CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP020470	Rhodobacter blasticus strain 28/5 chromosome, complete genome	0 crisprs	DEDDh,WYL,csa3,cas3,cas5,cas8c,cas7,cas4,cas1,cas2,cas6e,cse2gr11,cas8e	0	0	4	0
CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	1 crisprs	WYL	0	14	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

210790 : 223424

Paracoccus_phage(28.57%)

capsid,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWD20405.1\|210790_211987_+\|capsid	capsid protein	A0A2D1GNH4	Pseudomonas_phage	2.5e-64	39.2
AWD20406.1\|212068_212671_+	hypothetical protein	NA	NA	NA	NA
AWD20407.1\|212667_213006_+\|tail	phage tail protein	NA	NA	NA	NA
AWD20408.1\|213002_213398_+	hypothetical protein	NA	NA	NA	NA
AWD23238.1\|213438_213852_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
AWD20409.1\|213851_214172_+	hypothetical protein	NA	NA	NA	NA
AWD23239.1\|214171_214381_+	hypothetical protein	NA	NA	NA	NA
AWD20410.1\|214367_215021_+\|tail	phage tail protein	A0A1W6JP49	Morganella_phage	1.1e-10	31.6
AWD20411.1\|215026_215659_+	glycoside hydrolase family 24	A0A0B5A2K3	Paracoccus_phage	1.6e-57	50.0
AWD20412.1\|215655_216570_+	hypothetical protein	A0A0K1Y6Z2	Rhodobacter_phage	1.1e-35	36.5
AWD20413.1\|216566_217010_+	peptidase	F4YXU4	Roseobacter_phage	2.5e-25	43.3
AWD20414.1\|217012_220897_+	host specificity protein	A0A0B5A7K5	Paracoccus_phage	4.1e-217	37.3
AWD20415.1\|220989_221796_+	serine O-acetyltransferase	NA	NA	NA	NA
AWD20416.1\|221805_222468_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AWD23240.1\|222542_223424_+	phosphatidate cytidylyltransferase	A0A2K9L268	Tupanvirus	4.3e-13	32.0

DBSCAN-SWA_2

1033343 : 1040267

Prochlorococcus_phage(33.33%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWD21101.1\|1033343_1033892_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	5.4e-22	34.0
AWD21102.1\|1033942_1035001_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.3e-63	43.4
AWD21103.1\|1035265_1036336_-	hypothetical protein	A0A291AUF0	Sinorhizobium_phage	1.3e-51	35.8
AWD21104.1\|1036332_1036599_-	hypothetical protein	NA	NA	NA	NA
AWD21105.1\|1036606_1036942_-	hypothetical protein	A0A2I7QSM5	Vibrio_phage	2.5e-06	36.4
AWD21106.1\|1036944_1037166_-	hypothetical protein	NA	NA	NA	NA
AWD23319.1\|1037165_1038893_-	hypothetical protein	A0A2I7QRU0	Vibrio_phage	2.1e-08	29.7
AWD21107.1\|1039013_1040267_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	6.6e-68	37.8

DBSCAN-SWA_3

1606652 : 1641153

Rhodobacter_phage(51.61%)

head,integrase

attL 1602827:1602842|attR 1629617:1629632

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1602827:1602842	attL	NA	NA	NA	NA
AWD23381.1\|1606652_1607426_-	transcriptional regulator	G8GWB1	Rhodobacter_phage	3.5e-75	55.5
AWD21579.1\|1607593_1607890_+	DNA-binding protein	G8GWB2	Rhodobacter_phage	5.1e-27	64.5
AWD21580.1\|1607886_1608159_+	hypothetical protein	NA	NA	NA	NA
AWD21581.1\|1608351_1609191_+	hypothetical protein	G8GWB8	Rhodobacter_phage	4.3e-63	49.3
AWD21582.1\|1609190_1609667_+	hypothetical protein	R9U2Q7	Rhizobium_phage	5.3e-50	63.3
AWD23382.1\|1609672_1611973_+\|integrase	integrase	G8GWC0	Rhodobacter_phage	8.9e-228	54.8
AWD21583.1\|1612005_1612779_+	DNA transposition protein	G8GWC1	Rhodobacter_phage	1.7e-114	77.8
AWD21584.1\|1612778_1613366_+	hypothetical protein	NA	NA	NA	NA
AWD21585.1\|1613362_1613725_+	hypothetical protein	G8GWC3	Rhodobacter_phage	1.1e-36	64.0
AWD21586.1\|1613721_1614024_+	hypothetical protein	A0A1B0T6P4	Pelagibaca_phage	1.7e-14	49.5
AWD21587.1\|1614010_1614241_+	hypothetical protein	NA	NA	NA	NA
AWD21588.1\|1614244_1614916_+	hypothetical protein	A0A1B0T6L8	Pelagibaca_phage	1.2e-60	48.9
AWD21589.1\|1614912_1615320_+	hypothetical protein	NA	NA	NA	NA
AWD21590.1\|1615316_1615949_+	hypothetical protein	NA	NA	NA	NA
AWD21591.1\|1615973_1616240_+	hypothetical protein	A0A1B0T6M4	Pelagibaca_phage	1.7e-13	52.3
AWD21592.1\|1616492_1616804_+	hypothetical protein	NA	NA	NA	NA
AWD21593.1\|1617053_1617260_+	hypothetical protein	F8TVB2	EBPR_siphovirus	8.7e-10	44.6
AWD21594.1\|1617259_1617535_+	hypothetical protein	NA	NA	NA	NA
AWD21595.1\|1617531_1617969_+	hypothetical protein	F8TVB3	EBPR_siphovirus	1.5e-64	90.7
AWD21596.1\|1617968_1618382_+	hypothetical protein	NA	NA	NA	NA
AWD21597.1\|1618378_1619032_+	hypothetical protein	A0A076GD02	Sinorhizobium_phage	5.9e-60	55.4
AWD21598.1\|1619031_1619403_+	hypothetical protein	F8TVB5	EBPR_siphovirus	2.9e-48	75.6
AWD21599.1\|1619504_1620428_+	hypothetical protein	G8GWD3	Rhodobacter_phage	2.5e-72	53.9
AWD21600.1\|1620427_1620937_+	hypothetical protein	M4SRV1	Rhodobacter_phage	5.3e-48	58.3
AWD21601.1\|1620936_1621182_+	hypothetical protein	NA	NA	NA	NA
AWD21602.1\|1621171_1621669_+	hypothetical protein	F8TVC1	EBPR_siphovirus	1.3e-72	87.8
AWD21603.1\|1621665_1623330_+	hypothetical protein	F8TVC2	EBPR_siphovirus	1.0e-289	87.5
AWD21604.1\|1623442_1623655_+	hypothetical protein	NA	NA	NA	NA
AWD21605.1\|1623881_1625273_+	hypothetical protein	F8TVC4	EBPR_siphovirus	3.6e-224	83.5
AWD21606.1\|1625368_1626853_+\|head	head morphogenesis protein	F8TVC5	EBPR_siphovirus	9.8e-220	72.1
AWD21607.1\|1626956_1627445_+	phage virion morphogenesis protein	F8TVC6	EBPR_siphovirus	4.6e-49	68.8
AWD23383.1\|1627732_1628836_+	hypothetical protein	G8GWE4	Rhodobacter_phage	1.9e-114	67.7
AWD21608.1\|1628845_1629187_+	hypothetical protein	NA	NA	NA	NA
AWD21609.1\|1629197_1630142_+	hypothetical protein	G8GWE7	Rhodobacter_phage	4.8e-119	67.5
1629617:1629632	attR	NA	NA	NA	NA
AWD21610.1\|1630141_1630540_+	hypothetical protein	NA	NA	NA	NA
AWD21611.1\|1630603_1630879_+	hypothetical protein	NA	NA	NA	NA
AWD21612.1\|1630985_1631294_+	hypothetical protein	A0A1S6UB66	Serratia_phage	2.6e-05	36.0
AWD21613.1\|1631293_1631545_+	hypothetical protein	NA	NA	NA	NA
AWD21614.1\|1631541_1631964_+	hypothetical protein	G8GWF0	Rhodobacter_phage	1.5e-43	62.1
AWD21615.1\|1631963_1632395_+	hypothetical protein	G8GWF1	Rhodobacter_phage	2.0e-24	46.4
AWD21616.1\|1632551_1633493_+	hypothetical protein	G8GWF3	Rhodobacter_phage	2.4e-38	35.3
AWD21617.1\|1633507_1633846_+	hypothetical protein	NA	NA	NA	NA
AWD21618.1\|1633932_1634217_+	hypothetical protein	M4T549	Rhodobacter_phage	6.8e-13	43.7
AWD21619.1\|1634230_1636879_+	hypothetical protein	M4SPQ3	Rhodobacter_phage	4.6e-26	43.9
AWD21620.1\|1636989_1637535_+	hypothetical protein	NA	NA	NA	NA
AWD21621.1\|1637531_1638044_+	hypothetical protein	NA	NA	NA	NA
AWD21622.1\|1637935_1638475_+	hypothetical protein	A0A1B0T6D9	Thiobacimonas_phage	1.2e-13	39.2
AWD21623.1\|1638471_1641153_+	hypothetical protein	M4T544	Rhodobacter_phage	1.3e-07	29.2

DBSCAN-SWA_4

3236100 : 3248507

Acidithiobacillus_phage(44.44%)

transposase,portal,capsid,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWD22954.1\|3236100_3236523_-	acyl-CoA transferase	G8DH50	Emiliania_huxleyi_virus	1.8e-33	50.7
AWD22955.1\|3236655_3237597_+	hypothetical protein	NA	NA	NA	NA
AWD22956.1\|3237672_3238317_-	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	1.1e-50	52.4
AWD22957.1\|3238449_3238839_+\|transposase	transposase	NA	NA	NA	NA
AWD22958.1\|3238835_3239189_+\|transposase	IS66 family transposase	NA	NA	NA	NA
AWD22959.1\|3239243_3240800_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.3e-97	42.0
AWD22960.1\|3240791_3241100_-	hypothetical protein	NA	NA	NA	NA
AWD22961.1\|3241111_3242137_-\|capsid	phage capsid protein	K4I3Z3	Acidithiobacillus_phage	4.9e-101	54.7
AWD22962.1\|3242184_3242565_-\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	9.8e-23	51.2
AWD23566.1\|3242606_3243929_-	serine peptidase	A0A068CE01	Rhizobium_phage	1.7e-61	45.3
AWD22963.1\|3243928_3245440_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	5.0e-171	66.0
AWD22964.1\|3245442_3245655_-	hypothetical protein	K4HZB1	Acidithiobacillus_phage	3.5e-06	44.3
AWD22965.1\|3247653_3248190_-	hypothetical protein	NA	NA	NA	NA
AWD22966.1\|3248312_3248507_+	hypothetical protein	A0A1X9I6B9	Streptococcus_phage	8.5e-07	50.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP020471

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020471_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020471_1

88015-88897

Orphan

I-E

Consensus_repeat	Method
CGGTTCATCCCCGCGTGTGCGGGGAACAG	PILER-CR
CTGTTCCCCGCACACGCGGGGATGAACCG	CRISPRCasFinder
CTGTTCCCCGCACACGCGGGGATGAACCG	CRT

14 spacers

The CRISPR arrays of CP020471_1

>merge|CP020471|1|88015-88897|PILER-CR,CRISPRCasFinder,CRT
CTGTTCCCCGCACACGCGGGGATGAACCGTATCCGGCGCCGTCGACCCAGTTGTCGGCGTGCTGTTCCCCGCACACGCGGGGATGAACCGCCGTTGGCAAACCGTGGCAGGCAACGACCTACCTGTTCCCCGCACACGCGGGGATGAACCGGTGATGCAGGCCATGCGCTGGTGGCCCGAGGACTGTTCCCCGCACACGCGGGGATGAACCGCCGGCTCTGATGACGATCGCTAAGCTGCGCATCTGTTCCCCGCACACGCGGGGATGAACCGAACGGCACCCCAGCCGCGATGCACTGATCGCGCTGTTCCCCGCACACGCGGGGATGAACCGCGCCACCACGACAGGATGATCCGGCCGGAACGCTGTTCCCCGCACACGCGGGGATGAACCGCGCAAGGCTTCCAGTTTCTACTATGACGGCATCTGTTCCCCGCACACGCGGGGATGAACCGGCGCCCAGCTTCGGCATTTCGATGGTGCAGTTCTGTTCCCCGCACACGCGGGGATGAACCGATGGTGTCGTCGCCCCGGTCGTTTTGGCCGAACTGTTCCCCGCACACGCGGGGATGAACCGAATGAATGTCATGTCGATCCGGTGGCGCCGCCCTGTTCCCCGCACACGCGGGGATGAACCGATCGTCTCGGATGCGCTTGAGGGTGCCCAGCACTGTTCCCCGCACACGCGGGGATGAACCGCCACGGCCGAGGATGTGCGCAAGCTGTTCCAGCTGTTCCCCGCACACGCGGGGATGAACCGGCGTCCATCAGATCGGAGTTGATGGTTTCCCCCTGTTCCCCGCACACGCGGGGATGAACCGGGAGAGCGTCACAGACGGTATACCCGACCGGACTGTTCCCCGCTGGCGGCGTGGCGGCGGA

>CP020471|1|1|88015-88836|PILER-CR
CTGTTCCCCGCACACGCGGGGATGAACCG	TATCCGGCGCCGTCGACCCAGTTGTCGGCGTG
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGTTGGCAAACCGTGGCAGGCAACGACCTAC
CTGTTCCCCGCACACGCGGGGATGAACCG	GTGATGCAGGCCATGCGCTGGTGGCCCGAGGA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGGCTCTGATGACGATCGCTAAGCTGCGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	AACGGCACCCCAGCCGCGATGCACTGATCGCG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCCACCACGACAGGATGATCCGGCCGGAACG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCAAGGCTTCCAGTTTCTACTATGACGGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGCCCAGCTTCGGCATTTCGATGGTGCAGTT
CTGTTCCCCGCACACGCGGGGATGAACCG	ATGGTGTCGTCGCCCCGGTCGTTTTGGCCGAA
CTGTTCCCCGCACACGCGGGGATGAACCG	AATGAATGTCATGTCGATCCGGTGGCGCCGCC
CTGTTCCCCGCACACGCGGGGATGAACCG	ATCGTCTCGGATGCGCTTGAGGGTGCCCAGCA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCACGGCCGAGGATGTGCGCAAGCTGTTCCAG
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGTCCATCAGATCGGAGTTGATGGTTTCCCC
CTGTTCCCCGCACACGCGGGGATGAACCG

>CP020471|1|1|88015-88836|CRISPRCasFinder
CTGTTCCCCGCACACGCGGGGATGAACCG	TATCCGGCGCCGTCGACCCAGTTGTCGGCGTG
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGTTGGCAAACCGTGGCAGGCAACGACCTAC
CTGTTCCCCGCACACGCGGGGATGAACCG	GTGATGCAGGCCATGCGCTGGTGGCCCGAGGA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGGCTCTGATGACGATCGCTAAGCTGCGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	AACGGCACCCCAGCCGCGATGCACTGATCGCG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCCACCACGACAGGATGATCCGGCCGGAACG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCAAGGCTTCCAGTTTCTACTATGACGGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGCCCAGCTTCGGCATTTCGATGGTGCAGTT
CTGTTCCCCGCACACGCGGGGATGAACCG	ATGGTGTCGTCGCCCCGGTCGTTTTGGCCGAA
CTGTTCCCCGCACACGCGGGGATGAACCG	AATGAATGTCATGTCGATCCGGTGGCGCCGCC
CTGTTCCCCGCACACGCGGGGATGAACCG	ATCGTCTCGGATGCGCTTGAGGGTGCCCAGCA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCACGGCCGAGGATGTGCGCAAGCTGTTCCAG
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGTCCATCAGATCGGAGTTGATGGTTTCCCC
CTGTTCCCCGCACACGCGGGGATGAACCG

>CP020471|1|1|88015-88897|CRT
CTGTTCCCCGCACACGCGGGGATGAACCG	TATCCGGCGCCGTCGACCCAGTTGTCGGCGTG
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGTTGGCAAACCGTGGCAGGCAACGACCTAC
CTGTTCCCCGCACACGCGGGGATGAACCG	GTGATGCAGGCCATGCGCTGGTGGCCCGAGGA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCGGCTCTGATGACGATCGCTAAGCTGCGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	AACGGCACCCCAGCCGCGATGCACTGATCGCG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCCACCACGACAGGATGATCCGGCCGGAACG
CTGTTCCCCGCACACGCGGGGATGAACCG	CGCAAGGCTTCCAGTTTCTACTATGACGGCAT
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGCCCAGCTTCGGCATTTCGATGGTGCAGTT
CTGTTCCCCGCACACGCGGGGATGAACCG	ATGGTGTCGTCGCCCCGGTCGTTTTGGCCGAA
CTGTTCCCCGCACACGCGGGGATGAACCG	AATGAATGTCATGTCGATCCGGTGGCGCCGCC
CTGTTCCCCGCACACGCGGGGATGAACCG	ATCGTCTCGGATGCGCTTGAGGGTGCCCAGCA
CTGTTCCCCGCACACGCGGGGATGAACCG	CCACGGCCGAGGATGTGCGCAAGCTGTTCCAG
CTGTTCCCCGCACACGCGGGGATGAACCG	GCGTCCATCAGATCGGAGTTGATGGTTTCCCC
CTGTTCCCCGCACACGCGGGGATGAACCG	GGAGAGCGTCACAGACGGTATACCCGACCGGA
CTGTTCCCCGCTGGCGGCGTGGCGGCGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP020471.1\|AWD23661.1\|93640_94558_+\|dipeptide-ABC-transporter-permease-DppC	unknown	unknown	gnl\|CDD\|182833
CP020471.1\|AWD23666.1\|97938_99783_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|132997
CP020471.1\|AWD23660.1\|92636_93644_+\|peptide-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|182834
CP020471.1\|AWD23658.1\|86104_87304_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184349
CP020471.1\|AWD23717.1\|91008_92565_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
CP020471.1\|AWD23714.1\|84956_85934_+\|plasmid-partitioning-protein-RepB	unknown	unknown	gnl\|CDD\|274586
CP020471.1\|AWD23663.1\|95398_96247_+\|peptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236898
CP020471.1\|AWD23654.1\|81247_82765_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372590
CP020471.1\|AWD23665.1\|96877_97942_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224748
CP020471.1\|AWD23657.1\|83763_84957_+\|plasmid-partitioning-protein-RepA	unknown	unknown	gnl\|CDD\|274585
CP020471.1\|AWD23662.1\|94562_95399_+\|nickel-import-ATP-binding-protein-NikD	unknown	unknown	gnl\|CDD\|223521
CP020471.1\|AWD23715.1\|87777_87915_+\|CRISPR-associated-protein-Cas2	unknown	unknown	gnl\|CDD\|236930
CP020471.1\|AWD23664.1\|96319_96613_-\|hypothetical-protein	unknown	unknown	unknown
CP020471.1\|AWD23656.1\|83278_83521_-\|prevent-host-death-protein	unknown	unknown	gnl\|CDD\|376852
CP020471.1\|AWD23652.1\|79259_79481_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377822
CP020471.1\|AWD23655.1\|82877_83279_-\|VapC-toxin-family-PIN-domain-ribonuclease	unknown	unknown	gnl\|CDD\|350313
CP020471.1\|AWD23659.1\|88965_90117_+\|X-Pro-dipeptidase	unknown	unknown	gnl\|CDD\|223085
CP020471.1\|AWD23716.1\|90278_90929_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
CP020471.1\|AWD23653.1\|79503_80574_+\|integrase	unknown	unknown	gnl\|CDD\|271180
CP020471.1\|AWD23651.1\|78953_79247_-\|plasmid-maintenance-protein-CcdB	unknown	unknown	gnl\|CDD\|376629

Protein	Function_ID	Function_description	E-value
CP020471.1\|AWD23661.1\|93640_94558_+\|dipeptide-ABC-transporter-permease-DppC	gnl\|CDD\|182833	PRK10913, PRK10913, dipeptide ABC transporter permease DppC.	4.24367e-141
CP020471.1\|AWD23666.1\|97938_99783_-\|hypothetical-protein	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	7.37245e-10
CP020471.1\|AWD23660.1\|92636_93644_+\|peptide-ABC-transporter-permease	gnl\|CDD\|182834	PRK10914, PRK10914, dipeptide ABC transporter permease DppB.	2.66717e-151
CP020471.1\|AWD23658.1\|86104_87304_+\|hypothetical-protein	gnl\|CDD\|184349	PRK13824, PRK13824, replication initiation protein RepC; Provisional.	1.53985e-167
CP020471.1\|AWD23717.1\|91008_92565_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
CP020471.1\|AWD23714.1\|84956_85934_+\|plasmid-partitioning-protein-RepB	gnl\|CDD\|274586	TIGR03454, partition_RepB, plasmid partitioning protein RepB. Members of this family are the RepB protein involved in replicon partitioning. RepB is found, in general, as part of a repABC operon in plasmids and small chromosomes, separate from the main chromosome, in various bacteria. This model describes a rather narrow clade of proteins; it should be noted that additional homologs scoring below the trusted cutoff have very similar functions, although they may be named differently. [Mobile and extrachromosomal element functions, Plasmid functions].	5.82454e-110
CP020471.1\|AWD23663.1\|95398_96247_+\|peptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	2.13784e-144
CP020471.1\|AWD23654.1\|81247_82765_+\|hypothetical-protein	gnl\|CDD\|372590	pfam13403, Hint_2, Hint domain. This domain is found in inteins.	9.04732e-69
CP020471.1\|AWD23665.1\|96877_97942_-\|hypothetical-protein	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	8.36267e-34
CP020471.1\|AWD23657.1\|83763_84957_+\|plasmid-partitioning-protein-RepA	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	0
CP020471.1\|AWD23662.1\|94562_95399_+\|nickel-import-ATP-binding-protein-NikD	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	4.87665e-146
CP020471.1\|AWD23715.1\|87777_87915_+\|CRISPR-associated-protein-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	4.16347e-11
CP020471.1\|AWD23656.1\|83278_83521_-\|prevent-host-death-protein	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	1.10085e-10
CP020471.1\|AWD23652.1\|79259_79481_-\|hypothetical-protein	gnl\|CDD\|377822	pfam07362, CcdA, Post-segregation antitoxin CcdA. This family consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein.	4.32175e-15
CP020471.1\|AWD23655.1\|82877_83279_-\|VapC-toxin-family-PIN-domain-ribonuclease	gnl\|CDD\|350313	cd18746, PIN_VapC4-5_FitB-like, uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily. The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.93079e-60
CP020471.1\|AWD23659.1\|88965_90117_+\|X-Pro-dipeptidase	gnl\|CDD\|223085	COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism].	4.7352e-94
CP020471.1\|AWD23716.1\|90278_90929_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.9511e-25
CP020471.1\|AWD23653.1\|79503_80574_+\|integrase	gnl\|CDD\|271180	cd00799, INT_Cre_C, C-terminal catalytic domain of Cre recombinase (also called integrase). Cre-like recombinases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.	4.65383e-44
CP020471.1\|AWD23651.1\|78953_79247_-\|plasmid-maintenance-protein-CcdB	gnl\|CDD\|376629	pfam01845, CcdB, CcdB protein.	3.89243e-22

>CP020471.1|AWD23715.1|87777_87915_+|CRISPR-associated-protein-Cas2
MEEGDAVMIWKALADQGFDFATTVRIRHMPADFNGLKRLSFFPRE
>CP020471.1|AWD23658.1|86104_87304_+|hypothetical-protein
MQHISLTPFGRQPATSSLLAARFQADKAPALPQVDKWAVFNALREARTRLGLTDRDLSVLYALLTFLPAKALEDGAQLVVFPSNAALSDRAHGMAESTLRRHLAALVAAGLICRQDSPNGKRYAARDSAGGLAVAFGFDLRPLLTRADDIFRIAAEVTEAAAALRRQREALVLRLRDAAKLLAYGQDAALPGDWAGIEARLLPLRAALRRKMDPEQIAGLLDQAGDILRAISAMLAFPTEESNGTAAHFGRHHTDSNPDSHAFEPCPEKGRAAEAGSPDTEANPQDEPETPLPLYLVLKACPEIEAYANGNLTRWPEFIATASEVRGMMGISASAWQDACQTMGHGTAAIVVAAMLQRFASIQSPGGYLRALTAKAAEGAFSPGPMVMSLLNTNQRRAA
>CP020471.1|AWD23714.1|84956_85934_+|plasmid-partitioning-protein-RepB
MSRKDVLKGLMDAQPATPAGPVAAPPRANRGAIGAVSRSIADLKARSVVELDPHSIEAAGMSDRLETDLDADASLRNSIAEYGQQVPVLVRPHPTKEGRYQIVYGRRRVLAMRDLGQTVKALIRDLDDRELVLAQGQENTARRDLSFIEKVNFARQLSEAGYDRKVICDALSVDKTLISRMLSIADRLPPDLIAGIGAAPSVGRDRWLALADLVEATETDTITLLAMVNLGTVSERSDDRFQTAWAYLSGVMARRKAVPESTRRPAQPLYTPDGVPLGQARYDRNFCTVKLRLAHSEGFEDWLVENLPTLFTDWQARNTGPARKP
>CP020471.1|AWD23657.1|83763_84957_+|plasmid-partitioning-protein-RepA
MGQINERIDRLVGEHAAKLSERLMAHRAQLFPPNASKVLRRFTSGEVAGLLGVKDAYLRKLSLEGRGPQPETGPGGRRLYSSNDIMELRRLLEAGTKTPGTYLPGRRQNDHLQVITVINFKGGSGKTTTAAHLAQKCALDGYRVLAIDLDPQASFSALHGFQPEFDLLDGGTLYDAIRYEDPLPLRDIIRPSYFTNLHIVPGNLELMEFEHDTPRALAVRRGSEPGENLFFTRISDALADVQADYDLVVIDCPPQLGFLTMSALSAATAVLVTVHPQMLDVMSMCQFLLMTSNLLGVVADAGGNMNYDWLRYLVTRYEPGDGPQNQMVSFMRSLFGDHVLNHPVLKSTAISDAGLTKQTLYEVEKADFTRATYERAMESLNAVNSEIEGLIQKAWGR
>CP020471.1|AWD23656.1|83278_83521_-|prevent-host-death-protein
MWTVQDAKNRFSAVVEAALAGIPQQVSRRGKPAVVVLSADDYRRLLQGAVQSRESFADHLLAFPGADVPRAEAAPRDVTF
>CP020471.1|AWD23655.1|82877_83279_-|VapC-toxin-family-PIN-domain-ribonuclease
MYILDTNVLSAVRRPDRAPKVAAWLRGKPEQELFLSVITLGEIERGIHLQERRDPGFAQDLRAWLDRTVLLFSDRLLPFDAEDARIWGRLSATIGHNGADLMIAASALRHGATVVTGNVSDFAPTGAVVENPF
>CP020471.1|AWD23654.1|81247_82765_+|hypothetical-protein
MAGGEGSDTLDGGGDDDNLQGSAGSDLVYGGEGNDAILGDWPGSGSGAGPADDTIYGGNGNDTITPEDGSDLVYGDAGNDQVLALDGNDTVFGGEGRDNLYGSFGEDSLDGGDQDDFLNGGSGNDVLLGNSGNDYIFGLEDNDTLFGGDGNDYLDGGTGGGPETSGSDNVEGGAGNDTLSGGGGGADTLTGGTENDLFIISGDASDSIFLSDFGAGETNGANGSSSDNDFVDLTLWYDSSTLALYNATYGTSFATALEALQHDAQDGALQFIALQGGPNVTFTLVGSGVMDTEHTGVVCFARGTMIETDCGPVAIEELRRGDRVATLDNGCQILRWIGSRKIAAAELAANPKLRPIRIRAGALGSGLPVADVLVSPQHRVLVSSRIAERMFGCAEVLVAARQLLTVQGISVAEDVESVEYFHFLFDRHQIVFAEGAPMESLFTGIEALKSVTEDARREIFEIMPDLRQLTAETLPVPARPIMAGQPARKLAWRHVKNNLPLIRQA
>CP020471.1|AWD23653.1|79503_80574_+|integrase
MLREYKLSIPDDQDDRPALPSPVPGSGALDRLAETARGYARAAASENTLKAYARDWAQFTRWCRMRGAEPLPPSPQLIGLYLADLAAPGGKAPSQPASRPLSVASIERRLSGLVWACAQRGERLDRKDRHIASVLAGIRRKHARPPVQKAAILPEDLRDMLATLPHDLRGLRDRAILLIGFAGGLRRSEIVSLDLGRDDTPESGGWVEVLEGGVLITLRGKTGWREVEIARGSSDQTCPVHALAQWLHFARIDFGPIFVAVSRNGARATGERLSDKHVARLIKQTVEAAGLRPELPKAERLTLYSGHSLRAGLASSAEVDERHIQKQLGHASAEMTRRYQRRRDRFRINLTKAAGL
>CP020471.1|AWD23652.1|79259_79481_-|hypothetical-protein
MGRVKVNLTLDAEVAETARALGLNMSRLAEQAIAEATKAERNRLWREETREANAAYAEELAREGLPLARFRTF
>CP020471.1|AWD23651.1|78953_79247_-|plasmid-maintenance-protein-CcdB
MAQFDVFRLTGGQLVVDLQTDLIGIDASRIVAPLRDAGRYVAFPGLTPKVEIDGTVWIVRVQELAAIPGAELREPVASLAAERDALKRALDILIDGI
>CP020471.1|AWD23659.1|88965_90117_+|X-Pro-dipeptidase
MRDYDAILNEFSPVRADPIGAEEYSGRLERLAAAMRRSGVEGVWLDAAASLTYYTGLVLGLSERIHGALVLKDGALVYVTPNFERPKLESMVRLPGKIVVWEEHEDPFALFAAQVTGRLALDPDTPFRFASRIAALPGLTVTGAEQMIAEQRRIKSAAELAILQTAMDASYRVQKAVHAGLRLGVRASEVADFIAAAHVALGMSPAFAAVQFGEATAYPHGVPHDQVLASGDMVLVDMGARLHGYHSDITRTYVFGTPTARQQHLWDCEHRAQLAAFAAARPGTPCEAVDRAARDVLEAAGFGPGYAVPGLPHRTGHGLGLNIHEGPWIVQGDKTPLAPGMCFSIEPMLCVYGECGVRLEDIVYMTEAGPRWFCPPAERPDGP
>CP020471.1|AWD23716.1|90278_90929_+|XRE-family-transcriptional-regulator
MTNKRARMPVALGQRIRKRRLQMAMTLQALSRACGVSVSYLSQVERDNAVPTLGTLAEIAAALDVGIDHFIATPRQVDSVTRAEERRRFSVAGNSVVYERIGADFAAHELSCFLLNVPPSYRSETVRHSGEEIVFVLEGEILHMVDGQSFLLRAGDSMHYLGQQPHSYSNPGDAPARMLWTGKMAHPATPTILGPAQAGGLPGTGSGSGPSDGALA
>CP020471.1|AWD23717.1|91008_92565_+|ABC-transporter-substrate-binding-protein
MSAAMAEAKTFVYCSEASPEGFDPAPYTAGGTFDASAHPVFNRLTEFKKGTTEVEPGLAESWDVSADGTEYTFHLRKGVKWQSNDKFTPTRDFNADDVVFSYDRQGNAENPWHQYIPGITYEYYTSMAMPELIKSIEKIDDYTVKFTLNKPEAPFLANIAMPFASIVSKEYADALMAAGTPEDMNNLPIGTGPFKFVAYQKDAVIRYQKNPDYWGTPAIIDDLVFAITPDAAVRLQKLKAGECHLMPYPAPADIEAIKADPNLKLDEQAGLNVGYLAYNTTVAPFDNPKVRKALNMAINKQAIVDAVFQGAALPAKNPIPPTMWSYNDAVQDDAYDPEAAKKMLEEAGVKDLSMKIWAMPVQRPYMPNARRTAELMQEDLSKIGVKVEIVSYEWGEYLQKSMEPGRDGAVILGWTGDNGDPDNFLSVLLSCDSAGEGGANRAFWCSEDFSKLLGDAKVTADQAERTKLYEQAQVIFKEQAPWFTIAHSTQYVPMSSKVSGFVMSPLGDFTFETVDIAE
>CP020471.1|AWD23660.1|92636_93644_+|peptide-ABC-transporter-permease
MLRFILSKFLYLVPTFLGITVIAFSFVRILPGDPVLLMAGERGVTPERHAELTAQLGYDKPVVLQYFDFLGRLLHGDFGNSLVTKKPVLTEFLSLFPATVELGLCAIIIATLIGVPVGVLAAIRRGSWFDQVSMTAALVGFSMPIFWWGLLLIIFFSGMLGWTPVSGRISLLYFFPNVTGFMLIDSLLSGQKGAFTSALSHLILPSVVLATIPLAVIARQTRSAMLEVMGEDYVRTARAKGMPPYRVIGIHALRNAMIPVITTIGLQIGVLMAGAILTETIFSWPGIGKWMIDSISRRDYPVVQSGLLLIAALVMIVNLLVDLTYGLINPRIRVK
>CP020471.1|AWD23661.1|93640_94558_+|dipeptide-ABC-transporter-permease-DppC
MTDIPPAAAPVRLSDAAIRRRMLAEFWFYFSQNRGAVIGLAVFVLLVAVAVFASVLAPHDPTVQNRAALLVPPVWQEGGSSAYLLGTDAVGRDILSRLIFGAQYSLFIGFVVVSIALVGGIVIGLLAGFFGGWVDGVIMRVMDVILAFPSLLLALVLVAVLGPGLTNAMIAIAIVYQPHFARLTRAAVMSEMQREYVTAARVAGAGNLRLMFKTILPNCLAPLIVQATLSFSSAVLDSAALGFLGMGAQPPAPEWGTMLAEAREFILRAWWVVTFPGLAILVSVLAINLMGDGLRDALDPKLKRS
>CP020471.1|AWD23662.1|94562_95399_+|nickel-import-ATP-binding-protein-NikD
MALLNIRNLTVKFATATGSFTAVDGIDVHVDRGEVLAIVGESGSGKSVSMLAVMGLLPDTATITADEMTYDGRDISNLSAAERRRLIGREITMIFQEPIASLNPSFTVGFQIEEVLRLNLGLGRKEAYSRALELFRAVGIPQPEVKIKSYPHQLSGGQCQRVMIAIAIASNPRLLIADEPTTALDVTIQKQILDLLMKLQEDYGMALILITHDMGVVAETADRVVVQYKGRKMEEADVLSLFEAPQNPYTRALLSALPEHATGDRLPTVSDFFQQAGA
>CP020471.1|AWD23663.1|95398_96247_+|peptide-ABC-transporter-ATP-binding-protein
MGQDIPVVEGRAIVRDYHVPGSMLARGKNVRALKGIDFKVDKGRTLAIVGESGSGKSTLARIIALIDPPSSGDLRISGESVDIHRRRPGPALRSKVQMVFQNPYGSLNPRQKVGDVLMEPLVINTDIPATERRDRAEAMLRKVGLQPEHFNRYPHMFSGGQRQRIAIARALMLNPSLLVLDEPVSALDLSVQAQVLNLLADLQDEFDLTYVFVSHDLSVVRYIADEIMVISNGESVEQGTREAVFANPQHPYTQSLFAATPVTDVEAIRARVARRKAARQGA
>CP020471.1|AWD23664.1|96319_96613_-|hypothetical-protein
MGHGAVTFDAAGDADQTAADHRLAEGHVDALPEVLSQTCCRGAFRRPSRTDIEVSSYVGLPEIADIKVFPLDEAEAASQRDAFLTTWAALPKAGDVE
>CP020471.1|AWD23665.1|96877_97942_-|hypothetical-protein
MTPVASKAQKPILPDNFAAIRLLAALTVVFGHSFPLTGGEGPGYLGSTASTLAVKIFFVISGYMISESWRRDPHLGRYLRRRALRIFPALFFLCLITVLLVGPALTKVDLATYFSHHGTWNYFTNIALYPNYSLPGVFDGNIYPGAVNGSLWTLPIEFSMYLMLPALLIIPFQRVTVCVMAIGLSIASIWYTRISIPSEPIVLYGSNVINGLEMTPYFLWGMVYRLWFRSEWLSLQISVMAIMLLPLATSTWAGAELVSLILVPYVTLSFGHAHNARFSWVEKLGDMSYGTYLYGFLVQQIIAQMIGTPGAHWTNFIASVPPTLILGFLSWHLVEKPAMALKPRKGSHDTFRSV
>CP020471.1|AWD23666.1|97938_99783_-|hypothetical-protein
MLNADELYDNAVQPDNVYGHCLALLDRYRDAAPSASEGIHLDLGCGFGRMAEVLCDVPGLTYVGVDGSDRGPSSLRDRGFEAHQLMFTSYDETIARLQQIVAGRRILSLSMLDTLEHLDNCDEILRVIRCLIGPHHAPAIISVPNFAHRDVGFKMAFGSWDYTREGILDHTHLRVFNKATLKRTFDAVGLQIVDTNDVYIVNSDQHFPTTHPALASGSLISEIMTGLRDQIDATAKVNQFVSLVLAGPQTRMTHYLSDEERAPKRPFLSVVMRTQGKRPHTMIEALTALAAQKDRDFELLVMGHKLTHENQLVIERQLEDSPKWMRDQIRLIRIDEGNRTRPLNVGFAEAKGEYIAILDDDDVPMAHWISTFRTLAQQKPGRVLRTIAARQNVDVIEVQGRSAVRATGGLEPYPAAFDLLQHMITNETPPVALAFPHGAFHDLNIRFDETLTTTEDWDFLMRCVFVVGVHAAPEITAIYHWWVDTVESSRTVHSQAEWDANYHTIHRKMDSMPILLEPGVAKELRYLKSRFNSGDFVEETGRTELLRAVTDILTSRSWRWSWVNRLPKYIKGRRDPNLAECMAMSNEELIKLIAQLRRSSSWRRTAIFRTNGKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88044-88075	0	1.0
CP020471_1	1.2\|88105\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88105-88136	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88105-88136	0	1.0
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88166-88197	0	1.0
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88227-88258	0	1.0
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88288-88319	0	1.0
CP020471_1	1.6\|88349\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88349-88380	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88349-88380	0	1.0
CP020471_1	1.7\|88410\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88410-88441	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88410-88441	0	1.0
CP020471_1	1.8\|88471\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88471-88502	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88471-88502	0	1.0
CP020471_1	1.9\|88532\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88532-88563	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88532-88563	0	1.0
CP020471_1	1.10\|88593\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88593-88624	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88593-88624	0	1.0
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88654-88685	0	1.0
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88715-88746	0	1.0
CP020471_1	1.13\|88776\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88776-88807	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88776-88807	0	1.0
CP020471_1	1.14\|88837\|32\|CP020471\|CRT	88837-88868	32	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	88837-88868	0	1.0
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	MN284907	Gordonia phage Fireball, complete genome	45453-45484	2	0.938
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	MK814761	Gordonia phage SmokingBunny, complete genome	45115-45146	2	0.938
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	MK305889	Gordonia phage Mutzi, complete genome	46249-46280	2	0.938
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	MH976509	Gordonia phage Bizzy, complete genome	46559-46590	6	0.812
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1496826-1496857	7	0.781
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	282381-282412	7	0.781
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	150519-150550	7	0.781
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_CP053209	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence	75913-75944	7	0.781
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	NZ_CP013105	Paraburkholderia caribensis strain MWAP64 plasmid 2, complete sequence	47442-47473	7	0.781
CP020471_1	1.9\|88532\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88532-88563	32	MN908693	Gordonia phage AnClar, complete genome	40027-40058	7	0.781
CP020471_1	1.9\|88532\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88532-88563	32	MK801725	Gordonia phage Yago84, complete genome	38106-38137	7	0.781
CP020471_1	1.9\|88532\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88532-88563	32	MN234196	Gordonia phage CloverMinnie, complete genome	39428-39459	7	0.781
CP020471_1	1.9\|88532\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88532-88563	32	MT657335	Gordonia phage Mariokart, complete genome	37071-37102	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1237321-1237352	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	1056154-1056185	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	509774-509805	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	694501-694532	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	449977-450008	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	669549-669580	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	646396-646427	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	478166-478197	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	533816-533847	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	521875-521906	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	425899-425930	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1529-1560	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	215734-215765	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	335587-335618	7	0.781
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NC_013930	Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence	168002-168033	7	0.781
CP020471_1	1.13\|88776\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88776-88807	32	MH552540	Microviridae sp. isolate ctdb34, complete genome	415-446	7	0.781
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_008537	Arthrobacter sp. FB24 plasmid 1, complete sequence	40175-40206	8	0.75
CP020471_1	1.2\|88105\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88105-88136	32	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1666768-1666799	8	0.75
CP020471_1	1.6\|88349\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88349-88380	32	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	33914-33945	8	0.75
CP020471_1	1.8\|88471\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88471-88502	32	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	89979-90010	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1147242-1147273	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	823879-823910	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	863516-863547	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1569533-1569564	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	822833-822864	8	0.75
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	MH651182	Gordonia phage Neville, complete genome	6819-6850	8	0.75
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP017944	Phyllobacterium zundukense strain Tri-48 plasmid unnamed4, complete sequence	83246-83277	9	0.719
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1052335-1052366	9	0.719
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	543163-543194	9	0.719
CP020471_1	1.2\|88105\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88105-88136	32	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	784219-784250	9	0.719
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	822611-822642	9	0.719
CP020471_1	1.5\|88288\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88288-88319	32	LR700236	marine metagenome genome assembly, complete genome: monopartite	5527-5558	9	0.719
CP020471_1	1.10\|88593\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88593-88624	32	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	513820-513851	9	0.719
CP020471_1	1.10\|88593\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88593-88624	32	NZ_CP039912	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence	83192-83223	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1003652-1003683	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	195422-195453	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1696533-1696564	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1211350-1211381	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1347641-1347672	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1627261-1627292	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	614720-614751	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1706022-1706053	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1413646-1413677	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1665178-1665209	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1710750-1710781	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1717502-1717533	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1710717-1710748	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1621274-1621305	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1709511-1709542	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1621586-1621617	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1709547-1709578	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1621274-1621305	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1620477-1620508	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1709547-1709578	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	335266-335297	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1709536-1709567	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1621588-1621619	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1602235-1602266	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1657218-1657249	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1695259-1695290	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1709536-1709567	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1621585-1621616	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1710537-1710568	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1709547-1709578	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1709558-1709589	9	0.719
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1709359-1709390	9	0.719
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	193501-193532	9	0.719
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NC_014120	Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence	474938-474969	9	0.719
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	361495-361526	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	432373-432404	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	347780-347811	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	59372-59403	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	439083-439114	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	347780-347811	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	39999-40030	10	0.688
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP043619	Rhodobacteraceae bacterium SH-1 plasmid p1, complete sequence	85386-85417	10	0.688
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP043620	Rhodobacteraceae bacterium SH-1 plasmid p2, complete sequence	19396-19427	10	0.688
CP020471_1	1.3\|88166\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88166-88197	32	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	13131-13162	10	0.688
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	44402-44433	10	0.688
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	275046-275077	10	0.688
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_CP020540	Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence	193410-193441	10	0.688
CP020471_1	1.4\|88227\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88227-88258	32	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	187718-187749	10	0.688
CP020471_1	1.6\|88349\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88349-88380	32	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	181888-181919	10	0.688
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NZ_LR723676	Rhizobium sp. TCK plasmid 2	60691-60722	10	0.688
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	MK967378	Gordonia phage Trax, complete genome	6819-6850	10	0.688
CP020471_1	1.12\|88715\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88715-88746	32	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	24871-24902	10	0.688
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	240914-240945	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	27200-27231	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP024587	Roseomonas sp. FDAARGOS_362 plasmid unnamed3, complete sequence	119046-119077	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	48668-48699	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	64546-64577	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	78870-78901	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	64490-64521	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	118314-118345	11	0.656
CP020471_1	1.1\|88044\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88044-88075	32	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	12481-12512	11	0.656
CP020471_1	1.11\|88654\|32\|CP020471\|PILER-CR,CRISPRCasFinder,CRT	88654-88685	32	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	69104-69135	11	0.656

1. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
tatccggcgccgtcgacccagttgtcggcgtg	Protospacer
********************************

2. spacer 1.2|88105|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

ccgttggcaaaccgtggcaggcaacgacctac	CRISPR spacer
ccgttggcaaaccgtggcaggcaacgacctac	Protospacer
********************************

3. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
gtgatgcaggccatgcgctggtggcccgagga	Protospacer
********************************

4. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
ccggctctgatgacgatcgctaagctgcgcat	Protospacer
********************************

5. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

aacggcaccccagccgcgatgcactgatcgcg	CRISPR spacer
aacggcaccccagccgcgatgcactgatcgcg	Protospacer
********************************

6. spacer 1.6|88349|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

cgccaccacgacaggatgatccggccggaacg	CRISPR spacer
cgccaccacgacaggatgatccggccggaacg	Protospacer
********************************

7. spacer 1.7|88410|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

cgcaaggcttccagtttctactatgacggcat	CRISPR spacer
cgcaaggcttccagtttctactatgacggcat	Protospacer
********************************

8. spacer 1.8|88471|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

gcgcccagcttcggcatttcgatggtgcagtt	CRISPR spacer
gcgcccagcttcggcatttcgatggtgcagtt	Protospacer
********************************

9. spacer 1.9|88532|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

atggtgtcgtcgccccggtcgttttggccgaa	CRISPR spacer
atggtgtcgtcgccccggtcgttttggccgaa	Protospacer
********************************

10. spacer 1.10|88593|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

aatgaatgtcatgtcgatccggtggcgccgcc	CRISPR spacer
aatgaatgtcatgtcgatccggtggcgccgcc	Protospacer
********************************

11. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
atcgtctcggatgcgcttgagggtgcccagca	Protospacer
********************************

12. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
ccacggccgaggatgtgcgcaagctgttccag	Protospacer
********************************

13. spacer 1.13|88776|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtccatcagatcggagttgatggtttcccc	CRISPR spacer
gcgtccatcagatcggagttgatggtttcccc	Protospacer
********************************

14. spacer 1.14|88837|32|CP020471|CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 0, identity: 1.0

ggagagcgtcacagacggtatacccgaccgga	CRISPR spacer
ggagagcgtcacagacggtatacccgaccgga	Protospacer
********************************

15. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MN284907 (Gordonia phage Fireball, complete genome) position: , mismatch: 2, identity: 0.938

aacggcaccccagccgcgatgcactgatcgcg	CRISPR spacer
aacggcaccccagccgcgacgcactggtcgcg	Protospacer
*******************.******.*****

16. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MK814761 (Gordonia phage SmokingBunny, complete genome) position: , mismatch: 2, identity: 0.938

aacggcaccccagccgcgatgcactgatcgcg	CRISPR spacer
aacggcaccccagccgcgacgcactggtcgcg	Protospacer
*******************.******.*****

17. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MK305889 (Gordonia phage Mutzi, complete genome) position: , mismatch: 2, identity: 0.938

aacggcaccccagccgcgatgcactgatcgcg	CRISPR spacer
aacggcaccccagccgcgacgcactggtcgcg	Protospacer
*******************.******.*****

18. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MH976509 (Gordonia phage Bizzy, complete genome) position: , mismatch: 6, identity: 0.812

tatccggcgccgtcgacccagttgtcggcgtg-	CRISPR spacer
ttgtcggcggcgtcggcccagttgtc-gcgtga	Protospacer
*  .***** *****.********** *****

19. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
gagatcacggcgatgcgctggtggcccgcggt	Protospacer
* ***   *** **************** **

20. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 7, identity: 0.781

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
gagatcacggcgatgcgctggtggcccgcggt	Protospacer
* ***   *** **************** **

21. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050084 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence) position: , mismatch: 7, identity: 0.781

--ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
aacagg--cagatgacgatcgcatagctgcgcag	Protospacer
  * **  * ************  *********

22. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053209 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence) position: , mismatch: 7, identity: 0.781

--ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
aacagg--cagatgacgatcgcatagctgcgcag	Protospacer
  * **  * ************  *********

23. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013105 (Paraburkholderia caribensis strain MWAP64 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

aacggc--accccagccgcgatgcactgatcgcg	CRISPR spacer
--tggtcaacaccagccgcgctgcactgatcgcc	Protospacer
  .**.  ** ********* ************

24. spacer 1.9|88532|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MN908693 (Gordonia phage AnClar, complete genome) position: , mismatch: 7, identity: 0.781

atggtgtcgtcgccccggtcgttttggccgaa	CRISPR spacer
atggtctcctcgccccggtcgttgagcacgat	Protospacer
***** ** **************  *  ***

25. spacer 1.9|88532|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MK801725 (Gordonia phage Yago84, complete genome) position: , mismatch: 7, identity: 0.781

atggtgtcgtcgccccggtcgttttggccgaa	CRISPR spacer
atggtctcctcgccccggtcgttgagcacgat	Protospacer
***** ** **************  *  ***

26. spacer 1.9|88532|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MN234196 (Gordonia phage CloverMinnie, complete genome) position: , mismatch: 7, identity: 0.781

atggtgtcgtcgccccggtcgttttggccgaa	CRISPR spacer
atggtctcctcgccccggtcgttgagcacgat	Protospacer
***** ** **************  *  ***

27. spacer 1.9|88532|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MT657335 (Gordonia phage Mariokart, complete genome) position: , mismatch: 7, identity: 0.781

atggtgtcgtcgccccggtcgttttggccgaa	CRISPR spacer
atggtctcctcgccccggtcgttgagcacgac	Protospacer
***** ** **************  *  ***

28. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtgttccag	Protospacer
.* . *  *************** ********

29. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtgttccag	Protospacer
.* . *  *************** ********

30. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

31. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

32. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

33. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

34. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcacgaa	Protospacer
.*** *************** *****. * *.

35. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

36. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcaccgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

37. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcactgccgaggatgtgcgccagctgcgcgaa	Protospacer
.*** *************** *****. * *.

38. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctggaggaggacgtgcgcaaggtgttccag	Protospacer
.* .**  *****.********* ********

39. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctggaggaggacgtgcgcaaggtgttccag	Protospacer
.* .**  *****.********* ********

40. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
ccgatgccgacaatgtgcgcaagctgttctac	Protospacer
**.  ***** .*****************.*

41. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcacggccgacgacgtgcgcaagctcatcgcg	Protospacer
.********* **.***********  **  *

42. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_013930 (Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence) position: , mismatch: 7, identity: 0.781

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
ccgccggtcaggatgtccgcaagctgctccag	Protospacer
**.* * . ******* *********.*****

43. spacer 1.13|88776|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MH552540 (Microviridae sp. isolate ctdb34, complete genome) position: , mismatch: 7, identity: 0.781

gcgtccatcagatcggagttgatggtttcccc	CRISPR spacer
gcgtcaatcagatcggtgttgatgttgctgcc	Protospacer
***** ********** ******* * .. **

44. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_008537 (Arthrobacter sp. FB24 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
taggggtcgccgtcgacccagttgtagtcgac	Protospacer
**   * ****************** * **

45. spacer 1.2|88105|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 8, identity: 0.75

ccgttggcaaaccgtggcaggcaacgacctac	CRISPR spacer
cgggcggcaatccgtggcgggcaacgacattg	Protospacer
* * .***** *******.********* *

46. spacer 1.6|88349|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 8, identity: 0.75

cgccaccacgacaggatgatccggccggaacg	CRISPR spacer
cgagagcacgaccgggtgatccggccggacga	Protospacer
**  * ****** **.*************  .

47. spacer 1.8|88471|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

gcgcccagcttcggcatttcgatggt--gcagtt	CRISPR spacer
ccgctcagcttcggcatgtcgatgtccatcag--	Protospacer
 ***.************ ****** .   ***

48. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtcttccag	Protospacer
.* . *  *************** * ******

49. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtcttccag	Protospacer
.* . *  *************** * ******

50. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtcttccag	Protospacer
.* . *  *************** * ******

51. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtcttccag	Protospacer
.* . *  *************** * ******

52. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
tcctcgaggaggatgtgcgcaaggtcttccag	Protospacer
.* . *  *************** * ******

53. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MH651182 (Gordonia phage Neville, complete genome) position: , mismatch: 8, identity: 0.75

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
accgtgccgagaatgagcgcaagctgttcacg	Protospacer
 *   ******.*** *************  *

54. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017944 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
gcgatggcgccgtcgacccatttgtcgccgcc	Protospacer
    .*************** ****** **.

55. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
aggccggcgacgtcgacccaggtgtcgaagcc	Protospacer
 . ****** *********** *****. *.

56. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 9, identity: 0.719

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
tatccgccgccgtcgacccacttcttcagctc	Protospacer
****** ************* ** *. .  *

57. spacer 1.2|88105|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 9, identity: 0.719

ccgttggcaaaccgtggcaggcaacgacctac	CRISPR spacer
acgttcgcaaaccgtggcaggcaagcttgtgg	Protospacer
 **** ******************   . *.

58. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
ctgatgcaggcgatgcgccggtggccgagttc	Protospacer
 ********** ******.******* ..

59. spacer 1.5|88288|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to LR700236 (marine metagenome genome assembly, complete genome: monopartite) position: , mismatch: 9, identity: 0.719

aacggcaccccagccgcgatgcactgatcgcg	CRISPR spacer
aacggcacgccagccgcgattcatgagcagct	Protospacer
******** *********** **. ... **

60. spacer 1.10|88593|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 9, identity: 0.719

aatgaatgtcatgtcgatccggtggcgccgcc	CRISPR spacer
ggatggtctcatgtctatctggtggcgccgcc	Protospacer
..  ..* ******* ***.************

61. spacer 1.10|88593|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039912 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence) position: , mismatch: 9, identity: 0.719

aatgaatgtcatgtcgatccggtggcgccgcc	CRISPR spacer
ggatggtctcatgtctatctggtggcgccgcc	Protospacer
..  ..* ******* ***.************

62. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

63. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

64. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

65. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

66. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

67. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

68. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

69. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

70. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

71. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

72. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

73. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

74. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

75. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

76. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

77. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

78. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

79. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

80. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

81. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

82. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

83. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

84. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

85. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

86. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

87. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

88. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

89. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

90. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

91. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

92. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

93. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
gccgtcgccgatgcgcttgagggtggcgcccg	Protospacer
..**** * **************** *   *.

94. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
cttaggcgcaggatgtgcgcaagctgtgtgaa	Protospacer
*.  ***  ****************** . *.

95. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_014120 (Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence) position: , mismatch: 9, identity: 0.719

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
gttcggccgctgatgtgcgcaagctggtggaa	Protospacer
 . ******  *************** *  *.

96. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttttcgcccga	Protospacer
.  .******** ********** *** *  .

97. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

98. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

99. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

100. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

101. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

102. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 10, identity: 0.688

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
ccgtcggcgccggcgacccagttctcgcccga	Protospacer
.  .******** ********** *** *  .

103. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043619 (Rhodobacteraceae bacterium SH-1 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
aggatgcaggcgatgcgctgctggcctatatc	Protospacer
. ********* ******** *****.. .

104. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043620 (Rhodobacteraceae bacterium SH-1 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
aggatgcaggcgatgcgctgctggcctatatc	Protospacer
. ********* ******** *****.. .

105. spacer 1.3|88166|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 10, identity: 0.688

gtgatgcaggccatgcgctggtggcccgagga	CRISPR spacer
agggccgaggccatgcgctggtgggacgagct	Protospacer
. *..  *****************  ****

106. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.688

ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
ccggatctgatgacgatggctaaaagcctggc	Protospacer
**** ************ *****.   *  ..

107. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
aaatatcagatgacgatcgccaagctgccgct	Protospacer
  .  ** ************.*******   *

108. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020540 (Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
aaatatcagatgacgatcgccaagctgccgct	Protospacer
  .  ** ************.*******   *

109. spacer 1.4|88227|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 10, identity: 0.688

ccggctctgatgacgatcgctaagctgcgcat	CRISPR spacer
aaatatcagatgacgatcgccaagctgccatt	Protospacer
  .  ** ************.*******   *

110. spacer 1.6|88349|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 10, identity: 0.688

cgccaccacgacaggatgatccggccggaacg	CRISPR spacer
atttcctcggagaggatgatccggccgcaacg	Protospacer
  .. *.  ** *************** ****

111. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 10, identity: 0.688

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
ggaagagcggatgcgcctgagggtgcccggcc	Protospacer
.  .   *********.***********.**

112. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to MK967378 (Gordonia phage Trax, complete genome) position: , mismatch: 10, identity: 0.688

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
atcgtgccgagaatgagcgcaagctgttcact	Protospacer
 .   ******.*** *************

113. spacer 1.12|88715|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ccacggccgaggatgtgcgcaagctgttccag	CRISPR spacer
aggcctccgaggctgtgcgcaagctgctcagc	Protospacer
  .*  ****** *************.** .

114. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
gccttcctcccgtcgatccagatgtcggcgtg	Protospacer
  ...  . *******.**** **********

115. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

116. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024587 (Roseomonas sp. FDAARGOS_362 plasmid unnamed3, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
gccttcctcccgtcgatccagatgtcggcgtg	Protospacer
  ...  . *******.**** **********

117. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

118. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

119. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

120. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

121. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

122. spacer 1.1|88044|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 11, identity: 0.656

tatccggcgccgtcgacccagttgtcggcgtg	CRISPR spacer
cgcagcttgcggtggacccagttgtcggcgtc	Protospacer
...    .** ** *****************

123. spacer 1.11|88654|32|CP020471|PILER-CR,CRISPRCasFinder,CRT matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 11, identity: 0.656

atcgtctcggatgcgcttgagggtgcccagca	CRISPR spacer
ggcgtcgcggatgcgctcgagggtgtggttgg	Protospacer
. **** **********.*******.     .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13167 : 35944

Leptospira_phage(28.57%)

transposase,integrase

attL 13372:13388|attR 40883:40899

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWD23608.1\|13167_13557_+\|transposase	transposase	NA	NA	NA	NA
13372:13388	attL	NA	NA	NA	NA
AWD23609.1\|13553_13907_+\|transposase	IS66 family transposase	S5VXZ8	Leptospira_phage	1.7e-13	36.6
AWD23610.1\|14378_15935_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.5e-96	41.2
AWD23611.1\|15989_16343_-\|transposase	IS66 family transposase	S5VXZ8	Leptospira_phage	1.7e-13	36.6
AWD23612.1\|16339_16729_-\|transposase	transposase	NA	NA	NA	NA
AWD23613.1\|18188_18419_+	hypothetical protein	NA	NA	NA	NA
AWD23614.1\|18399_18858_+	hypothetical protein	A0A077SL39	Escherichia_phage	1.7e-21	43.7
AWD23615.1\|19584_19971_-	hypothetical protein	NA	NA	NA	NA
AWD23616.1\|20030_20255_+	hypothetical protein	NA	NA	NA	NA
AWD23617.1\|20315_20807_-	hypothetical protein	NA	NA	NA	NA
AWD23618.1\|20820_21504_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.4e-40	42.7
AWD23619.1\|21984_22491_+	hypothetical protein	NA	NA	NA	NA
AWD23620.1\|22751_24056_-	restriction endonuclease	NA	NA	NA	NA
AWD23711.1\|24052_26179_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	8.4e-39	49.1
AWD23621.1\|26945_28490_-	cell filamentation protein Fic	NA	NA	NA	NA
AWD23622.1\|30969_33663_+	hypothetical protein	NA	NA	NA	NA
AWD23623.1\|34228_34669_-	hypothetical protein	NA	NA	NA	NA
AWD23624.1\|34867_35068_-	hypothetical protein	NA	NA	NA	NA
AWD23625.1\|35293_35944_-\|integrase	integrase	A0A141E172	Streptococcus_phage	2.7e-12	32.5
40883:40899	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP020470

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP020471

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection