobacterial_phage	3.4e-56	99.1
AVZ14811.1\|2811058_2812216_-\|capsid	phage major capsid protein	F1C582	Cronobacter_phage	4.5e-212	100.0
AVZ14812.1\|2812218_2812896_-\|head,protease	HK97 family phage prohead protease	F1C583	Cronobacter_phage	3.2e-125	100.0
AVZ14813.1\|2812913_2814188_-\|portal	phage portal protein	F1C584	Cronobacter_phage	1.6e-247	99.3
AVZ14814.1\|2814187_2815702_-\|terminase	terminase large subunit	Q9MCT1	Enterobacteria_phage	8.0e-294	99.6
AVZ14815.1\|2815708_2816194_-\|terminase	terminase	Q77WA1	Escherichia_phage	1.3e-80	98.8
AVZ14816.1\|2816377_2816581_-	hypothetical protein	A0A220NRN5	Escherichia_phage	9.8e-22	76.1
AVZ14817.1\|2816580_2816922_-	HNH endonuclease	K7PM05	Enterobacterial_phage	4.6e-64	99.1
AVZ14818.1\|2816978_2817569_-	hypothetical protein	K7P7D2	Enterobacteria_phage	5.6e-110	94.4
AVZ14819.1\|2817550_2819011_-	glycosyltransferase family 2 protein	A0A220NRM5	Escherichia_phage	5.5e-231	77.2
AVZ14820.1\|2819010_2819571_-	HNH endonuclease	A0A220NRM6	Escherichia_phage	1.4e-97	88.7
AVZ14821.1\|2819690_2820026_-	hypothetical protein	S4TTH3	Salmonella_phage	3.7e-42	73.9
AVZ14822.1\|2820102_2820648_+	hypothetical protein	S4TR57	Salmonella_phage	3.1e-94	96.7
AVZ14823.1\|2821108_2821444_-	hypothetical protein	Q5QF73	Pseudomonas_virus	6.6e-15	55.4
AVZ14824.1\|2821561_2821762_-	hypothetical protein	K7PM01	Enterobacterial_phage	7.9e-16	80.4
AVZ14825.1\|2821712_2821985_-	hypothetical protein	NA	NA	NA	NA
AVZ14826.1\|2821992_2822622_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	6.2e-99	86.6
AVZ14827.1\|2822621_2822900_-\|holin	phage holin family protein	G8C7V9	Escherichia_phage	1.3e-37	85.9
AVZ14828.1\|2822889_2823279_-	hypothetical protein	G8C7V8	Escherichia_phage	8.9e-64	99.2
AVZ14829.1\|2823784_2824012_+	hypothetical protein	NA	NA	NA	NA
AVZ14830.1\|2824058_2824544_-	HNH endonuclease	C4ML56	Xanthomonas_virus	1.5e-23	42.7
AVZ14831.1\|2824839_2825622_-	antitermination protein	F1C595	Cronobacter_phage	1.1e-108	76.0
AVZ14832.1\|2825625_2827497_-	toprim domain-containing protein	Q5G8S8	Enterobacteria_phage	1.1e-223	59.6
AVZ14833.1\|2827604_2828537_-	hypothetical protein	C5IHL2	Burkholderia_virus	1.7e-36	37.8
AVZ14834.1\|2828533_2828731_-	DUF4222 domain-containing protein	NA	NA	NA	NA
AVZ14835.1\|2828732_2828951_-	hypothetical protein	NA	NA	NA	NA
AVZ14836.1\|2829065_2829773_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	2.6e-93	73.4
AVZ14837.1\|2830186_2830387_+	hypothetical protein	NA	NA	NA	NA
AVZ14838.1\|2831001_2831205_+	hypothetical protein	NA	NA	NA	NA
AVZ14839.1\|2831185_2831596_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	9.5e-48	83.5
AVZ14840.1\|2831782_2832289_+	hypothetical protein	F1C5A2	Cronobacter_phage	4.1e-53	54.8
AVZ14841.1\|2832301_2833162_+	ORF6N domain-containing protein	F1C5A3	Cronobacter_phage	1.6e-126	75.9
AVZ14842.1\|2833161_2833413_+	hypothetical protein	NA	NA	NA	NA
AVZ14843.1\|2833414_2833837_+	hypothetical protein	NA	NA	NA	NA
AVZ14844.1\|2833833_2833959_+	sodium:solute symporter	NA	NA	NA	NA
AVZ14845.1\|2833955_2834312_+	hypothetical protein	NA	NA	NA	NA
AVZ14846.1\|2834304_2834637_+	hypothetical protein	NA	NA	NA	NA
AVZ14847.1\|2834699_2834936_+	excisionase	Q8W657	Enterobacteria_phage	1.1e-37	88.5
AVZ14848.1\|2834991_2836305_+	DUF3596 domain-containing protein	Q8W658	Enterobacteria_phage	1.0e-220	85.8
AVZ14849.1\|2836283_2837057_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	2.5e-57	79.5
AVZ14850.1\|2837108_2837504_+	hypothetical protein	NA	NA	NA	NA
AVZ14851.1\|2837544_2838288_+	carboxy-S-adenosyl-L-methionine synthase CmoA	A0A1S6L2V9	Erwinia_phage	6.1e-29	30.2
AVZ14852.1\|2838284_2839256_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AVZ14853.1\|2839152_2839428_-	hypothetical protein	NA	NA	NA	NA
AVZ14854.1\|2839454_2840198_-	copper homeostasis protein CutC	NA	NA	NA	NA
AVZ14855.1\|2840276_2840837_-	VOC family protein	NA	NA	NA	NA
AVZ14856.1\|2841075_2842809_+\|tRNA	arginine--tRNA ligase	A0A1V0SIS8	Klosneuvirus	1.4e-87	37.2

DBSCAN-SWA_5

3519372 : 3602570

Escherichia_phage(21.95%)

tRNA,protease,capsid,holin,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ15434.1\|3519372_3520140_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AVZ15435.1\|3520171_3520711_-	ribosome maturation factor RimM	NA	NA	NA	NA
AVZ15436.1\|3520726_3520975_-	30S ribosomal protein S16	NA	NA	NA	NA
AVZ15437.1\|3521091_3522453_-	signal recognition particle protein	NA	NA	NA	NA
AVZ16701.1\|3522619_3523411_+	inner membrane protein YpjD	NA	NA	NA	NA
AVZ15438.1\|3523430_3524717_+	DUF21 domain-containing protein	NA	NA	NA	NA
AVZ15439.1\|3524769_3525387_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AVZ15440.1\|3525485_3526364_+	NAD(+) kinase	NA	NA	NA	NA
AVZ15441.1\|3526449_3528111_+	DNA repair protein RecN	NA	NA	NA	NA
AVZ15442.1\|3528085_3528268_+	hypothetical protein	NA	NA	NA	NA
AVZ15443.1\|3528249_3528588_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
AVZ15444.1\|3528649_3528937_-	RnfH family protein	NA	NA	NA	NA
AVZ15445.1\|3528926_3529403_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
AVZ15446.1\|3529520_3530003_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8
AVZ15447.1\|3530659_3531901_+	DUF4102 domain-containing protein	A0A1B5FPC6	Escherichia_phage	6.7e-105	48.3
AVZ15448.1\|3531959_3532838_-	hypothetical protein	NA	NA	NA	NA
AVZ15449.1\|3532963_3533176_+	AlpA family transcriptional regulator	NA	NA	NA	NA
AVZ16702.1\|3533340_3534696_+	DUF3987 domain-containing protein	NA	NA	NA	NA
AVZ15450.1\|3534937_3535558_+	inovirus Gp2 family protein	NA	NA	NA	NA
AVZ15451.1\|3536921_3537149_+	hypothetical protein	NA	NA	NA	NA
AVZ16703.1\|3537370_3537652_+	DNA-binding protein	NA	NA	NA	NA
AVZ15452.1\|3537686_3538256_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AVZ15453.1\|3538361_3541211_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	1.5e-128	41.2
AVZ15454.1\|3541210_3541402_+	hypothetical protein	NA	NA	NA	NA
AVZ15455.1\|3541462_3543040_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	4.5e-98	43.8
AVZ15456.1\|3543127_3543586_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AVZ15457.1\|3543608_3544523_+	hypothetical protein	NA	NA	NA	NA
AVZ15458.1\|3544625_3545513_+	hypothetical protein	NA	NA	NA	NA
AVZ15459.1\|3545602_3546214_+	HdeD family acid-resistance protein	NA	NA	NA	NA
AVZ15460.1\|3546293_3547439_+	hypothetical protein	NA	NA	NA	NA
AVZ15461.1\|3547428_3547869_+	thioredoxin TrxC	V5L6J2	Insectomime_virus	2.6e-11	32.4
AVZ15462.1\|3547872_3549588_+	sodium:proton exchanger	NA	NA	NA	NA
AVZ15463.1\|3549584_3550082_+	phosphate-starvation-inducible E family protein	NA	NA	NA	NA
AVZ15464.1\|3551053_3552205_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	9.9e-26	30.3
AVZ15465.1\|3552429_3553410_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	6.1e-93	57.3
AVZ15466.1\|3554366_3555518_-\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	6.4e-41	35.0
AVZ15467.1\|3555474_3555831_-\|transposase	transposase	U5P4I9	Shigella_phage	5.7e-33	91.2
AVZ15468.1\|3556969_3557791_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	2.3e-45	38.7
AVZ15469.1\|3558007_3558709_+	WYL domain-containing protein	NA	NA	NA	NA
AVZ15470.1\|3558749_3558986_+	hypothetical protein	NA	NA	NA	NA
AVZ15471.1\|3558985_3559429_+	hypothetical protein	NA	NA	NA	NA
AVZ15472.1\|3559453_3559921_+	hypothetical protein	NA	NA	NA	NA
AVZ15473.1\|3560222_3561191_-	phage exclusion protein	NA	NA	NA	NA
AVZ15474.1\|3561719_3564029_+	ATPase	NA	NA	NA	NA
AVZ15475.1\|3564032_3565349_+	ATP-binding protein	NA	NA	NA	NA
AVZ15476.1\|3565345_3567541_+	DEAD/DEAH box helicase	NA	NA	NA	NA
AVZ15477.1\|3568394_3568874_+	antirestriction protein	A9J566	Pseudomonas_phage	2.3e-13	29.8
AVZ15478.1\|3568889_3569366_+	DNA repair protein RadC	NA	NA	NA	NA
AVZ15479.1\|3569374_3569596_+	DUF987 domain-containing protein	NA	NA	NA	NA
AVZ15480.1\|3569613_3569931_+	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
AVZ15481.1\|3569951_3570281_+	toxin	NA	NA	NA	NA
AVZ15482.1\|3570965_3571892_-\|transposase	transposase	A0A077SL42	Escherichia_phage	2.9e-68	44.4
AVZ15483.1\|3572041_3573766_-	flagellin	NA	NA	NA	NA
AVZ15484.1\|3577560_3578529_-	hypothetical protein	G1CSU0	Cronobacter_virus	6.5e-55	40.8
AVZ15485.1\|3578532_3580140_-	DUF1983 domain-containing protein	S4TTF5	Salmonella_phage	3.7e-212	68.9
AVZ15486.1\|3580186_3581413_-\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	2.3e-129	87.2
AVZ15487.1\|3581426_3582731_-\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	1.8e-233	93.5
AVZ15488.1\|3582730_3584467_-\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	99.7
AVZ15489.1\|3584466_3584940_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.3e-85	98.7
AVZ15490.1\|3585097_3585448_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	2.4e-52	82.8
AVZ15491.1\|3585447_3586038_-	hypothetical protein	S4TR53	Salmonella_phage	1.0e-95	84.1
AVZ15492.1\|3586203_3586461_+	hypothetical protein	K7P7V5	Enterobacteria_phage	2.7e-32	95.1
AVZ15493.1\|3586761_3588219_-	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	1.2e-273	92.8
AVZ15494.1\|3588409_3588700_+	lipoprotein bor	C6ZCX3	Enterobacteria_phage	6.3e-30	62.9
AVZ16704.1\|3588810_3589095_-	hypothetical protein	G8C7W3	Escherichia_phage	1.1e-26	67.0
AVZ16705.1\|3589161_3589344_-	hypothetical protein	K7PM01	Enterobacterial_phage	2.1e-15	83.7
AVZ15495.1\|3590011_3590281_-	hypothetical protein	G8C7W1	Escherichia_phage	4.8e-32	90.8
AVZ15496.1\|3590288_3590918_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	1.4e-114	97.6
AVZ15497.1\|3590917_3591196_-\|holin	phage holin family protein	G8C7V9	Escherichia_phage	9.6e-36	87.4
AVZ15498.1\|3591185_3591575_-	hypothetical protein	G8C7V8	Escherichia_phage	2.3e-59	94.5
AVZ15499.1\|3591655_3591883_+	hypothetical protein	NA	NA	NA	NA
AVZ15500.1\|3591929_3592415_-	HNH endonuclease	C4ML56	Xanthomonas_virus	1.5e-23	42.7
AVZ15501.1\|3592709_3593492_-	antitermination protein	F1C595	Cronobacter_phage	9.4e-113	79.1
AVZ15502.1\|3593488_3593797_-	hypothetical protein	NA	NA	NA	NA
AVZ15503.1\|3593798_3595670_-	bifunctional DNA primase/helicase	K7PK08	Enterobacteria_phage	4.5e-230	61.3
AVZ15504.1\|3595773_3596796_-	hypothetical protein	V5URT9	Shigella_phage	4.0e-47	55.6
AVZ15505.1\|3596788_3596998_-	DUF4222 domain-containing protein	NA	NA	NA	NA
AVZ16706.1\|3596999_3597224_-	helix-turn-helix domain-containing protein	G8C7U2	Escherichia_phage	1.3e-19	59.7
AVZ15506.1\|3597336_3598035_+	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	3.0e-78	62.5
AVZ15507.1\|3598236_3598668_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AVZ15508.1\|3598734_3599121_+	S24 family peptidase	F1C5A0	Cronobacter_phage	1.9e-37	59.7
AVZ15509.1\|3599227_3599452_+	hypothetical protein	NA	NA	NA	NA
AVZ15510.1\|3599444_3599852_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	2.1e-47	87.5
AVZ15511.1\|3599805_3600417_+	HNH endonuclease	A0A2I7S010	Vibrio_phage	6.6e-37	47.2
AVZ15512.1\|3600406_3600829_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	1.6e-45	66.4
AVZ15513.1\|3600932_3601244_+	hypothetical protein	NA	NA	NA	NA
AVZ15514.1\|3601233_3601443_+	excisionase	I6PBM8	Cronobacter_phage	4.4e-33	97.1
AVZ15515.1\|3601397_3602570_+	DUF3596 domain-containing protein	I6PDJ1	Cronobacter_phage	8.3e-206	91.0

DBSCAN-SWA_6

4052546 : 4103673

Erwinia_phage(37.29%)

tRNA,plate,protease,head,tail,lysis,portal,terminase,capsid,integrase

attL 4058635:4058685|attR 4103853:4103903

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ15923.1\|4052546_4053560_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.3e-108	58.6
AYM45051.1\|4053563_4053746_+	hypothetical protein	NA	NA	NA	NA
AVZ15924.1\|4053796_4054012_+	30S ribosomal protein S21	NA	NA	NA	NA
AVZ15925.1\|4054127_4055873_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-76	39.0
AVZ15927.1\|4056026_4057871_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
AVZ15928.1\|4057973_4058480_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
4058635:4058685	attL	NA	NA	NA	NA
AVZ15929.1\|4058837_4059056_-	DNA-binding transcriptional regulator	A0A2I8TV89	Erwinia_phage	4.3e-39	100.0
AVZ15930.1\|4059122_4060292_-	phage late control D family protein	A0A218M4J7	Erwinia_phage	5.6e-210	100.0
AVZ15931.1\|4060288_4060774_-\|tail	phage tail protein	S4TUC3	Salmonella_phage	2.6e-84	98.1
AVZ15932.1\|4060786_4063228_-\|tail	phage tail tape measure protein	S4TP64	Salmonella_phage	0.0e+00	95.2
AVZ15933.1\|4063220_4063358_-\|tail	GpE family phage tail protein	O80316	Escherichia_phage	1.2e-18	97.8
AVZ15934.1\|4063372_4063708_-\|tail	phage tail assembly protein	A0A218M4J8	Erwinia_phage	1.8e-52	99.1
AVZ15935.1\|4063770_4064292_-\|tail	phage major tail tube protein	Q37845	Escherichia_phage	1.7e-94	100.0
AVZ15936.1\|4064307_4065486_-\|tail	phage tail sheath protein	Q37844	Escherichia_phage	5.4e-213	95.4
AVZ15937.1\|4065614_4066070_-\|tail	tail fiber assembly protein	A0A1B0V844	Salmonella_phage	6.0e-27	47.8
AVZ15938.1\|4066036_4068058_-	hypothetical protein	A0A1B0V7G4	Salmonella_phage	3.2e-104	53.9
AVZ15939.1\|4068064_4068598_-\|tail	phage tail protein I	Q37841	Escherichia_phage	2.1e-95	92.6
AVZ15940.1\|4068590_4069499_-\|plate	baseplate assembly protein	Q37840	Escherichia_phage	2.8e-153	94.4
AVZ15941.1\|4069505_4069853_-\|plate	baseplate assembly protein	A0A218M4K8	Erwinia_phage	9.4e-57	98.3
AVZ15942.1\|4069849_4070485_-\|plate	phage baseplate assembly protein V	A0A2I8TV69	Erwinia_phage	4.3e-108	96.2
AVZ15943.1\|4070553_4071003_-	phage virion morphogenesis protein	O80313	Escherichia_phage	8.7e-71	96.6
AVZ15944.1\|4070995_4071463_-\|tail	phage tail protein	A0A218M4K6	Erwinia_phage	4.2e-84	99.4
AVZ15945.1\|4071425_4071599_-\|lysis	phage lysis protein	O80311	Escherichia_phage	6.2e-25	98.2
AVZ15946.1\|4071570_4071981_-\|lysis	LysB family phage lysis regulatory protein	A0A218M4K2	Erwinia_phage	1.7e-49	75.7
AVZ15947.1\|4071980_4072412_-	lysA protein	A0A218M4L6	Erwinia_phage	4.4e-64	83.2
AVZ15948.1\|4072408_4072921_-	lysozyme	A0A218M4K3	Erwinia_phage	3.0e-91	97.6
AVZ15949.1\|4072904_4073126_-	primosomal protein	A0A218M4L5	Erwinia_phage	8.4e-35	98.6
AVZ15950.1\|4073116_4073320_-\|tail	phage tail protein	A0A218M4L8	Erwinia_phage	2.6e-30	97.0
AVZ15951.1\|4073319_4073829_-\|head	head completion/stabilization protein	A0A218M4L7	Erwinia_phage	1.1e-90	98.8
AVZ15952.1\|4073922_4074672_-\|terminase	terminase	Q6K1I5	Salmonella_virus	6.9e-113	87.6
AVZ15953.1\|4074675_4075743_-\|capsid	phage major capsid protein, P2 family	O80304	Escherichia_phage	2.9e-197	99.4
AVZ15954.1\|4075818_4076673_-\|capsid	GPO family capsid scaffolding protein	A0A218M4L9	Erwinia_phage	4.1e-154	96.8
AVZ15955.1\|4076838_4078608_+	oxidoreductase	A0A218M4M1	Erwinia_phage	0.0e+00	99.7
AVZ15956.1\|4078607_4079654_+\|portal	phage portal protein	A0A2I8TV74	Erwinia_phage	1.2e-190	95.1
AVZ15957.1\|4079674_4079875_+	hypothetical protein	NA	NA	NA	NA
AVZ15958.1\|4079788_4079971_-	hypothetical protein	NA	NA	NA	NA
AVZ15959.1\|4079956_4080142_+	hypothetical protein	A0A0M4R4Y4	Salmonella_phage	7.3e-08	75.0
AVZ15960.1\|4080138_4080870_-	hypothetical protein	Q37850	Escherichia_phage	3.6e-130	95.1
AVZ15961.1\|4080951_4081392_-	DinI family protein	A0A218M4I0	Erwinia_phage	5.5e-70	99.3
AVZ15962.1\|4081510_4083727_-	replication endonuclease	A0A218M4H2	Erwinia_phage	0.0e+00	94.6
AVZ15963.1\|4083728_4083950_-	TraR/DksA family transcriptional regulator	A0A218M4I6	Erwinia_phage	2.2e-27	79.5
AVZ15964.1\|4083949_4084177_-	DUF2732 domain-containing protein	A0A218M4I9	Erwinia_phage	3.4e-23	78.7
AVZ15965.1\|4084246_4084447_-	hypothetical protein	A0A0M5M7U3	Salmonella_phage	3.7e-29	92.4
AVZ15966.1\|4084433_4084661_-	DUF2724 domain-containing protein	A0A0M4RTI3	Salmonella_phage	3.9e-35	93.3
AVZ15967.1\|4084668_4085178_-	phage regulatory CII family protein	Q6K1F8	Salmonella_virus	9.9e-79	86.4
AVZ15968.1\|4085208_4085472_-	hypothetical protein	A0A218M4I5	Erwinia_phage	7.4e-30	72.4
AVZ15969.1\|4085564_4086194_+	phage repressor protein CI	A0A218M4J1	Erwinia_phage	7.9e-62	56.6
AVZ15970.1\|4086193_4087237_+\|integrase	integrase	A0A218M4I3	Erwinia_phage	6.3e-197	96.8
AVZ16717.1\|4088156_4088495_-	hypothetical protein	NA	NA	NA	NA
AVZ15971.1\|4088503_4089118_-\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	1.0e-66	68.2
AVZ15972.1\|4089131_4090793_-\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	97.5
AVZ15973.1\|4090776_4091133_-\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	1.2e-59	98.3
AVZ15974.1\|4091090_4091282_-\|terminase	terminase	NA	NA	NA	NA
AVZ15975.1\|4091408_4091852_-	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	1.4e-76	89.1
AVZ15976.1\|4091851_4092145_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	1.2e-41	81.4
AVZ15977.1\|4092137_4092476_-\|head,tail	head-tail adaptor	A0A2H4JHK5	uncultured_Caudovirales_phage	5.1e-23	48.6
AVZ16718.1\|4092472_4093699_-\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	9.9e-234	97.3
AVZ15978.1\|4093709_4094270_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	1.0e-100	98.4
AVZ15979.1\|4094321_4095488_-\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	2.6e-215	99.0
AVZ15980.1\|4095731_4096505_+	hypothetical protein	NA	NA	NA	NA
AVZ16719.1\|4096547_4096784_-	hypothetical protein	NA	NA	NA	NA
AVZ15981.1\|4097151_4098516_-	hypothetical protein	A0A2H4JFA4	uncultured_Caudovirales_phage	2.7e-256	96.0
AVZ15982.1\|4098512_4098881_-	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	1.8e-61	98.4
AVZ15983.1\|4098877_4099105_-	aminotransferase	A0A2H4JBA1	uncultured_Caudovirales_phage	1.0e-27	87.8
AVZ15984.1\|4099097_4099283_-	hypothetical protein	A0A2H4JFH8	uncultured_Caudovirales_phage	4.7e-23	96.7
AVZ16720.1\|4099275_4099488_-	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	5.3e-10	50.9
AVZ16721.1\|4099681_4099876_+	hypothetical protein	NA	NA	NA	NA
AVZ15985.1\|4100389_4101169_-	hypothetical protein	Q8HA02	Enterobacteria_phage	4.3e-41	52.0
AVZ15986.1\|4101177_4101387_-	DNA-binding protein	NA	NA	NA	NA
AVZ16722.1\|4101529_4101889_-	hypothetical protein	NA	NA	NA	NA
AVZ16723.1\|4102251_4103673_-	DUF4102 domain-containing protein	H7BV31	unidentified_phage	8.8e-08	27.2
4103853:4103903	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP028537

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

61632 : 104963

Escherichia_phage(30.77%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ12027.1\|61632_62655_+\|transposase	IS21-like element IS100 family transposase	A0A2L1IVA1	Escherichia_phage	4.6e-200	99.4
AVZ12028.1\|62651_63434_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.9e-139	99.6
AVZ12029.1\|64271_65771_-	kinase	NA	NA	NA	NA
AVZ12030.1\|65796_67434_-	protein phosphatase 2C domain-containing protein	NA	NA	NA	NA
AVZ12031.1\|67433_68474_-	VWA domain-containing protein	NA	NA	NA	NA
AVZ12032.1\|68559_69198_-	VWA domain-containing protein	NA	NA	NA	NA
AVZ12033.1\|69197_69839_-	tellurium resistance protein TerX	NA	NA	NA	NA
AVZ12034.1\|69861_70500_-	VWA domain-containing protein	NA	NA	NA	NA
AVZ12035.1\|70962_71430_-	tellurium resistance protein TerW	NA	NA	NA	NA
AVZ12036.1\|71447_72656_-	DUF4236 domain-containing protein	NA	NA	NA	NA
AVZ12037.1\|72666_73623_-	citrate lyase subunit beta	NA	NA	NA	NA
AVZ12038.1\|73622_74702_-	hypothetical protein	A0A172Q0S8	Acinetobacter_phage	8.1e-38	33.8
AVZ12039.1\|74703_75477_-	hypothetical protein	NA	NA	NA	NA
AVZ12040.1\|75469_76612_-	adenine/guanine phosphoribosyltransferase	A0A172Q0Y1	Acinetobacter_phage	1.7e-30	35.4
AVZ12041.1\|76621_77680_-	carbamoyl-phosphate synthase large chain	NA	NA	NA	NA
AVZ12042.1\|78003_78585_+	tellurium resistance protein TerZ	K4JRX3	Caulobacter_phage	6.3e-13	30.0
AVZ12043.1\|78584_79742_+	tellurium resistance protein TerA	NA	NA	NA	NA
AVZ12044.1\|79764_80220_+	Tellurite resistance protein TerB	NA	NA	NA	NA
AVZ12045.1\|80242_81283_+	tellurium resistance protein TerC	K7QKE8	Escherichia_phage	2.2e-77	48.0
AVZ12046.1\|81331_81910_+	TerD family protein	A0A2P1N0L4	Streptomyces_phage	3.3e-06	40.0
AVZ12047.1\|81977_82553_+	TerD family protein	K4JRX3	Caulobacter_phage	8.7e-31	41.6
AVZ12048.1\|82981_84223_+	tellurium resistance protein TerF	NA	NA	NA	NA
AVZ12049.1\|84785_85067_-	hypothetical protein	NA	NA	NA	NA
AVZ12050.1\|85116_85308_-	hypothetical protein	NA	NA	NA	NA
AVZ12051.1\|85399_85771_-	hypothetical protein	NA	NA	NA	NA
AVZ12052.1\|86113_86506_+	hypothetical protein	NA	NA	NA	NA
AVZ12053.1\|86484_86796_+	hypothetical protein	NA	NA	NA	NA
AVZ12294.1\|87109_87403_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVZ12054.1\|87407_88733_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AVZ12055.1\|88793_89000_+	hypothetical protein	NA	NA	NA	NA
AVZ12056.1\|89101_89512_+	hypothetical protein	NA	NA	NA	NA
AVZ12057.1\|89524_90340_+	HNH endonuclease	G0X580	Salmonella_phage	1.1e-15	36.5
AVZ12058.1\|90593_91019_+	hypothetical protein	NA	NA	NA	NA
AVZ12059.1\|91567_91876_+	hypothetical protein	NA	NA	NA	NA
AVZ12060.1\|91891_92749_+	HNH endonuclease	G0X580	Salmonella_phage	3.9e-11	34.2
AVZ12061.1\|92810_93014_+	hypothetical protein	NA	NA	NA	NA
AVZ12062.1\|93100_93280_-	hypothetical protein	NA	NA	NA	NA
AVZ12063.1\|94469_94811_-	RamA family antibiotic efflux transcriptional regulator	D0R0F8	Streptococcus_phage	2.0e-06	29.8
AVZ12064.1\|95397_96660_-\|transposase	IS1380 family transposase ISEc9	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
AVZ12065.1\|97297_98002_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12066.1\|98965_99808_+\|transposase	transposase	NA	NA	NA	NA
AVZ12067.1\|99794_101918_+\|transposase	transposase	NA	NA	NA	NA
AVZ12068.1\|101917_103366_+	ATP-binding protein	NA	NA	NA	NA
AVZ12069.1\|103406_104963_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

139983 : 189293

Escherichia_phage(38.1%)

integrase,transposase

attL 173114:173173|attR 176706:177527

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ12104.1\|139983_142881_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	9.3e-182	37.8
AVZ12105.1\|142975_143581_+	DNA resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
AVZ12106.1\|146325_146775_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	9.0e-60	100.0
AVZ12107.1\|146833_147538_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12108.1\|148527_148704_-	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
AVZ12109.1\|149033_149849_+	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AVZ12110.1\|149935_150238_+	phosphoglucosamine mutase	NA	NA	NA	NA
AVZ12111.1\|150131_150383_-	hypothetical protein	NA	NA	NA	NA
AVZ12112.1\|150413_151907_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AVZ12113.1\|152018_152324_-	LysR family transcriptional regulator	NA	NA	NA	NA
AVZ12114.1\|152351_153566_-	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	5.5e-19	28.7
AVZ12115.1\|153782_154667_-	DUF3363 domain-containing protein	NA	NA	NA	NA
AVZ12116.1\|154697_156191_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AVZ12117.1\|156401_156626_-	hypothetical protein	NA	NA	NA	NA
AVZ12118.1\|156622_157360_-	resolvase	NA	NA	NA	NA
AVZ12119.1\|157466_157958_+	hypothetical protein	NA	NA	NA	NA
AVZ12120.1\|157991_158696_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12121.1\|158783_160361_+	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	1.2e-95	99.4
AVZ12122.1\|161020_161308_+	hypothetical protein	NA	NA	NA	NA
AVZ12123.1\|161773_162550_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AVZ12124.1\|162620_163574_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AVZ12125.1\|163593_163992_-	ester cyclase	NA	NA	NA	NA
AVZ12126.1\|164823_165528_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12127.1\|165473_165683_-	hypothetical protein	Q1MVP5	Enterobacteria_phage	8.9e-10	89.5
AVZ12128.1\|165721_166108_+	bleomycin binding protein	NA	NA	NA	NA
AVZ12129.1\|166427_166820_-	NimC/NimA family protein	NA	NA	NA	NA
AVZ12130.1\|167154_167859_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12131.1\|168178_169354_+	multidrug efflux RND transporter periplasmic adaptor subunit OqxA	NA	NA	NA	NA
AVZ12132.1\|169377_172530_+	multidrug efflux RND transporter permease subunit OqxB	NA	NA	NA	NA
AVZ12133.1\|172599_173079_-	transcriptional regulator	NA	NA	NA	NA
173114:173173	attL	NA	NA	NA	NA
AVZ12134.1\|173167_173872_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12135.1\|174100_174415_-\|transposase	transposase	NA	NA	NA	NA
AVZ12136.1\|174353_175367_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AVZ12298.1\|175524_175998_+	trimethoprim-resistant dihydrofolate reductase DfrA17	A0A1B2IAU3	Erwinia_phage	1.3e-16	34.6
AVZ12137.1\|176759_177464_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12138.1\|177454_177643_+	hypothetical protein	NA	NA	NA	NA
176706:177527	attR	NA	NA	NA	NA
AVZ12139.1\|177730_179167_+	glutathione synthase	NA	NA	NA	NA
AVZ12140.1\|179584_180589_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AVZ12141.1\|180770_181043_-	hypothetical protein	NA	NA	NA	NA
AVZ12299.1\|181087_181792_-	RepB family plasmid replication initiator protein	I3WF20	Macacine_betaherpesvirus	6.4e-20	28.7
AVZ12142.1\|181821_182526_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12300.1\|182550_183801_+\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
AVZ12143.1\|184040_184682_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AVZ12144.1\|184922_185273_-	hypothetical protein	NA	NA	NA	NA
AVZ12145.1\|185504_186308_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AVZ12146.1\|186307_187144_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AVZ12147.1\|187479_188295_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.8e-160	98.2
AVZ12148.1\|188588_189293_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0

DBSCAN-SWA_3

233337 : 262135

Escherichia_phage(46.15%)

integrase,transposase

attL 243421:243480|attR 260596:261416

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVZ12194.1\|233337_234576_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	2.5e-11	23.1
AVZ12195.1\|234997_236338_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AVZ12196.1\|236768_237374_-	hypothetical protein	NA	NA	NA	NA
AVZ12197.1\|237590_237872_-	hypothetical protein	NA	NA	NA	NA
AVZ12198.1\|238247_238559_-	hypothetical protein	NA	NA	NA	NA
AVZ12199.1\|238781_238982_-	hypothetical protein	NA	NA	NA	NA
AVZ12200.1\|239021_239246_-	hypothetical protein	NA	NA	NA	NA
AVZ12201.1\|239300_239504_-	hypothetical protein	NA	NA	NA	NA
AVZ12202.1\|239683_239977_-	hypothetical protein	I7B2L9	Escherichia_phage	4.1e-05	38.6
AVZ12203.1\|240056_240548_-	DUF3085 domain-containing protein	NA	NA	NA	NA
AVZ12204.1\|240552_240864_-	DUF957 domain-containing protein	NA	NA	NA	NA
AVZ12205.1\|241065_241284_-	hypothetical protein	NA	NA	NA	NA
AVZ12206.1\|241380_241701_-	hypothetical protein	NA	NA	NA	NA
AVZ12207.1\|241879_242110_-	hypothetical protein	NA	NA	NA	NA
243421:243480	attL	NA	NA	NA	NA
AVZ12208.1\|243483_244188_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12209.1\|244677_245787_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	30.2
AVZ12210.1\|245881_247066_-	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
AVZ12211.1\|247161_247818_+	TetR family transcriptional regulator	NA	NA	NA	NA
AVZ12212.1\|247829_248534_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12213.1\|248567_249059_-	hypothetical protein	NA	NA	NA	NA
AVZ12214.1\|249165_249903_+	resolvase	NA	NA	NA	NA
AVZ12215.1\|249899_250124_+	hypothetical protein	NA	NA	NA	NA
AVZ12216.1\|250245_250422_+	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
AVZ12217.1\|250603_251608_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
AVZ12218.1\|251686_254653_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.8
AVZ12219.1\|254773_255478_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12220.1\|255514_256534_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.1e-71	45.5
AVZ12221.1\|256710_257265_+	aminoglycoside N-acetyltransferase AAC(6')-Ib3	NA	NA	NA	NA
AVZ12222.1\|257492_258233_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	4.4e-43	41.7
AVZ12303.1\|258219_259728_-\|transposase	IS21-like element ISCfr8 family transposase	A0A2L1IVA1	Escherichia_phage	9.9e-26	32.7
AVZ12223.1\|259887_260592_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVZ12224.1\|260667_261168_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AVZ12225.1\|261186_261366_+	hypothetical protein	NA	NA	NA	NA
AVZ12226.1\|261295_262135_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
260596:261416	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP028538

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP028537

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection