CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP020487	Enterococcus faecium strain CFSAN059070 plasmid unnamed3, complete sequence	0 crisprs	NA	0
CP020484	Enterococcus faecium strain CFSAN059070 chromosome, complete genome	1 crisprs	DEDDh,cas2,RT,DinG,cas3,cas14j,csa3	11
CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	0 crisprs	cas14j,RT,DEDDh	3
CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	0 crisprs	NA	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020484_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020484_1

2401986-2402095

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP020484_1

>merge|CP020484|1|2401986-2402095|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>CP020484|1|1|2401986-2402095|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
CP020484.1\|AWV59325.1\|2404561_2405434_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
CP020484.1\|AWV59314.1\|2393836_2394976_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
CP020484.1\|AWV59313.1\|2392782_2393748_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
CP020484.1\|AWV59324.1\|2403880_2404549_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
CP020484.1\|AWV59326.1\|2405524_2406544_-\|lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
CP020484.1\|AWV59315.1\|2395284_2395998_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP020484.1\|AWV59327.1\|2406716_2407604_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
CP020484.1\|AWV59323.1\|2403115_2403538_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
CP020484.1\|AWV59312.1\|2390573_2392733_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
CP020484.1\|AWV59330.1\|2408520_2408673_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
CP020484.1\|AWV59322.1\|2402322_2403012_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
CP020484.1\|AWV59331.1\|2408834_2409479_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
CP020484.1\|AWV59328.1\|2407680_2408226_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
CP020484.1\|AWV59317.1\|2397186_2398719_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223562
CP020484.1\|AWV59320.1\|2400988_2401357_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
CP020484.1\|AWV59319.1\|2400193_2400883_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
CP020484.1\|AWV59329.1\|2408326_2408497_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
CP020484.1\|AWV59318.1\|2398909_2400112_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP020484.1\|AWV59321.1\|2401409_2401913_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
CP020484.1\|AWV59316.1\|2396251_2396953_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693

Protein	Function_ID	Function_description	E-value
CP020484.1\|AWV59325.1\|2404561_2405434_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
CP020484.1\|AWV59314.1\|2393836_2394976_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
CP020484.1\|AWV59313.1\|2392782_2393748_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
CP020484.1\|AWV59324.1\|2403880_2404549_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
CP020484.1\|AWV59326.1\|2405524_2406544_-\|lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
CP020484.1\|AWV59315.1\|2395284_2395998_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
CP020484.1\|AWV59327.1\|2406716_2407604_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
CP020484.1\|AWV59323.1\|2403115_2403538_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
CP020484.1\|AWV59312.1\|2390573_2392733_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
CP020484.1\|AWV59330.1\|2408520_2408673_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
CP020484.1\|AWV59322.1\|2402322_2403012_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
CP020484.1\|AWV59331.1\|2408834_2409479_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
CP020484.1\|AWV59328.1\|2407680_2408226_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
CP020484.1\|AWV59317.1\|2397186_2398719_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
CP020484.1\|AWV59320.1\|2400988_2401357_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
CP020484.1\|AWV59319.1\|2400193_2400883_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
CP020484.1\|AWV59329.1\|2408326_2408497_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
CP020484.1\|AWV59318.1\|2398909_2400112_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
CP020484.1\|AWV59321.1\|2401409_2401913_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
CP020484.1\|AWV59316.1\|2396251_2396953_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119

>CP020484.1|AWV59321.1|2401409_2401913_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>CP020484.1|AWV59320.1|2400988_2401357_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>CP020484.1|AWV59319.1|2400193_2400883_-|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>CP020484.1|AWV59318.1|2398909_2400112_-|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>CP020484.1|AWV59317.1|2397186_2398719_+|ABC-transporter-ATP-binding-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>CP020484.1|AWV59316.1|2396251_2396953_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>CP020484.1|AWV59315.1|2395284_2395998_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>CP020484.1|AWV59314.1|2393836_2394976_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>CP020484.1|AWV59313.1|2392782_2393748_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>CP020484.1|AWV59312.1|2390573_2392733_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>CP020484.1|AWV59322.1|2402322_2403012_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>CP020484.1|AWV59323.1|2403115_2403538_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>CP020484.1|AWV59324.1|2403880_2404549_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>CP020484.1|AWV59325.1|2404561_2405434_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>CP020484.1|AWV59326.1|2405524_2406544_-|lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKYTKLMD
>CP020484.1|AWV59327.1|2406716_2407604_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>CP020484.1|AWV59328.1|2407680_2408226_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>CP020484.1|AWV59329.1|2408326_2408497_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>CP020484.1|AWV59330.1|2408520_2408673_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>CP020484.1|AWV59331.1|2408834_2409479_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

516753 : 583716

Streptococcus_phage(15.38%)

transposase,integrase,protease,tRNA

attL 512306:512325|attR 590565:590584

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
512306:512325	attL	NA	NA	NA	NA
AWV57559.1\|516753_517875_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AWV57560.1\|518120_519542_+	arginine-ornithine antiporter	NA	NA	NA	NA
AWV57561.1\|519555_520674_+	aminotransferase	NA	NA	NA	NA
AWV57562.1\|520733_522026_-	MFS transporter	NA	NA	NA	NA
AWV59757.1\|522175_522736_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV57563.1\|522864_523242_+	DUF1033 family protein	NA	NA	NA	NA
AWV57564.1\|523174_525247_+	DNA topoisomerase III	NA	NA	NA	NA
AWV57565.1\|525457_526405_-	glycosyltransferase	V5USA4	Oenococcus_phage	5.0e-84	51.0
AWV57566.1\|526650_527115_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-18	38.7
AWV57567.1\|527176_528220_-	putative sulfate exporter family transporter	NA	NA	NA	NA
AWV57568.1\|528596_529562_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AWV57569.1\|529795_530641_+	LysR family transcriptional regulator	NA	NA	NA	NA
AWV57570.1\|530649_530847_+	hypothetical protein	NA	NA	NA	NA
AWV57571.1\|530831_532019_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AWV57572.1\|532024_532381_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.7e-22	42.3
AWV57573.1\|532382_532721_+	glycine cleavage system protein H	NA	NA	NA	NA
AWV59758.1\|533115_534150_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-28	35.1
AWV57574.1\|534142_534829_+	ABC transporter permease	NA	NA	NA	NA
AWV57575.1\|534852_535701_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV57576.1\|535897_536671_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.1e-08	28.8
AWV57577.1\|536683_537970_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AWV57578.1\|537966_539202_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-113	47.7
AWV57579.1\|539188_539659_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
AWV57580.1\|539663_541055_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AWV57581.1\|541170_542466_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV57582.1\|542671_543814_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.3e-58	34.8
AWV57583.1\|543852_544587_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV57584.1\|544588_544774_+	hypothetical protein	NA	NA	NA	NA
AWV57585.1\|544818_545094_+	DNA-binding protein	NA	NA	NA	NA
AWV57586.1\|545191_547189_+	hypothetical protein	A0A1Z1LZK7	Bacillus_phage	5.5e-24	24.4
AWV57587.1\|547264_547600_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV57588.1\|547978_548341_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AWV57589.1\|548386_548713_+	hypothetical protein	NA	NA	NA	NA
AWV57590.1\|549048_549276_+	hypothetical protein	NA	NA	NA	NA
AWV57591.1\|549555_551379_+	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
AWV57592.1\|551392_552802_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	3.2e-42	27.6
AWV59759.1\|552819_553656_+	PRD domain-containing protein	NA	NA	NA	NA
AWV57593.1\|553720_554503_+	hypothetical protein	NA	NA	NA	NA
AWV57594.1\|554906_556032_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
AWV57595.1\|557384_557585_+	sensor histidine kinase	NA	NA	NA	NA
AWV57596.1\|557660_557858_+	hypothetical protein	NA	NA	NA	NA
AWV57597.1\|557806_558037_+	hypothetical protein	NA	NA	NA	NA
AWV57598.1\|558154_559702_-	bifunctional metallophosphatase/5'-nucleotidase	S4VPC4	Pandoravirus	4.6e-10	25.7
AWV57599.1\|559785_560589_-	metallophosphoesterase	NA	NA	NA	NA
AWV57600.1\|560591_561374_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWV57601.1\|561370_562150_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWV57602.1\|562121_562913_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-21	39.4
AWV57603.1\|562973_563903_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV57604.1\|564097_564781_+	cyclic nucleotide-binding protein	NA	NA	NA	NA
AWV57605.1\|564941_565985_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV57606.1\|567924_569103_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV57607.1\|569323_570232_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV57608.1\|570360_570960_+	DUF1819 family protein	NA	NA	NA	NA
AWV57609.1\|570959_571535_+	DUF1788 domain-containing protein	NA	NA	NA	NA
AWV57610.1\|571559_575231_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
AWV57611.1\|575294_578927_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
AWV59760.1\|579042_581565_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
AWV57612.1\|581682_583716_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
590565:590584	attR	NA	NA	NA	NA

DBSCAN-SWA_2

726195 : 734667

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV57744.1\|726195_726840_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
AWV57745.1\|726854_727184_+	hypothetical protein	NA	NA	NA	NA
AWV57746.1\|727197_728136_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
AWV57747.1\|728171_728996_+	signal peptidase	NA	NA	NA	NA
AWV57748.1\|728988_729336_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
AWV57749.1\|729404_730277_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
AWV57750.1\|730385_731507_+	DNA polymerase IV	NA	NA	NA	NA
AWV57751.1\|731560_732163_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
AWV57752.1\|732477_734667_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_3

787676 : 885190

112

uncultured_Caudovirales_phage(13.95%)

portal,terminase,holin,protease,transposase,head,tRNA,tail,plate,integrase,capsid

attL 780948:780963|attR 821749:821764

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
780948:780963	attL	NA	NA	NA	NA
AWV57806.1\|787676_790475_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
AWV57807.1\|790523_792050_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
AWV57808.1\|792064_792712_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
AWV59770.1\|792895_793225_-	DUF4828 domain-containing protein	NA	NA	NA	NA
AWV57809.1\|793401_794130_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
AWV57810.1\|794145_795159_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AWV57811.1\|795158_796436_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
AWV57812.1\|796498_799201_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
AWV57813.1\|799352_799670_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AWV57814.1\|799699_800020_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
AWV57815.1\|800127_801588_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV57816.1\|801655_801877_+	hypothetical protein	NA	NA	NA	NA
AWV57817.1\|801907_802090_+	DUF3188 domain-containing protein	NA	NA	NA	NA
AWV57818.1\|802089_802503_+	DUF3284 domain-containing protein	NA	NA	NA	NA
AWV57819.1\|802625_803807_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV57820.1\|804337_805477_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
AWV57821.1\|805775_806411_-	hypothetical protein	NA	NA	NA	NA
AWV57822.1\|806523_807159_-	DUF3221 domain-containing protein	NA	NA	NA	NA
AWV57823.1\|807192_807654_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
AWV57824.1\|807783_808215_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV57825.1\|808232_808553_-	XRE family transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
AWV57826.1\|808851_809628_+	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
AWV57827.1\|809642_809846_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV57828.1\|809861_810200_+	DUF771 domain-containing protein	NA	NA	NA	NA
AWV57829.1\|810186_810366_+	hypothetical protein	NA	NA	NA	NA
AWV59771.1\|810408_810879_-	hypothetical protein	NA	NA	NA	NA
AWV57830.1\|810965_811664_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
AWV57831.1\|811841_812183_+	hypothetical protein	NA	NA	NA	NA
AWV57832.1\|812175_812847_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
AWV57833.1\|812852_813545_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
AWV57834.1\|813541_814291_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
AWV57835.1\|814302_814572_+	hypothetical protein	NA	NA	NA	NA
AWV57836.1\|814734_815034_+	hypothetical protein	NA	NA	NA	NA
AWV57837.1\|815033_815336_+	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	70.7
AWV57838.1\|815375_815741_+	hypothetical protein	NA	NA	NA	NA
AWV57839.1\|816367_816550_+	hypothetical protein	NA	NA	NA	NA
AWV57840.1\|816562_816757_+	hypothetical protein	NA	NA	NA	NA
AWV57841.1\|816789_817002_-	hypothetical protein	NA	NA	NA	NA
AWV57842.1\|817126_817330_+	hypothetical protein	NA	NA	NA	NA
AWV57843.1\|817326_817599_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.5e-20	61.6
AWV57844.1\|817599_817785_+	hypothetical protein	NA	NA	NA	NA
AWV57845.1\|818078_818555_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	50.8
AWV57846.1\|818546_818732_-	hypothetical protein	NA	NA	NA	NA
AWV57847.1\|818700_819429_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-58	52.4
AWV57848.1\|819476_819755_+	hypothetical protein	NA	NA	NA	NA
AWV57849.1\|819756_820143_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	1.9e-10	36.7
AWV57850.1\|820139_820520_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
AWV57851.1\|820631_821084_+\|terminase	terminase small subunit	A0A2H4JFK0	uncultured_Caudovirales_phage	6.8e-47	66.2
AWV57852.1\|821080_822808_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	6.9e-265	73.3
821749:821764	attR	NA	NA	NA	NA
AWV57853.1\|822829_824059_+\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	1.7e-145	65.0
AWV57854.1\|824024_824600_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.6e-69	71.7
AWV57855.1\|824612_825977_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	69.1
AWV57856.1\|825978_826260_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	4.7e-22	62.7
AWV57857.1\|826237_826564_+\|head,tail	phage head-tail joining protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
AWV57858.1\|826553_826892_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.6e-22	45.9
AWV57859.1\|826881_827247_+	hypothetical protein	NA	NA	NA	NA
AWV57860.1\|827253_827880_+\|tail	phage tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	5.7e-28	34.5
AWV57861.1\|827879_828344_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.4e-15	38.9
AWV57862.1\|828538_830848_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	5.5e-84	50.1
AWV59772.1\|830859_831564_+\|tail	phage tail protein	NA	NA	NA	NA
AWV57863.1\|831560_834320_+	CHAP domain-containing protein	D7RWE0	Brochothrix_phage	1.6e-50	55.7
AWV57864.1\|834332_835241_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
AWV57865.1\|835240_835858_+	hypothetical protein	NA	NA	NA	NA
AWV57866.1\|835861_836311_+	hypothetical protein	NA	NA	NA	NA
AWV57867.1\|836310_836805_+	hypothetical protein	NA	NA	NA	NA
AWV57868.1\|836818_837250_+	hypothetical protein	NA	NA	NA	NA
AWV57869.1\|837251_837389_+	XkdX family protein	NA	NA	NA	NA
AWV57870.1\|837425_837719_+	hypothetical protein	NA	NA	NA	NA
AWV57871.1\|837715_837940_+\|holin	holin	NA	NA	NA	NA
AWV57872.1\|837936_838956_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
AWV57873.1\|839732_840032_-	hypothetical protein	NA	NA	NA	NA
AWV57874.1\|840037_840268_-	hypothetical protein	NA	NA	NA	NA
AWV57875.1\|840517_840718_-	hypothetical protein	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
AWV57876.1\|841034_842222_+\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AWV57877.1\|842496_843729_-	aminopeptidase	NA	NA	NA	NA
AWV57878.1\|843983_844553_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV57879.1\|844730_845171_-	flavodoxin	NA	NA	NA	NA
AWV57880.1\|845328_846093_+	type I methionyl aminopeptidase	NA	NA	NA	NA
AWV57881.1\|846124_847048_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
AWV57882.1\|847123_848263_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
AWV57883.1\|848255_849056_+	glycosyltransferase	NA	NA	NA	NA
AWV57884.1\|849055_849883_+	glycosyltransferase	NA	NA	NA	NA
AWV57885.1\|849860_850595_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AWV57886.1\|850694_851561_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	3.7e-102	62.5
AWV57887.1\|851574_852147_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
AWV57888.1\|852168_853197_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
AWV57889.1\|853294_854146_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
AWV57890.1\|854179_856213_+	hypothetical protein	NA	NA	NA	NA
AWV57891.1\|856256_857537_+	hypothetical protein	NA	NA	NA	NA
AWV57892.1\|857746_858553_+	ABC transporter permease	NA	NA	NA	NA
AWV57893.1\|858564_859785_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
AWV57894.1\|859774_861361_+	methyltransferase domain-containing protein	NA	NA	NA	NA
AWV57895.1\|861399_863538_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AWV57896.1\|863905_864889_-	serine hydrolase	NA	NA	NA	NA
AWV57897.1\|865266_866658_+	sugar transferase	NA	NA	NA	NA
AWV57898.1\|866673_867714_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
AWV57899.1\|867732_868818_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
AWV57900.1\|868850_869813_+	glycosyl transferase	NA	NA	NA	NA
AWV57901.1\|869805_871233_+	O-antigen ligase domain-containing protein	NA	NA	NA	NA
AWV57902.1\|871234_872305_+	hypothetical protein	NA	NA	NA	NA
AWV57903.1\|872291_873713_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV57904.1\|873725_874733_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
AWV57905.1\|874744_875749_+	N-acetylneuraminate synthase	NA	NA	NA	NA
AWV57906.1\|875745_876894_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
AWV57907.1\|876866_877544_+	transferase	NA	NA	NA	NA
AWV57908.1\|877533_878676_+	pyridoxal phosphate-dependent aminotransferase	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
AWV57909.1\|878688_879666_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AWV57910.1\|879665_880574_+	dehydrogenase	NA	NA	NA	NA
AWV57911.1\|880574_881327_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
AWV57912.1\|881331_882279_+	UDP-glucose 4-epimerase	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
AWV57913.1\|882452_883748_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	37.2
AWV57914.1\|884236_885190_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1160537 : 1170080

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV58164.1\|1160537_1161926_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	7.0e-10	26.0
AWV58165.1\|1162293_1162482_-	hypothetical protein	NA	NA	NA	NA
AWV58166.1\|1162494_1162872_-	hypothetical protein	NA	NA	NA	NA
AWV58167.1\|1163127_1163856_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
AWV58168.1\|1163855_1164110_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AWV58169.1\|1164111_1164783_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AWV58170.1\|1164783_1167006_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
AWV58171.1\|1166990_1168430_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
AWV59782.1\|1168461_1169505_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
AWV58172.1\|1169501_1170080_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1331421 : 1399215

Streptococcus_phage(33.33%)

tail,transposase,integrase

attL 1368760:1368776|attR 1393792:1393808

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV58319.1\|1331421_1332375_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV58320.1\|1332424_1333048_+	hypothetical protein	NA	NA	NA	NA
AWV58321.1\|1333497_1334547_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV58322.1\|1334543_1335425_+	ABC transporter permease	NA	NA	NA	NA
AWV58323.1\|1335427_1336198_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-09	27.3
AWV58324.1\|1336476_1337331_+	shikimate dehydrogenase	NA	NA	NA	NA
AWV58325.1\|1337508_1338672_+	LytR family transcriptional regulator	NA	NA	NA	NA
AWV58326.1\|1338788_1339199_+	VOC family protein	NA	NA	NA	NA
AWV58327.1\|1339372_1341601_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-128	52.6
AWV58328.1\|1341738_1342056_+	hypothetical protein	NA	NA	NA	NA
AWV58329.1\|1342215_1342452_+	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV58330.1\|1342448_1342847_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
AWV58331.1\|1343513_1344458_-	L-lactate dehydrogenase	NA	NA	NA	NA
AWV59791.1\|1344753_1345698_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV58332.1\|1345917_1347132_+	MFS transporter	NA	NA	NA	NA
AWV58333.1\|1347153_1349169_+	alpha-rhamnosidase	NA	NA	NA	NA
AWV58334.1\|1349251_1350625_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
AWV58335.1\|1350650_1350935_-	PTS lactose transporter subunit IIB	NA	NA	NA	NA
AWV58336.1\|1350936_1352952_-	PRD domain-containing protein	NA	NA	NA	NA
AWV58337.1\|1353130_1353436_-	rRNA processing protein	NA	NA	NA	NA
AWV58338.1\|1354761_1355637_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV58339.1\|1355788_1356631_-	class C sortase	NA	NA	NA	NA
AWV58340.1\|1356722_1358600_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV58341.1\|1358596_1360018_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV58342.1\|1360020_1363410_-	VWA domain-containing protein	NA	NA	NA	NA
AWV59792.1\|1363666_1365058_+	HTH domain-containing protein	NA	NA	NA	NA
AWV58343.1\|1364988_1365180_-	hypothetical protein	NA	NA	NA	NA
AWV58344.1\|1365186_1366461_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.2e-57	36.4
AWV58345.1\|1366639_1367287_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV58346.1\|1367294_1367981_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-29	37.0
AWV58347.1\|1367986_1369060_-	ABC transporter permease	NA	NA	NA	NA
1368760:1368776	attL	NA	NA	NA	NA
AWV58348.1\|1369281_1369956_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-29	35.3
AWV58349.1\|1369960_1371301_+	sensor histidine kinase	NA	NA	NA	NA
AWV58350.1\|1371449_1372436_-	DUF2382 domain-containing protein	NA	NA	NA	NA
AWV58351.1\|1373159_1374191_+\|integrase	integrase	NA	NA	NA	NA
AWV58352.1\|1374299_1375832_+	acetate--CoA ligase	NA	NA	NA	NA
AWV58353.1\|1375970_1376783_+	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AWV58354.1\|1376772_1377258_+	ECF transporter S component	NA	NA	NA	NA
AWV58355.1\|1377280_1377826_+	TIGR01440 family protein	NA	NA	NA	NA
AWV58356.1\|1377898_1379542_-	alpha-glucosidase	NA	NA	NA	NA
AWV58357.1\|1379670_1381899_-	VWA domain-containing protein	NA	NA	NA	NA
AWV58358.1\|1381931_1382411_-	hypothetical protein	NA	NA	NA	NA
AWV58359.1\|1382675_1383635_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV58360.1\|1383803_1385099_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
AWV58361.1\|1385217_1386066_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	9.8e-15	37.4
AWV58362.1\|1386222_1387833_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV58363.1\|1388076_1388394_-	AzlD domain-containing protein	NA	NA	NA	NA
AWV58364.1\|1388386_1389166_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AWV58365.1\|1389298_1390234_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
AWV58366.1\|1390309_1390702_-	DUF4430 domain-containing protein	NA	NA	NA	NA
AWV58367.1\|1390682_1391201_-	hypothetical protein	NA	NA	NA	NA
AWV58368.1\|1391348_1392422_-	hypothetical protein	NA	NA	NA	NA
AWV58369.1\|1392414_1393332_-	viral A-type inclusion protein	NA	NA	NA	NA
AWV58370.1\|1393534_1393726_-	hypothetical protein	NA	NA	NA	NA
AWV58371.1\|1393884_1395393_+	DUF1846 domain-containing protein	NA	NA	NA	NA
1393792:1393808	attR	NA	NA	NA	NA
AWV58372.1\|1395628_1396810_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AWV58373.1\|1396898_1397447_+	guanylate kinase	S4W1R9	Pandoravirus	3.3e-11	29.4
AWV58374.1\|1397702_1398215_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV58375.1\|1398258_1399215_-\|tail	phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_6

1445886 : 1488571

Streptococcus_phage(23.08%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV58419.1\|1445886_1447035_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
AWV58420.1\|1447051_1447456_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV58421.1\|1448572_1449046_+	DUF2975 domain-containing protein	NA	NA	NA	NA
AWV58422.1\|1449054_1449282_+	transcriptional regulator	NA	NA	NA	NA
AWV58423.1\|1449917_1450289_+	hypothetical protein	NA	NA	NA	NA
AWV58424.1\|1450544_1450787_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AWV58425.1\|1450818_1451721_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
AWV58426.1\|1451733_1451922_-	DUF2273 domain-containing protein	NA	NA	NA	NA
AWV58427.1\|1451935_1452499_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
AWV58428.1\|1452536_1453430_-	SDR family NAD(P)-dependent oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
AWV58429.1\|1453507_1454446_-	magnesium transporter CorA family protein	NA	NA	NA	NA
AWV58430.1\|1454479_1454830_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
AWV58431.1\|1454862_1455765_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
AWV58432.1\|1455757_1456615_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
AWV58433.1\|1456948_1457758_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AWV58434.1\|1457797_1458295_+	cysteine hydrolase	NA	NA	NA	NA
AWV58435.1\|1458939_1459263_+	hypothetical protein	NA	NA	NA	NA
AWV58436.1\|1459426_1459681_+	hypothetical protein	NA	NA	NA	NA
AWV58437.1\|1459750_1459996_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV58438.1\|1460071_1460437_+	hypothetical protein	NA	NA	NA	NA
AWV58439.1\|1460497_1461061_-	hypothetical protein	NA	NA	NA	NA
AWV58440.1\|1461712_1463008_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV58441.1\|1463028_1463208_+	hypothetical protein	NA	NA	NA	NA
AWV58442.1\|1463246_1464548_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
AWV58443.1\|1464651_1464852_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
AWV58444.1\|1465603_1466317_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
AWV58445.1\|1466309_1467395_-	mannonate dehydratase	NA	NA	NA	NA
AWV58446.1\|1467411_1467855_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV59794.1\|1467888_1468242_-	hypothetical protein	NA	NA	NA	NA
AWV58447.1\|1468353_1468755_-	hypothetical protein	NA	NA	NA	NA
AWV58448.1\|1468791_1469301_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV58449.1\|1469322_1470180_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV58450.1\|1470197_1471031_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV58451.1\|1471044_1471842_-	oxidoreductase	NA	NA	NA	NA
AWV58452.1\|1471874_1472159_-	alcohol dehydrogenase	NA	NA	NA	NA
AWV58453.1\|1472155_1473157_-	hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
AWV59795.1\|1473158_1474061_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
AWV58454.1\|1474224_1475073_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV58455.1\|1475718_1475925_+	DUF3955 domain-containing protein	NA	NA	NA	NA
AWV58456.1\|1476126_1477128_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
AWV58457.1\|1477132_1479046_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58458.1\|1479213_1479720_-	cysteine hydrolase	NA	NA	NA	NA
AWV58459.1\|1479879_1480320_+	transcriptional regulator	NA	NA	NA	NA
AWV58460.1\|1480345_1481503_-	hypothetical protein	NA	NA	NA	NA
AWV58461.1\|1481505_1481862_-	hypothetical protein	NA	NA	NA	NA
AWV58462.1\|1482159_1483134_-	peptidase	NA	NA	NA	NA
AWV58463.1\|1483329_1484169_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWV58464.1\|1484353_1485241_+	rotamase	NA	NA	NA	NA
AWV59796.1\|1485834_1486530_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
AWV58465.1\|1486513_1486912_-	PTS sorbitol transporter subunit IIA	NA	NA	NA	NA
AWV58466.1\|1487320_1488571_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_7

1496421 : 1543259

Streptococcus_phage(44.44%)

transposase,integrase

attL 1491611:1491626|attR 1501332:1501347

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1491611:1491626	attL	NA	NA	NA	NA
AWV58478.1\|1496421_1497600_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV58479.1\|1497755_1498709_-\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV58480.1\|1498765_1499893_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
AWV58481.1\|1500110_1501253_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-39	32.4
AWV58482.1\|1501257_1501443_-	DUF3173 domain-containing protein	NA	NA	NA	NA
1501332:1501347	attR	NA	NA	NA	NA
AWV58483.1\|1501796_1502042_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV58484.1\|1502035_1502437_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV58485.1\|1502623_1504432_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	2.3e-154	48.4
AWV58486.1\|1504454_1506221_-	beta-hexosaminidase	NA	NA	NA	NA
AWV58487.1\|1506233_1507028_-	HAD family hydrolase	NA	NA	NA	NA
AWV58488.1\|1507037_1508414_-	MFS transporter	NA	NA	NA	NA
AWV58489.1\|1508533_1509181_-	bifunctional 2-keto-4-hydroxyglutarate aldolase/2-keto-3-deoxy-6-phosphogluconate aldolase	NA	NA	NA	NA
AWV58490.1\|1509264_1510692_-	glucuronate isomerase	NA	NA	NA	NA
AWV58491.1\|1510765_1511845_-	mannonate dehydratase	NA	NA	NA	NA
AWV58492.1\|1511847_1513479_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
AWV58493.1\|1513782_1514454_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV58494.1\|1515466_1516786_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
AWV58495.1\|1517294_1517747_-	hypothetical protein	NA	NA	NA	NA
AWV58496.1\|1517753_1518302_-	peptidase	NA	NA	NA	NA
AWV58497.1\|1518555_1519875_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
AWV58498.1\|1520030_1520363_-	hypothetical protein	NA	NA	NA	NA
AWV58499.1\|1520376_1520634_-	hypothetical protein	NA	NA	NA	NA
AWV59797.1\|1520828_1521371_-	hypothetical protein	NA	NA	NA	NA
AWV58500.1\|1521391_1522471_-	CHAP domain-containing protein	A0A0B5A7F4	Streptococcus_phage	4.6e-25	29.9
AWV58501.1\|1522489_1524700_-	hypothetical protein	NA	NA	NA	NA
AWV58502.1\|1524715_1527244_-	ATPase	NA	NA	NA	NA
AWV58503.1\|1527295_1527706_-	hypothetical protein	NA	NA	NA	NA
AWV58504.1\|1527718_1527937_-	hypothetical protein	NA	NA	NA	NA
AWV58505.1\|1527933_1528926_-	conjugal transfer protein	NA	NA	NA	NA
AWV58506.1\|1529004_1529916_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58507.1\|1529934_1530279_-	hypothetical protein	NA	NA	NA	NA
AWV58508.1\|1530935_1531436_-	hypothetical protein	NA	NA	NA	NA
AWV58509.1\|1531436_1531982_-	hypothetical protein	NA	NA	NA	NA
AWV58510.1\|1531978_1533235_-	transcriptional regulator	NA	NA	NA	NA
AWV58511.1\|1533595_1533907_-	hypothetical protein	NA	NA	NA	NA
AWV59798.1\|1533929_1535240_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.3e-61	36.8
AWV58512.1\|1535853_1536306_-	hypothetical protein	NA	NA	NA	NA
AWV58513.1\|1536307_1536673_-	hypothetical protein	NA	NA	NA	NA
AWV59799.1\|1536771_1540071_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58514.1\|1541201_1541441_-	hypothetical protein	NA	NA	NA	NA
AWV58515.1\|1541530_1541803_-	hypothetical protein	A0A1W6JN36	Lactococcus_phage	1.6e-19	57.4
AWV58516.1\|1541885_1542137_-	hypothetical protein	D2IZL0	Enterococcus_phage	1.1e-06	58.5
AWV58517.1\|1542299_1543259_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1647454 : 1769657

110

Streptococcus_phage(35.14%)

transposase,tRNA,protease,integrase

attL 1660015:1660032|attR 1683501:1683518

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV58608.1\|1647454_1648408_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV58609.1\|1648404_1648986_-	DUF443 family protein	NA	NA	NA	NA
AWV58610.1\|1649172_1649823_-	hypothetical protein	NA	NA	NA	NA
AWV58611.1\|1649813_1650014_-	hypothetical protein	NA	NA	NA	NA
AWV58612.1\|1650365_1651301_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.0e-53	39.1
AWV58613.1\|1651334_1652333_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.6e-115	62.9
AWV58614.1\|1652329_1653214_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.4e-08	31.4
AWV58615.1\|1653348_1654080_-	amino acid racemase	NA	NA	NA	NA
AWV58616.1\|1654083_1655349_-	D-aspartate ligase	NA	NA	NA	NA
AWV58617.1\|1655611_1658428_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.6e-311	57.4
AWV58618.1\|1658437_1660432_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
1660015:1660032	attL	NA	NA	NA	NA
AWV58619.1\|1660690_1662193_+	ABC transporter permease subunit	NA	NA	NA	NA
AWV58620.1\|1662194_1662932_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-34	44.7
AWV58621.1\|1663102_1664296_-\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	3.9e-142	63.8
AWV58622.1\|1664374_1664581_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
AWV58623.1\|1664573_1665716_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.5e-63	35.4
AWV58624.1\|1666227_1666863_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV58625.1\|1667368_1667455_+	tetracycline resistance protein	NA	NA	NA	NA
AWV58626.1\|1667470_1669390_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
AWV58627.1\|1669490_1669676_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
AWV58628.1\|1669735_1670089_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
AWV59801.1\|1670293_1670365_+	hypothetical protein	NA	NA	NA	NA
AWV58629.1\|1670592_1671012_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV58630.1\|1671037_1671244_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV58631.1\|1671656_1672286_+	sugar diacid utilization regulator	NA	NA	NA	NA
AWV58632.1\|1672367_1673534_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7
AWV58633.1\|1673684_1675514_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-136	48.8
AWV58634.1\|1675564_1676128_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AWV58635.1\|1676221_1677265_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AWV58636.1\|1678679_1678907_-	adenosine deaminase	NA	NA	NA	NA
AWV58637.1\|1679390_1679981_+	glutamine amidotransferase	NA	NA	NA	NA
AWV58638.1\|1680170_1680884_+	hypothetical protein	NA	NA	NA	NA
AWV58639.1\|1681063_1682359_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV58640.1\|1682520_1683531_-	LD-carboxypeptidase	NA	NA	NA	NA
1683501:1683518	attR	NA	NA	NA	NA
AWV58641.1\|1683567_1684050_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
AWV58642.1\|1684199_1684568_+	iron chaperone	NA	NA	NA	NA
AWV58643.1\|1685032_1685485_+	DNA-binding protein	NA	NA	NA	NA
AWV58644.1\|1685608_1686460_-	sugar transporter	NA	NA	NA	NA
AWV58645.1\|1686472_1687258_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AWV58646.1\|1687609_1688551_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
AWV58647.1\|1688554_1689478_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AWV58648.1\|1692655_1692829_+	sugar ABC transporter permease	NA	NA	NA	NA
AWV58649.1\|1693099_1694395_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV58650.1\|1694589_1694937_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
AWV58651.1\|1694963_1697270_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
AWV58652.1\|1697282_1697594_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
AWV58653.1\|1697590_1697884_-	YlxR family protein	NA	NA	NA	NA
AWV58654.1\|1697905_1699081_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AWV58655.1\|1699103_1699577_-	ribosome maturation factor RimP	NA	NA	NA	NA
AWV58656.1\|1699721_1704080_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.9e-21	40.8
AWV58657.1\|1704291_1706001_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AWV58658.1\|1706068_1707337_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AWV58659.1\|1707497_1708298_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AWV58660.1\|1708294_1709107_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
AWV58661.1\|1709515_1710766_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV58662.1\|1711097_1712270_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV58663.1\|1712416_1712974_-	ribosome recycling factor	NA	NA	NA	NA
AWV58664.1\|1712976_1713699_-	UMP kinase	NA	NA	NA	NA
AWV58665.1\|1713834_1714716_-	elongation factor Ts	NA	NA	NA	NA
AWV58666.1\|1714814_1715597_-	30S ribosomal protein S2	NA	NA	NA	NA
AWV58667.1\|1715955_1716435_+	ArgR family transcriptional regulator	NA	NA	NA	NA
AWV59802.1\|1716651_1717743_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
AWV58668.1\|1718866_1720558_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
AWV58669.1\|1720977_1721925_-	carbamate kinase	NA	NA	NA	NA
AWV58670.1\|1722039_1723059_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AWV58671.1\|1723149_1724379_-	arginine deiminase	NA	NA	NA	NA
AWV58672.1\|1724839_1725541_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AWV58673.1\|1726149_1727166_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
AWV58674.1\|1727162_1727627_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AWV58675.1\|1727633_1728176_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AWV59803.1\|1728159_1728984_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AWV58676.1\|1729072_1730053_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
AWV58677.1\|1730076_1731561_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AWV58678.1\|1731572_1732562_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
AWV58679.1\|1732809_1732977_+	DUF3042 family protein	NA	NA	NA	NA
AWV58680.1\|1733038_1734850_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AWV58681.1\|1734846_1735212_-	DUF488 family protein	NA	NA	NA	NA
AWV58682.1\|1735374_1735770_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AWV58683.1\|1735787_1736750_-	ROK family protein	NA	NA	NA	NA
AWV58684.1\|1736749_1736962_-	DUF910 family protein	NA	NA	NA	NA
AWV58685.1\|1736982_1737681_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AWV58686.1\|1737700_1738243_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AWV58687.1\|1738374_1739379_-	iron ABC transporter permease	NA	NA	NA	NA
AWV58688.1\|1739375_1740365_-	iron ABC transporter permease	NA	NA	NA	NA
AWV58689.1\|1740361_1741168_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
AWV58690.1\|1741333_1742290_+	ferrichrome ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV58691.1\|1742366_1742885_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
AWV58692.1\|1742972_1743122_-	50S ribosomal protein L33	NA	NA	NA	NA
AWV58693.1\|1743349_1743796_+	DUF2188 domain-containing protein	NA	NA	NA	NA
AWV58694.1\|1743990_1745886_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
AWV58695.1\|1746210_1747185_-	linear amide C-N hydrolase	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
AWV58696.1\|1747750_1748317_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV58697.1\|1748572_1749904_+	DUF1576 domain-containing protein	NA	NA	NA	NA
AWV58698.1\|1749869_1750220_+	hypothetical protein	NA	NA	NA	NA
AWV58699.1\|1750731_1751076_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AWV58700.1\|1751341_1752301_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV58701.1\|1752490_1753087_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
AWV58702.1\|1753210_1755010_+	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
AWV58703.1\|1755287_1755500_-	hypothetical protein	NA	NA	NA	NA
AWV58704.1\|1756363_1757323_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
AWV58705.1\|1757535_1758444_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV58706.1\|1758492_1758879_+	YxeA family protein	NA	NA	NA	NA
AWV58707.1\|1759186_1760533_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
AWV58708.1\|1760644_1761994_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
AWV58709.1\|1762110_1763364_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
AWV58710.1\|1763434_1763920_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AWV58711.1\|1763942_1764701_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
AWV58712.1\|1764716_1765895_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
AWV58713.1\|1766124_1768245_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
AWV58714.1\|1768361_1769657_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_9

1775360 : 1946375

184

Streptococcus_phage(21.13%)

portal,transposase,holin,protease,terminase,head,tRNA,tail,integrase,capsid

attL 1768280:1768339|attR 1930903:1932416

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1768280:1768339	attL	NA	NA	NA	NA
AWV58721.1\|1775360_1776656_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV58722.1\|1776974_1777277_+	hypothetical protein	NA	NA	NA	NA
AWV58723.1\|1778024_1778207_+	hypothetical protein	NA	NA	NA	NA
AWV58724.1\|1778420_1778735_-	hypothetical protein	NA	NA	NA	NA
AWV58725.1\|1778851_1780030_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV58726.1\|1780366_1780606_+	hypothetical protein	NA	NA	NA	NA
AWV58727.1\|1780967_1781228_-	hypothetical protein	NA	NA	NA	NA
AWV58728.1\|1781412_1781910_-	GAF domain-containing protein	NA	NA	NA	NA
AWV58729.1\|1782039_1782750_-	acetolactate decarboxylase	NA	NA	NA	NA
AWV58730.1\|1782762_1784427_-	acetolactate synthase AlsS	NA	NA	NA	NA
AWV58731.1\|1784631_1785294_-	DUF624 domain-containing protein	NA	NA	NA	NA
AWV58732.1\|1785303_1786119_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV58733.1\|1786380_1786824_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWV58734.1\|1786957_1787296_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWV58735.1\|1787283_1787661_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWV58736.1\|1787884_1789078_+	MFS transporter	NA	NA	NA	NA
AWV58737.1\|1789243_1789666_-	HTH domain-containing protein	NA	NA	NA	NA
AWV59804.1\|1790060_1790255_+	hypothetical protein	NA	NA	NA	NA
AWV58738.1\|1790251_1790746_+	hypothetical protein	NA	NA	NA	NA
AWV58739.1\|1790713_1790911_-	hypothetical protein	NA	NA	NA	NA
AWV58740.1\|1790907_1792080_-	class C sortase	NA	NA	NA	NA
AWV58741.1\|1792285_1793101_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58742.1\|1793250_1793697_-	cell wall anchor protein	NA	NA	NA	NA
AWV58743.1\|1793693_1794707_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV58744.1\|1794737_1795196_-	cell wall anchor protein	NA	NA	NA	NA
AWV58745.1\|1795192_1797520_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58746.1\|1798161_1798275_+\|protease	CAAX protease	NA	NA	NA	NA
AWV58747.1\|1798362_1798656_-	DUF2087 domain-containing protein	NA	NA	NA	NA
AWV58748.1\|1798692_1798878_+	hypothetical protein	NA	NA	NA	NA
AWV58749.1\|1799058_1800237_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
AWV58750.1\|1800340_1800655_-	DNA-binding protein	NA	NA	NA	NA
AWV58751.1\|1800761_1800977_+	hypothetical protein	NA	NA	NA	NA
AWV59805.1\|1801276_1801519_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV58752.1\|1801505_1801934_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV58753.1\|1802085_1803633_-\|transposase	IS66 family transposase	NA	NA	NA	NA
AWV58754.1\|1803734_1804088_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AWV58755.1\|1804077_1804272_-	hypothetical protein	NA	NA	NA	NA
AWV58756.1\|1804402_1805565_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AWV58757.1\|1806129_1806504_-	lactoylglutathione lyase	NA	NA	NA	NA
AWV58758.1\|1806526_1807927_-	beta-fructofuranosidase	NA	NA	NA	NA
AWV58759.1\|1807930_1808341_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV58760.1\|1808358_1808850_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV58761.1\|1808859_1809651_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV58762.1\|1809643_1810417_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV58763.1\|1810572_1813107_-	PRD domain-containing protein	NA	NA	NA	NA
AWV58764.1\|1813188_1814061_-	ROK family protein	NA	NA	NA	NA
AWV58765.1\|1814096_1814564_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AWV58766.1\|1814573_1816043_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
AWV58767.1\|1816113_1817532_-	beta-fructofuranosidase	NA	NA	NA	NA
AWV58768.1\|1817653_1818634_-	LacI family transcriptional regulator	NA	NA	NA	NA
AWV58769.1\|1818913_1820076_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
AWV58770.1\|1820168_1820678_-	MarR family transcriptional regulator	NA	NA	NA	NA
AWV58771.1\|1821016_1821970_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV58772.1\|1821922_1822159_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV58773.1\|1822578_1823700_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWV59806.1\|1824027_1825437_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AWV58774.1\|1825433_1826162_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
AWV58775.1\|1826289_1827201_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
AWV58776.1\|1827217_1828225_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
AWV58777.1\|1828221_1830351_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
AWV58778.1\|1830651_1831839_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AWV58779.1\|1832883_1834710_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
AWV58780.1\|1836943_1837333_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
AWV58781.1\|1837382_1838279_-	phosphoesterase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
AWV58782.1\|1838281_1840129_-	PHP domain-containing protein	NA	NA	NA	NA
AWV58783.1\|1840225_1840726_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
AWV58784.1\|1840738_1840960_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
AWV58785.1\|1840964_1841102_-	DUF3789 domain-containing protein	NA	NA	NA	NA
AWV58786.1\|1841098_1842283_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
AWV58787.1\|1842538_1842793_-	hypothetical protein	NA	NA	NA	NA
AWV58788.1\|1842817_1843960_-	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
AWV58789.1\|1844019_1845372_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
AWV58790.1\|1845442_1845796_-	DNA-damage-inducible protein J	NA	NA	NA	NA
AWV58791.1\|1845796_1846171_-	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
AWV58792.1\|1846183_1846498_-	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
AWV58793.1\|1846611_1849839_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV58794.1\|1849917_1850580_-	hypothetical protein	NA	NA	NA	NA
AWV58795.1\|1851196_1851427_+	hypothetical protein	NA	NA	NA	NA
AWV58796.1\|1851432_1851732_+	hypothetical protein	NA	NA	NA	NA
AWV58797.1\|1852726_1853935_-	hypothetical protein	NA	NA	NA	NA
AWV58798.1\|1854049_1855066_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	9.8e-62	66.7
AWV58799.1\|1855076_1855274_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
AWV58800.1\|1855289_1855532_-\|holin	holin	D2J075	Enterococcus_phage	1.2e-21	63.3
AWV58801.1\|1855566_1855704_-	XkdX family protein	NA	NA	NA	NA
AWV58802.1\|1855705_1856152_-	hypothetical protein	NA	NA	NA	NA
AWV58803.1\|1856314_1858375_-	DUF2479 domain-containing protein	A0A249XZH9	Enterococcus_phage	1.7e-65	44.9
AWV58804.1\|1858392_1859217_-	hypothetical protein	NA	NA	NA	NA
AWV58805.1\|1859220_1860270_-	hypothetical protein	Q5K5I4	Oenococcus_phage	1.9e-31	27.9
AWV58806.1\|1860266_1861139_-	hypothetical protein	NA	NA	NA	NA
AWV58807.1\|1861139_1864988_-\|tail	phage tail protein	A0A0M5M3L4	Enterococcus_phage	0.0e+00	76.0
AWV58808.1\|1864987_1865179_-	hypothetical protein	NA	NA	NA	NA
AWV58809.1\|1865202_1865514_-	hypothetical protein	A0A0S2MY76	Enterococcus_phage	4.0e-14	44.8
AWV58810.1\|1865638_1866199_-\|tail	phage tail protein	V5UQL2	Enterococcus_phage	3.4e-40	46.2
AWV58811.1\|1866214_1866586_-	hypothetical protein	A0A060ANH4	Enterococcus_phage	2.5e-23	46.2
AWV58812.1\|1866582_1866978_-	hypothetical protein	C0LZZ2	Enterococcus_phage	4.3e-21	44.5
AWV58813.1\|1866974_1867310_-\|head,tail	head-tail adaptor protein	A0A249XUC8	Enterococcus_phage	2.2e-18	44.1
AWV58814.1\|1867313_1867640_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
AWV58815.1\|1867654_1868848_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.5e-114	55.4
AWV58816.1\|1868844_1869522_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	4.9e-49	51.0
AWV58817.1\|1869556_1870777_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.2e-61	38.5
AWV58818.1\|1872331_1873111_-	hypothetical protein	A0A220BXN1	Staphylococcus_phage	8.1e-40	45.9
AWV58819.1\|1873185_1873344_+	ribbon-helix-helix domain-containing protein	A0A0A7RUX5	Clostridium_phage	5.3e-07	65.9
AWV58820.1\|1873810_1874332_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.1e-16	34.2
AWV58821.1\|1874433_1874598_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.6e-14	69.8
AWV58822.1\|1874754_1875072_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	2.0e-13	39.8
AWV58823.1\|1875072_1875618_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV58824.1\|1875617_1875806_-	hypothetical protein	NA	NA	NA	NA
AWV58825.1\|1875802_1876033_-	hypothetical protein	NA	NA	NA	NA
AWV58826.1\|1876813_1877227_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-56	81.0
AWV58827.1\|1877429_1877681_+	hypothetical protein	NA	NA	NA	NA
AWV58828.1\|1877713_1878001_-	hypothetical protein	NA	NA	NA	NA
AWV58829.1\|1877997_1878201_-	toxin PIN	NA	NA	NA	NA
AWV58830.1\|1878130_1878400_-	hypothetical protein	NA	NA	NA	NA
AWV58831.1\|1878396_1878927_-	DUF1642 domain-containing protein	A0A059T7S4	Listeria_phage	1.8e-11	37.2
AWV58832.1\|1878919_1879234_-	hypothetical protein	D2IZY1	Enterococcus_phage	4.6e-34	72.7
AWV58833.1\|1879233_1879539_-	hypothetical protein	NA	NA	NA	NA
AWV58834.1\|1879535_1879697_-	antitoxin	NA	NA	NA	NA
AWV58835.1\|1879693_1880011_-	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	3.6e-31	61.5
AWV58836.1\|1880257_1882570_-	DNA primase	R4IBW2	Listeria_phage	1.3e-250	55.9
AWV58837.1\|1882584_1883085_-	DUF669 domain-containing protein	A8ATF2	Listeria_phage	1.1e-34	52.9
AWV58838.1\|1883086_1883560_-	transcriptional regulator	A8ATW6	Listeria_phage	7.7e-09	43.9
AWV58839.1\|1883550_1884900_-	ATP-dependent helicase	A0A0P0ID30	Lactobacillus_phage	4.1e-132	53.4
AWV58840.1\|1884874_1885561_-	DNA-binding protein	A0A1P8VVS4	Streptococcus_phage	1.1e-61	52.7
AWV58841.1\|1885679_1886006_-	hypothetical protein	F0PIH7	Enterococcus_phage	1.6e-26	57.8
AWV58842.1\|1886002_1886434_-	hypothetical protein	NA	NA	NA	NA
AWV58843.1\|1886883_1887363_-	hypothetical protein	E5DV79	Deep-sea_thermophilic_phage	5.3e-34	49.0
AWV58844.1\|1887295_1887613_-	hypothetical protein	NA	NA	NA	NA
AWV58845.1\|1887780_1888239_+	hypothetical protein	NA	NA	NA	NA
AWV58846.1\|1888541_1888790_-	hypothetical protein	NA	NA	NA	NA
AWV58847.1\|1888802_1888988_-	XRE family transcriptional regulator	Q5YAA3	Bacillus_phage	8.4e-12	56.7
AWV58848.1\|1889291_1889666_+	XRE family transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
AWV58849.1\|1889670_1890099_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV58850.1\|1890148_1890802_+	hypothetical protein	NA	NA	NA	NA
AWV58851.1\|1890937_1891504_+	hypothetical protein	A0A0P0IXE0	Lactobacillus_phage	1.9e-06	92.3
AWV58852.1\|1891619_1892756_+\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	8.4e-54	36.8
AWV58853.1\|1892887_1893235_-	50S ribosomal protein L19	NA	NA	NA	NA
AWV58854.1\|1893370_1894132_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AWV58855.1\|1894121_1894643_-	ribosome maturation factor RimM	NA	NA	NA	NA
AWV58856.1\|1894812_1895604_-	hypothetical protein	NA	NA	NA	NA
AWV58857.1\|1895728_1895980_-	KH domain-containing protein	NA	NA	NA	NA
AWV58858.1\|1895991_1896267_-	30S ribosomal protein S16	NA	NA	NA	NA
AWV58859.1\|1896519_1897074_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
AWV58860.1\|1897152_1897674_-	dihydrofolate reductase	NA	NA	NA	NA
AWV58861.1\|1897677_1898256_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AWV58862.1\|1898367_1899786_-	signal recognition particle protein	NA	NA	NA	NA
AWV58863.1\|1899806_1900145_-	putative DNA-binding protein	NA	NA	NA	NA
AWV58864.1\|1900104_1900608_-	DUF523 domain-containing protein	NA	NA	NA	NA
AWV58865.1\|1900738_1901443_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.4e-38	36.2
AWV58866.1\|1901439_1903176_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
AWV58867.1\|1903278_1905750_-	HAD family hydrolase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.1e-45	29.2
AWV58868.1\|1906074_1906965_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
AWV58869.1\|1907161_1907644_-	hypothetical protein	NA	NA	NA	NA
AWV58870.1\|1907851_1908217_+	hypothetical protein	NA	NA	NA	NA
AWV58871.1\|1908420_1908738_-	hypothetical protein	NA	NA	NA	NA
AWV58872.1\|1909467_1910442_-	linear amide C-N hydrolase	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
AWV58873.1\|1910851_1912102_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV58874.1\|1912387_1912645_+	hypothetical protein	NA	NA	NA	NA
AWV58875.1\|1912876_1913290_-	DUF4231 domain-containing protein	NA	NA	NA	NA
AWV58876.1\|1913568_1914908_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
AWV58877.1\|1914977_1915553_-	N-acetylmuramoyl-L-alanine amidase	Q9MCC6	Lactobacillus_phage	4.8e-13	35.9
AWV58878.1\|1915633_1916795_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-79	51.3
AWV58879.1\|1917169_1917739_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AWV58880.1\|1917812_1919102_-	hypothetical protein	NA	NA	NA	NA
AWV59807.1\|1919455_1920304_+	MoxR family ATPase	NA	NA	NA	NA
AWV58881.1\|1920317_1921391_+	DUF58 domain-containing protein	NA	NA	NA	NA
AWV58882.1\|1921380_1923552_+	transglutaminase domain-containing protein	NA	NA	NA	NA
AWV59808.1\|1923663_1925820_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.9e-71	32.3
AWV58883.1\|1925962_1928149_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.4e-121	38.7
AWV58884.1\|1928148_1928358_-	copper-binding protein	NA	NA	NA	NA
AWV58885.1\|1928370_1928811_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
AWV59809.1\|1928884_1929358_-	topology modulation family protein	A0A097BYE2	Leuconostoc_phage	1.1e-10	28.8
AWV58886.1\|1929584_1930880_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
AWV58887.1\|1931189_1932656_-	amino acid permease	NA	NA	NA	NA
1930903:1932416	attR	NA	NA	NA	NA
AWV58888.1\|1932966_1935051_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-117	35.7
AWV58889.1\|1935574_1935934_-	YccF domain-containing protein	NA	NA	NA	NA
AWV58890.1\|1935963_1936305_-	hypothetical protein	NA	NA	NA	NA
AWV58891.1\|1936301_1936976_-	GDSL family lipase	NA	NA	NA	NA
AWV58892.1\|1937770_1939069_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
AWV59810.1\|1939108_1940299_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AWV58893.1\|1940319_1940847_-	peptidase	NA	NA	NA	NA
AWV58894.1\|1940893_1943683_-	DNA polymerase III subunit epsilon	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
AWV58895.1\|1943829_1944030_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
AWV58896.1\|1944481_1944802_-	hypothetical protein	NA	NA	NA	NA
AWV58897.1\|1945079_1946375_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_10

2521649 : 2643009

112

Enterococcus_phage(22.86%)

portal,transposase,holin,terminase,protease,tRNA,head,tail,plate,integrase

attL 2572730:2572745|attR 2611679:2611694

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV59422.1\|2521649_2522609_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV59423.1\|2522759_2525462_-	alpha-mannosidase	NA	NA	NA	NA
AWV59424.1\|2525474_2526764_-	glycoside hydrolase family 125 protein	NA	NA	NA	NA
AWV59425.1\|2526913_2527960_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV59426.1\|2527961_2530115_+	alpha-mannosidase	NA	NA	NA	NA
AWV59427.1\|2530587_2532039_-	DNA-binding response regulator	NA	NA	NA	NA
AWV59428.1\|2532035_2533760_-	sensor histidine kinase	NA	NA	NA	NA
AWV59429.1\|2533752_2534367_-	DUF624 domain-containing protein	NA	NA	NA	NA
AWV59430.1\|2534403_2534601_-	hypothetical protein	NA	NA	NA	NA
AWV59431.1\|2534711_2536169_-	DUF3502 domain-containing protein	NA	NA	NA	NA
AWV59432.1\|2536209_2537130_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV59433.1\|2537141_2538089_-	sugar ABC transporter permease	NA	NA	NA	NA
AWV59434.1\|2538567_2539287_-	rRNA pseudouridine synthase	NA	NA	NA	NA
AWV59435.1\|2539335_2540982_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV59436.1\|2541160_2541751_+	membrane protein	NA	NA	NA	NA
AWV59437.1\|2541842_2543348_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
AWV59438.1\|2543431_2544784_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AWV59439.1\|2544783_2545302_-	hypothetical protein	NA	NA	NA	NA
AWV59440.1\|2545317_2545644_-	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
AWV59441.1\|2545656_2547636_-	PRD domain-containing protein	NA	NA	NA	NA
AWV59442.1\|2547656_2547971_-	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
AWV59443.1\|2548138_2548432_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AWV59444.1\|2548509_2549622_-	FUSC family protein	NA	NA	NA	NA
AWV59445.1\|2550008_2550188_+	hypothetical protein	NA	NA	NA	NA
AWV59446.1\|2550181_2550394_+	hypothetical protein	NA	NA	NA	NA
AWV59447.1\|2550381_2550552_+	hypothetical protein	NA	NA	NA	NA
AWV59823.1\|2550975_2551716_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV59824.1\|2552141_2555183_-	hypothetical protein	NA	NA	NA	NA
AWV59448.1\|2556863_2558036_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV59449.1\|2558451_2559213_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWV59450.1\|2559312_2561034_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-37	28.0
AWV59451.1\|2561048_2562833_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-46	28.2
AWV59452.1\|2563213_2564767_-	glycosyl hydrolase	NA	NA	NA	NA
AWV59453.1\|2565114_2567529_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
AWV59454.1\|2567955_2569974_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
AWV59455.1\|2570343_2571000_+	phosphatase PAP2 family protein	NA	NA	NA	NA
AWV59456.1\|2570999_2571956_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
AWV59457.1\|2571955_2572522_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
2572730:2572745	attL	NA	NA	NA	NA
AWV59458.1\|2572957_2573188_+	hypothetical protein	NA	NA	NA	NA
AWV59459.1\|2573193_2573493_+	hypothetical protein	NA	NA	NA	NA
AWV59460.1\|2573528_2573900_-	hypothetical protein	NA	NA	NA	NA
AWV59461.1\|2573901_2574303_-	hypothetical protein	NA	NA	NA	NA
AWV59462.1\|2574316_2574724_-	hypothetical protein	NA	NA	NA	NA
AWV59463.1\|2575646_2576809_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
AWV59464.1\|2577748_2578774_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
AWV59465.1\|2578770_2578995_-\|holin	holin	NA	NA	NA	NA
AWV59466.1\|2578991_2579285_-	hypothetical protein	NA	NA	NA	NA
AWV59467.1\|2579322_2579460_-	XkdX family protein	NA	NA	NA	NA
AWV59468.1\|2579461_2579893_-	hypothetical protein	NA	NA	NA	NA
AWV59469.1\|2579906_2580401_-	hypothetical protein	NA	NA	NA	NA
AWV59470.1\|2580400_2580850_-	hypothetical protein	NA	NA	NA	NA
AWV59471.1\|2580853_2581474_-	hypothetical protein	NA	NA	NA	NA
AWV59472.1\|2581473_2582382_-\|plate	phage baseplate upper protein	A0A1P8BKW9	Lactococcus_phage	1.1e-08	24.3
AWV59473.1\|2582394_2585157_-	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	1.1e-139	39.5
AWV59474.1\|2585153_2585894_-\|tail	phage tail protein	NA	NA	NA	NA
AWV59825.1\|2585883_2588673_-\|tail	phage tail tape measure protein	D7RWD8	Brochothrix_phage	5.4e-70	38.9
AWV59475.1\|2588914_2589256_-	hypothetical protein	NA	NA	NA	NA
AWV59476.1\|2589255_2589864_-\|tail	phage tail protein	NA	NA	NA	NA
AWV59477.1\|2589864_2590242_-	hypothetical protein	NA	NA	NA	NA
AWV59478.1\|2590243_2590639_-	HK97 gp10 family phage protein	NA	NA	NA	NA
AWV59479.1\|2590631_2591003_-	hypothetical protein	NA	NA	NA	NA
AWV59480.1\|2591002_2591344_-	hypothetical protein	NA	NA	NA	NA
AWV59481.1\|2591355_2591571_-	hypothetical protein	NA	NA	NA	NA
AWV59482.1\|2591593_2592484_-	hypothetical protein	NA	NA	NA	NA
AWV59483.1\|2592498_2593200_-	DUF4355 domain-containing protein	NA	NA	NA	NA
AWV59484.1\|2593118_2593310_-	hypothetical protein	NA	NA	NA	NA
AWV59485.1\|2593248_2593566_-	hypothetical protein	NA	NA	NA	NA
AWV59826.1\|2593567_2594446_-\|head	phage head morphogenesis protein	NA	NA	NA	NA
AWV59486.1\|2594537_2596067_-\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.7e-28	25.0
AWV59487.1\|2596078_2597494_-\|terminase	terminase B	C9E2I7	Enterococcus_phage	1.4e-218	79.4
AWV59488.1\|2597486_2598320_-\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	4.7e-78	67.9
AWV59489.1\|2598478_2598709_-	hypothetical protein	NA	NA	NA	NA
AWV59490.1\|2599455_2599923_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
AWV59827.1\|2599997_2600438_-	transcriptional regulator	D2IYV6	Enterococcus_phage	5.3e-20	38.4
AWV59491.1\|2600467_2600761_-	hypothetical protein	NA	NA	NA	NA
AWV59492.1\|2600791_2600986_-	hypothetical protein	NA	NA	NA	NA
AWV59493.1\|2601091_2601544_-	hypothetical protein	NA	NA	NA	NA
AWV59494.1\|2601569_2602031_-	class I SAM-dependent methyltransferase	A0A2H4PBJ4	Lactobacillus_phage	1.1e-60	67.1
AWV59495.1\|2602031_2602235_-	hypothetical protein	NA	NA	NA	NA
AWV59496.1\|2602231_2603083_-	AAA family ATPase	A0A0P0I3L9	Lactobacillus_phage	2.3e-27	30.2
AWV59497.1\|2603097_2603898_-	replication protein	B4XYS6	Lactobacillus_phage	3.0e-58	54.9
AWV59498.1\|2603940_2604831_-	recombinase RecT	D2IYT9	Enterococcus_phage	1.4e-136	84.5
AWV59499.1\|2604832_2605774_-	endonuclease	D2IZK1	Enterococcus_phage	1.0e-145	79.2
AWV59500.1\|2606006_2606342_-	hypothetical protein	NA	NA	NA	NA
AWV59501.1\|2606667_2606856_-	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
AWV59502.1\|2606918_2607158_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.8e-27	81.1
AWV59503.1\|2607154_2607310_-	hypothetical protein	NA	NA	NA	NA
AWV59504.1\|2607449_2607662_-	hypothetical protein	NA	NA	NA	NA
AWV59505.1\|2607664_2607877_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV59506.1\|2608151_2608562_+	XRE family transcriptional regulator	Q5YAA4	Bacillus_phage	2.8e-31	51.4
AWV59507.1\|2608574_2609027_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV59828.1\|2609465_2610398_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.8e-57	53.8
AWV59508.1\|2610469_2611591_+\|integrase	site-specific integrase	C9E2L6	Enterococcus_phage	4.0e-64	38.5
AWV59509.1\|2611672_2613445_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-54	29.5
2611679:2611694	attR	NA	NA	NA	NA
AWV59510.1\|2613447_2615160_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
AWV59511.1\|2615274_2615943_+	TetR family transcriptional regulator	NA	NA	NA	NA
AWV59512.1\|2616009_2616798_-	esterase family protein	NA	NA	NA	NA
AWV59513.1\|2616880_2618353_-	MFS transporter	NA	NA	NA	NA
AWV59514.1\|2618482_2619676_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
AWV59515.1\|2625372_2625570_+	hypothetical protein	NA	NA	NA	NA
AWV59516.1\|2627985_2629482_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.7e-91	40.9
AWV59517.1\|2629592_2630597_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AWV59518.1\|2630597_2631485_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
AWV59519.1\|2631701_2633813_-\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
AWV59520.1\|2633902_2634448_-	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
AWV59829.1\|2634447_2635893_-\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
AWV59521.1\|2636012_2636483_-	RNA-binding protein S1	NA	NA	NA	NA
AWV59522.1\|2636528_2636954_-	septum formation initiator family protein	NA	NA	NA	NA
AWV59523.1\|2637020_2637290_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
AWV59524.1\|2637300_2638896_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV59525.1\|2638910_2642432_-	transcription-repair coupling factor	NA	NA	NA	NA
AWV59526.1\|2642448_2643009_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

DBSCAN-SWA_11

2750102 : 2766998

Streptococcus_phage(92.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV59628.1\|2750102_2750417_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
AWV59629.1\|2750429_2750804_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
AWV59630.1\|2750804_2751149_+	damage-inducible protein J	NA	NA	NA	NA
AWV59631.1\|2751231_2752572_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	1.5e-163	65.2
AWV59632.1\|2752649_2753324_+	zeta toxin family protein	NA	NA	NA	NA
AWV59633.1\|2753556_2753991_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
AWV59634.1\|2753991_2754699_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
AWV59635.1\|2754688_2754979_+	hypothetical protein	NA	NA	NA	NA
AWV59636.1\|2755237_2756422_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
AWV59637.1\|2756418_2756556_+	DUF3789 domain-containing protein	NA	NA	NA	NA
AWV59638.1\|2757301_2759212_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
AWV59639.1\|2759315_2759540_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
AWV59640.1\|2759552_2760056_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
AWV59641.1\|2760115_2760505_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
AWV59642.1\|2760491_2762939_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
AWV59643.1\|2762943_2765067_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
AWV59644.1\|2765063_2766068_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
AWV59645.1\|2766086_2766998_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP020485

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2691 : 55756

Bacillus_phage(28.57%)

integrase,transposase

attL 13431:13448|attR 56559:56576

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV59837.1\|2691_3861_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AWV59838.1\|4333_4888_+\|integrase	integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
AWV59839.1\|5060_5534_-\|integrase	integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
AWV59840.1\|5545_6082_+	glyoxalase	NA	NA	NA	NA
AWV59841.1\|6121_6493_+	glyoxalase	NA	NA	NA	NA
AWV59842.1\|6776_8048_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
AWV59843.1\|8292_9318_+	LacI family transcriptional regulator	NA	NA	NA	NA
AWV59844.1\|9611_10721_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV59845.1\|11715_12540_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV59846.1\|12571_13882_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
13431:13448	attL	NA	NA	NA	NA
AWV59847.1\|14029_15289_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV59848.1\|15298_16171_+	sugar ABC transporter permease	NA	NA	NA	NA
AWV59849.1\|16182_17013_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV59850.1\|17052_19236_+	alpha-galactosidase	NA	NA	NA	NA
AWV59851.1\|19296_20517_+	oligo-1,6-glucosidase	NA	NA	NA	NA
AWV59852.1\|20513_21974_+	sucrose phosphorylase	NA	NA	NA	NA
AWV59853.1\|23478_23688_+	DUF3173 domain-containing protein	NA	NA	NA	NA
AWV59854.1\|23680_23830_+\|integrase	integrase	NA	NA	NA	NA
AWV59855.1\|24932_26018_-	tyrosine recombinase XerS	NA	NA	NA	NA
AWV59856.1\|26351_26585_+	addiction module antitoxin	NA	NA	NA	NA
AWV59857.1\|26581_26989_+	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	4.0e-14	38.9
AWV60038.1\|27579_27783_-	hypothetical protein	NA	NA	NA	NA
AWV59858.1\|28125_28644_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
AWV60039.1\|29010_29259_+	hypothetical protein	NA	NA	NA	NA
AWV59859.1\|29304_29496_+	fructokinase	NA	NA	NA	NA
AWV59860.1\|29761_30923_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AWV59861.1\|31421_31898_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AWV59862.1\|31910_33413_-	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
AWV59863.1\|33426_34116_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
AWV59864.1\|34276_35095_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV59865.1\|35324_35555_+	resolvase	NA	NA	NA	NA
AWV60040.1\|35886_36120_-	hypothetical protein	NA	NA	NA	NA
AWV59866.1\|36140_36596_-\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
AWV59867.1\|36838_38264_+\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
AWV59868.1\|38440_39736_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
AWV59869.1\|39756_39954_+	hypothetical protein	NA	NA	NA	NA
AWV59870.1\|39956_40919_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
AWV59871.1\|40920_42360_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
AWV59872.1\|42544_44491_+	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
AWV59873.1\|44754_45627_+	ROK family protein	NA	NA	NA	NA
AWV59874.1\|47484_47955_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-09	33.6
AWV59875.1\|47999_48167_-	transcriptional regulator	NA	NA	NA	NA
AWV59876.1\|48200_48500_-	hypothetical protein	NA	NA	NA	NA
AWV59877.1\|48540_49158_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
AWV59878.1\|49482_49878_-	hypothetical protein	NA	NA	NA	NA
AWV59879.1\|49957_52309_-	DUF1906 domain-containing protein	NA	NA	NA	NA
AWV59880.1\|52433_53123_-	hypothetical protein	NA	NA	NA	NA
AWV59881.1\|53136_53589_-	hypothetical protein	NA	NA	NA	NA
AWV59882.1\|53823_54965_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
AWV59883.1\|55075_55756_+\|transposase	IS6 family transposase IS1216E	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
56559:56576	attR	NA	NA	NA	NA

DBSCAN-SWA_2

69251 : 110507

Streptococcus_phage(45.45%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV59899.1\|69251_70874_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-121	47.3
AWV59900.1\|71159_72536_-	ABC transporter permease	NA	NA	NA	NA
AWV59901.1\|72535_73192_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
AWV59902.1\|73201_74479_-	ABC transporter permease	NA	NA	NA	NA
AWV59903.1\|74728_75890_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
AWV59904.1\|75920_76370_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
AWV59905.1\|76525_76876_-	hypothetical protein	NA	NA	NA	NA
AWV59906.1\|78055_78742_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.7e-127	99.1
AWV59907.1\|78989_79847_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
AWV59908.1\|80408_80738_-	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV59909.1\|80814_81087_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
AWV59910.1\|81086_81350_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AWV59911.1\|82494_83670_-	MFS transporter	NA	NA	NA	NA
AWV59912.1\|83672_85922_-	alpha-galactosidase	NA	NA	NA	NA
AWV59913.1\|86971_88120_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
AWV59914.1\|88136_88541_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV59915.1\|89847_90783_-	hypothetical protein	NA	NA	NA	NA
AWV59916.1\|91341_91659_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AWV59917.1\|91659_91914_-	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV59918.1\|92272_92677_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV59919.1\|92693_93842_+\|transposase	transposase	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
AWV59920.1\|94548_94743_-	hypothetical protein	NA	NA	NA	NA
AWV59921.1\|96094_97135_+	replication protein RepA	NA	NA	NA	NA
AWV59922.1\|97958_98291_+	conjugal transfer protein TraE	NA	NA	NA	NA
AWV59923.1\|98909_99251_+	hypothetical protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
AWV59924.1\|99487_100738_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV59925.1\|101147_101387_+	hypothetical protein	NA	NA	NA	NA
AWV59926.1\|101453_101663_+	hypothetical protein	NA	NA	NA	NA
AWV59927.1\|101722_102394_+	class A sortase	NA	NA	NA	NA
AWV59928.1\|102446_104423_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV59929.1\|104435_105191_+	class C sortase	NA	NA	NA	NA
AWV59930.1\|105187_106012_+	hypothetical protein	NA	NA	NA	NA
AWV59931.1\|106021_106270_+	hypothetical protein	NA	NA	NA	NA
AWV59932.1\|106300_108412_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV59933.1\|108449_110507_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

146867 : 181964

Streptococcus_phage(36.36%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV59974.1\|146867_147554_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	98.7
AWV59975.1\|147601_148312_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWV59976.1\|148295_149030_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWV59977.1\|149246_150260_+	SIS domain-containing protein	NA	NA	NA	NA
AWV59978.1\|150270_150681_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV59979.1\|150680_151148_+	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV59980.1\|151165_151912_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV59981.1\|151911_152721_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV59982.1\|154683_155085_-	hypothetical protein	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2
AWV59983.1\|155311_156490_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.7e-23	27.1
AWV59984.1\|156537_157275_-	conjugal transfer protein TraG	NA	NA	NA	NA
AWV59985.1\|157432_158362_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.1e-06	23.3
AWV59986.1\|158434_159046_-	VanZ family protein	NA	NA	NA	NA
AWV59987.1\|159261_160170_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV59988.1\|161628_162471_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AWV59989.1\|162795_163212_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV59990.1\|163208_163679_+	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV59991.1\|163692_164466_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV59992.1\|164479_165292_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV59993.1\|165345_166311_+	SIS domain-containing protein	NA	NA	NA	NA
AWV59994.1\|166446_169170_+	PRD domain-containing protein	NA	NA	NA	NA
AWV59995.1\|169182_169815_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
AWV59996.1\|170019_170247_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
AWV59997.1\|170243_170582_+	antitoxin	NA	NA	NA	NA
AWV59998.1\|170571_170841_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
AWV59999.1\|171019_172321_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
AWV60000.1\|172549_174097_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
AWV60001.1\|174198_174552_-	IS66 family insertion sequence hypothetical protein	S5VXZ8	Leptospira_phage	5.7e-17	38.7
AWV60002.1\|174541_174736_-	hypothetical protein	NA	NA	NA	NA
AWV60003.1\|174814_176107_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
AWV60004.1\|176869_177838_+	SIS domain-containing protein	NA	NA	NA	NA
AWV60005.1\|177848_178664_+	fructoselysine 6-kinase	NA	NA	NA	NA
AWV60006.1\|178731_179442_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV60007.1\|179477_180719_+	hydrolase	NA	NA	NA	NA
AWV60008.1\|180776_181964_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP020486

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2672

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV60045.1\|50_401_+	hypothetical protein	NA	NA	NA	NA
AWV60046.1\|811_1006_-	hypothetical protein	NA	NA	NA	NA
AWV60047.1\|1471_1747_-	type III secretion system protein PrgO	NA	NA	NA	NA
AWV60048.1\|1718_2672_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

DBSCAN-SWA_2

6819 : 14865

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV60052.1\|6819_7506_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV60053.1\|8126_9299_-\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV60054.1\|9450_10146_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
AWV60055.1\|10123_11278_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
AWV60056.1\|11492_12461_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
AWV60057.1\|12453_13485_+	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
AWV60058.1\|13490_14099_+	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
AWV60059.1\|14178_14865_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

DBSCAN-SWA_3

20235 : 47988

Streptococcus_phage(70.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV60065.1\|20235_20853_+	recombinase family protein	A0A219YA40	Aeromonas_phage	2.9e-16	36.6
AWV60066.1\|22483_23131_-	type A-7 chloramphenicol O-acetyltransferase	A0A1X9I6V6	Streptococcus_phage	9.0e-69	54.4
AWV60067.1\|23260_24199_-	replication initiation protein	NA	NA	NA	NA
AWV60068.1\|26040_26280_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	6.8e-22	81.5
AWV60096.1\|26328_26397_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
AWV60069.1\|26434_27607_-\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV60070.1\|27868_28606_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	3.1e-134	99.2
AWV60071.1\|28610_28742_+	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
AWV60072.1\|29106_30445_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
AWV60073.1\|30557_31454_+	chromosome partitioning protein ParA	A0A1X9I765	Streptococcus_phage	1.1e-152	97.9
AWV60074.1\|31545_31761_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
AWV60075.1\|31778_32051_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
AWV60076.1\|32052_32916_+	toxin zeta	NA	NA	NA	NA
AWV60077.1\|33687_34374_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-126	99.1
AWV60078.1\|34762_34987_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV60079.1\|35001_35871_+	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
AWV60080.1\|35851_36586_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
AWV60081.1\|36618_37527_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
AWV60082.1\|38092_38779_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV60083.1\|38981_39194_+	hypothetical protein	NA	NA	NA	NA
AWV60084.1\|39355_39874_+	hypothetical protein	NA	NA	NA	NA
AWV60085.1\|39880_40393_+	hypothetical protein	NA	NA	NA	NA
AWV60086.1\|40496_41792_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
AWV60087.1\|42185_42809_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
AWV60088.1\|42898_43585_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV60089.1\|43782_44388_+	cell filamentation protein	NA	NA	NA	NA
AWV60090.1\|44403_44976_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
AWV60091.1\|45227_45485_-	hypothetical protein	NA	NA	NA	NA
AWV60092.1\|45610_46426_-	hypothetical protein	NA	NA	NA	NA
AWV60093.1\|46815_47988_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP020484

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP020485

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP020486

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection