CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP020488	Enterococcus faecium strain CFSAN059071 chromosome, complete genome	1 crisprs	DEDDh,cas2,RT,DinG,cas3,cas14j,csa3	12
CP020489	Enterococcus faecium strain CFSAN059071 plasmid unnamed1, complete sequence	0 crisprs	cas14j,RT,DEDDh	3
CP020491	Enterococcus faecium strain CFSAN059071 plasmid unnamed3, complete sequence	0 crisprs	NA	0
CP020490	Enterococcus faecium strain CFSAN059071 plasmid unnamed2, complete sequence	0 crisprs	NA	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP020488_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP020488_1

2405034-2405143

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP020488_1

>merge|CP020488|1|2405034-2405143|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>CP020488|1|1|2405034-2405143|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
CP020488.1\|AWV62336.1\|2398332_2399046_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP020488.1\|AWV62350.1\|2411374_2411545_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
CP020488.1\|AWV62342.1\|2404457_2404961_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
CP020488.1\|AWV62349.1\|2410728_2411274_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
CP020488.1\|AWV62351.1\|2411568_2411721_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
CP020488.1\|AWV62343.1\|2405370_2406060_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
CP020488.1\|AWV62344.1\|2406163_2406586_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
CP020488.1\|AWV62339.1\|2401957_2403160_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP020488.1\|AWV62346.1\|2407609_2408482_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
CP020488.1\|AWV62348.1\|2409764_2410652_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
CP020488.1\|AWV62337.1\|2399299_2400001_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
CP020488.1\|AWV62333.1\|2393621_2395781_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
CP020488.1\|AWV62338.1\|2400234_2401767_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223562
CP020488.1\|AWV62340.1\|2403241_2403931_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
CP020488.1\|AWV62345.1\|2406928_2407597_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
CP020488.1\|AWV62352.1\|2411882_2412527_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
CP020488.1\|AWV62334.1\|2395830_2396796_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
CP020488.1\|AWV62335.1\|2396884_2398024_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
CP020488.1\|AWV62347.1\|2408572_2409592_-\|lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
CP020488.1\|AWV62341.1\|2404036_2404405_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671

Protein	Function_ID	Function_description	E-value
CP020488.1\|AWV62336.1\|2398332_2399046_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
CP020488.1\|AWV62350.1\|2411374_2411545_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
CP020488.1\|AWV62342.1\|2404457_2404961_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
CP020488.1\|AWV62349.1\|2410728_2411274_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
CP020488.1\|AWV62351.1\|2411568_2411721_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
CP020488.1\|AWV62343.1\|2405370_2406060_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
CP020488.1\|AWV62344.1\|2406163_2406586_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
CP020488.1\|AWV62339.1\|2401957_2403160_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
CP020488.1\|AWV62346.1\|2407609_2408482_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
CP020488.1\|AWV62348.1\|2409764_2410652_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
CP020488.1\|AWV62337.1\|2399299_2400001_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
CP020488.1\|AWV62333.1\|2393621_2395781_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
CP020488.1\|AWV62338.1\|2400234_2401767_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
CP020488.1\|AWV62340.1\|2403241_2403931_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
CP020488.1\|AWV62345.1\|2406928_2407597_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
CP020488.1\|AWV62352.1\|2411882_2412527_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
CP020488.1\|AWV62334.1\|2395830_2396796_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
CP020488.1\|AWV62335.1\|2396884_2398024_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
CP020488.1\|AWV62347.1\|2408572_2409592_-\|lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
CP020488.1\|AWV62341.1\|2404036_2404405_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45

>CP020488.1|AWV62342.1|2404457_2404961_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>CP020488.1|AWV62341.1|2404036_2404405_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>CP020488.1|AWV62340.1|2403241_2403931_-|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>CP020488.1|AWV62339.1|2401957_2403160_-|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>CP020488.1|AWV62338.1|2400234_2401767_+|ABC-transporter-ATP-binding-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>CP020488.1|AWV62337.1|2399299_2400001_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>CP020488.1|AWV62336.1|2398332_2399046_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>CP020488.1|AWV62335.1|2396884_2398024_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>CP020488.1|AWV62334.1|2395830_2396796_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>CP020488.1|AWV62333.1|2393621_2395781_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>CP020488.1|AWV62343.1|2405370_2406060_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>CP020488.1|AWV62344.1|2406163_2406586_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>CP020488.1|AWV62345.1|2406928_2407597_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>CP020488.1|AWV62346.1|2407609_2408482_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>CP020488.1|AWV62347.1|2408572_2409592_-|lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKYTKLMD
>CP020488.1|AWV62348.1|2409764_2410652_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>CP020488.1|AWV62349.1|2410728_2411274_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>CP020488.1|AWV62350.1|2411374_2411545_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>CP020488.1|AWV62351.1|2411568_2411721_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>CP020488.1|AWV62352.1|2411882_2412527_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

518277 : 585240

Streptococcus_phage(15.38%)

transposase,protease,tRNA,integrase

attL 513830:513849|attR 592089:592108

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
513830:513849	attL	NA	NA	NA	NA
AWV60573.1\|518277_519399_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AWV60574.1\|519644_521066_+	arginine-ornithine antiporter	NA	NA	NA	NA
AWV60575.1\|521079_522198_+	aminotransferase	NA	NA	NA	NA
AWV60576.1\|522257_523550_-	MFS transporter	NA	NA	NA	NA
AWV62780.1\|523699_524260_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV60577.1\|524388_524766_+	DUF1033 family protein	NA	NA	NA	NA
AWV60578.1\|524698_526771_+	DNA topoisomerase III	NA	NA	NA	NA
AWV60579.1\|526981_527929_-	glycosyltransferase	V5USA4	Oenococcus_phage	5.0e-84	51.0
AWV60580.1\|528174_528639_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-18	38.7
AWV60581.1\|528700_529744_-	putative sulfate exporter family transporter	NA	NA	NA	NA
AWV60582.1\|530120_531086_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AWV60583.1\|531319_532165_+	LysR family transcriptional regulator	NA	NA	NA	NA
AWV60584.1\|532173_532371_+	hypothetical protein	NA	NA	NA	NA
AWV60585.1\|532355_533543_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AWV60586.1\|533548_533905_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.7e-22	42.3
AWV60587.1\|533906_534245_+	glycine cleavage system protein H	NA	NA	NA	NA
AWV62781.1\|534639_535674_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-28	35.1
AWV60588.1\|535666_536353_+	ABC transporter permease	NA	NA	NA	NA
AWV60589.1\|536376_537225_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV60590.1\|537421_538195_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.1e-08	28.8
AWV60591.1\|538207_539494_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AWV60592.1\|539490_540726_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-113	47.7
AWV60593.1\|540712_541183_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
AWV60594.1\|541187_542579_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AWV60595.1\|542694_543990_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV60596.1\|544195_545338_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.3e-58	34.8
AWV60597.1\|545376_546111_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV60598.1\|546112_546298_+	hypothetical protein	NA	NA	NA	NA
AWV60599.1\|546342_546618_+	DNA-binding protein	NA	NA	NA	NA
AWV60600.1\|546715_548713_+	hypothetical protein	A0A1Z1LZK7	Bacillus_phage	5.5e-24	24.4
AWV60601.1\|548788_549124_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV60602.1\|549502_549865_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AWV60603.1\|549910_550237_+	hypothetical protein	NA	NA	NA	NA
AWV60604.1\|550572_550800_+	hypothetical protein	NA	NA	NA	NA
AWV60605.1\|551079_552903_+	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
AWV60606.1\|552916_554326_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	3.2e-42	27.6
AWV60607.1\|554343_555180_+	PRD domain-containing protein	NA	NA	NA	NA
AWV60608.1\|555244_556027_+	hypothetical protein	NA	NA	NA	NA
AWV60609.1\|556430_557556_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
AWV60610.1\|558908_559109_+	sensor histidine kinase	NA	NA	NA	NA
AWV60611.1\|559184_559382_+	hypothetical protein	NA	NA	NA	NA
AWV60612.1\|559330_559561_+	hypothetical protein	NA	NA	NA	NA
AWV60613.1\|559678_561226_-	bifunctional metallophosphatase/5'-nucleotidase	S4VPC4	Pandoravirus	4.6e-10	25.7
AWV60614.1\|561309_562113_-	metallophosphoesterase	NA	NA	NA	NA
AWV60615.1\|562115_562898_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWV60616.1\|562894_563674_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWV60617.1\|563645_564437_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-21	39.4
AWV60618.1\|564497_565427_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV60619.1\|565621_566305_+	cyclic nucleotide-binding protein	NA	NA	NA	NA
AWV60620.1\|566465_567509_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV60621.1\|569448_570627_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV60622.1\|570847_571756_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV60623.1\|571884_572484_+	DUF1819 family protein	NA	NA	NA	NA
AWV60624.1\|572483_573059_+	DUF1788 domain-containing protein	NA	NA	NA	NA
AWV60625.1\|573083_576755_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
AWV60626.1\|576818_580451_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
AWV62782.1\|580566_583089_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
AWV60627.1\|583206_585240_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
592089:592108	attR	NA	NA	NA	NA

DBSCAN-SWA_2

727719 : 736191

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV60759.1\|727719_728364_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
AWV60760.1\|728378_728708_+	hypothetical protein	NA	NA	NA	NA
AWV60761.1\|728721_729660_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
AWV60762.1\|729695_730520_+	signal peptidase	NA	NA	NA	NA
AWV60763.1\|730512_730860_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
AWV60764.1\|730928_731801_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
AWV60765.1\|731909_733031_+	DNA polymerase IV	NA	NA	NA	NA
AWV60766.1\|733084_733687_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
AWV60767.1\|734001_736191_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_3

789200 : 886714

112

uncultured_Caudovirales_phage(13.95%)

capsid,portal,head,tRNA,terminase,integrase,transposase,protease,tail,plate,holin

attL 782472:782487|attR 823273:823288

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
782472:782487	attL	NA	NA	NA	NA
AWV60821.1\|789200_791999_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
AWV60822.1\|792047_793574_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
AWV60823.1\|793588_794236_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
AWV62792.1\|794419_794749_-	DUF4828 domain-containing protein	NA	NA	NA	NA
AWV60824.1\|794925_795654_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
AWV60825.1\|795669_796683_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AWV60826.1\|796682_797960_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
AWV60827.1\|798022_800725_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
AWV60828.1\|800876_801194_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AWV60829.1\|801223_801544_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
AWV60830.1\|801651_803112_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV60831.1\|803179_803401_+	hypothetical protein	NA	NA	NA	NA
AWV60832.1\|803431_803614_+	DUF3188 domain-containing protein	NA	NA	NA	NA
AWV60833.1\|803613_804027_+	DUF3284 domain-containing protein	NA	NA	NA	NA
AWV60834.1\|804149_805331_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV60835.1\|805861_807001_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
AWV60836.1\|807299_807935_-	hypothetical protein	NA	NA	NA	NA
AWV60837.1\|808047_808683_-	DUF3221 domain-containing protein	NA	NA	NA	NA
AWV60838.1\|808716_809178_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
AWV60839.1\|809307_809739_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV60840.1\|809756_810077_-	XRE family transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
AWV60841.1\|810375_811152_+	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
AWV60842.1\|811166_811370_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV60843.1\|811385_811724_+	DUF771 domain-containing protein	NA	NA	NA	NA
AWV60844.1\|811710_811890_+	hypothetical protein	NA	NA	NA	NA
AWV62793.1\|811932_812403_-	hypothetical protein	NA	NA	NA	NA
AWV60845.1\|812489_813188_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
AWV60846.1\|813365_813707_+	hypothetical protein	NA	NA	NA	NA
AWV60847.1\|813699_814371_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
AWV60848.1\|814376_815069_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
AWV60849.1\|815065_815815_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
AWV60850.1\|815826_816096_+	hypothetical protein	NA	NA	NA	NA
AWV60851.1\|816258_816558_+	hypothetical protein	NA	NA	NA	NA
AWV60852.1\|816557_816860_+	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	70.7
AWV60853.1\|816899_817265_+	hypothetical protein	NA	NA	NA	NA
AWV60854.1\|817891_818074_+	hypothetical protein	NA	NA	NA	NA
AWV60855.1\|818086_818281_+	hypothetical protein	NA	NA	NA	NA
AWV60856.1\|818313_818526_-	hypothetical protein	NA	NA	NA	NA
AWV60857.1\|818650_818854_+	hypothetical protein	NA	NA	NA	NA
AWV60858.1\|818850_819123_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.5e-20	61.6
AWV60859.1\|819123_819309_+	hypothetical protein	NA	NA	NA	NA
AWV60860.1\|819602_820079_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	50.8
AWV60861.1\|820070_820256_-	hypothetical protein	NA	NA	NA	NA
AWV60862.1\|820224_820953_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-58	52.4
AWV60863.1\|821000_821279_+	hypothetical protein	NA	NA	NA	NA
AWV60864.1\|821280_821667_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	1.9e-10	36.7
AWV60865.1\|821663_822044_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
AWV60866.1\|822155_822608_+\|terminase	terminase small subunit	A0A2H4JFK0	uncultured_Caudovirales_phage	6.8e-47	66.2
AWV60867.1\|822604_824332_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	6.9e-265	73.3
823273:823288	attR	NA	NA	NA	NA
AWV60868.1\|824353_825583_+\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	1.7e-145	65.0
AWV60869.1\|825548_826124_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.6e-69	71.7
AWV60870.1\|826136_827501_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	69.1
AWV60871.1\|827502_827784_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	4.7e-22	62.7
AWV60872.1\|827761_828088_+\|head,tail	phage head-tail joining protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
AWV60873.1\|828077_828416_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.6e-22	45.9
AWV60874.1\|828405_828771_+	hypothetical protein	NA	NA	NA	NA
AWV60875.1\|828777_829404_+\|tail	phage tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	5.7e-28	34.5
AWV60876.1\|829403_829868_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.4e-15	38.9
AWV60877.1\|830062_832372_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	5.5e-84	50.1
AWV62794.1\|832383_833088_+\|tail	phage tail protein	NA	NA	NA	NA
AWV60878.1\|833084_835844_+	CHAP domain-containing protein	D7RWE0	Brochothrix_phage	1.6e-50	55.7
AWV60879.1\|835856_836765_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
AWV60880.1\|836764_837382_+	hypothetical protein	NA	NA	NA	NA
AWV60881.1\|837385_837835_+	hypothetical protein	NA	NA	NA	NA
AWV60882.1\|837834_838329_+	hypothetical protein	NA	NA	NA	NA
AWV60883.1\|838342_838774_+	hypothetical protein	NA	NA	NA	NA
AWV60884.1\|838775_838913_+	XkdX family protein	NA	NA	NA	NA
AWV60885.1\|838949_839243_+	hypothetical protein	NA	NA	NA	NA
AWV60886.1\|839239_839464_+\|holin	holin	NA	NA	NA	NA
AWV60887.1\|839460_840480_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
AWV60888.1\|841256_841556_-	hypothetical protein	NA	NA	NA	NA
AWV60889.1\|841561_841792_-	hypothetical protein	NA	NA	NA	NA
AWV60890.1\|842041_842242_-	hypothetical protein	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
AWV60891.1\|842558_843746_+\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AWV60892.1\|844020_845253_-	aminopeptidase	NA	NA	NA	NA
AWV60893.1\|845507_846077_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV60894.1\|846254_846695_-	flavodoxin	NA	NA	NA	NA
AWV60895.1\|846852_847617_+	type I methionyl aminopeptidase	NA	NA	NA	NA
AWV60896.1\|847648_848572_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
AWV60897.1\|848647_849787_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
AWV60898.1\|849779_850580_+	glycosyltransferase	NA	NA	NA	NA
AWV60899.1\|850579_851407_+	glycosyltransferase	NA	NA	NA	NA
AWV60900.1\|851384_852119_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AWV60901.1\|852218_853085_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	3.7e-102	62.5
AWV60902.1\|853098_853671_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
AWV60903.1\|853692_854721_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
AWV60904.1\|854818_855670_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
AWV60905.1\|855703_857737_+	hypothetical protein	NA	NA	NA	NA
AWV60906.1\|857780_859061_+	hypothetical protein	NA	NA	NA	NA
AWV60907.1\|859270_860077_+	ABC transporter permease	NA	NA	NA	NA
AWV60908.1\|860088_861309_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
AWV60909.1\|861298_862885_+	methyltransferase domain-containing protein	NA	NA	NA	NA
AWV60910.1\|862923_865062_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AWV60911.1\|865429_866413_-	serine hydrolase	NA	NA	NA	NA
AWV60912.1\|866790_868182_+	sugar transferase	NA	NA	NA	NA
AWV60913.1\|868197_869238_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
AWV60914.1\|869256_870342_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
AWV60915.1\|870374_871337_+	glycosyl transferase	NA	NA	NA	NA
AWV60916.1\|871329_872757_+	O-antigen ligase domain-containing protein	NA	NA	NA	NA
AWV60917.1\|872758_873829_+	hypothetical protein	NA	NA	NA	NA
AWV60918.1\|873815_875237_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV60919.1\|875249_876257_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
AWV60920.1\|876268_877273_+	N-acetylneuraminate synthase	NA	NA	NA	NA
AWV60921.1\|877269_878418_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
AWV60922.1\|878390_879068_+	transferase	NA	NA	NA	NA
AWV60923.1\|879057_880200_+	pyridoxal phosphate-dependent aminotransferase	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
AWV60924.1\|880212_881190_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AWV60925.1\|881189_882098_+	dehydrogenase	NA	NA	NA	NA
AWV60926.1\|882098_882851_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
AWV60927.1\|882855_883803_+	UDP-glucose 4-epimerase	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
AWV60928.1\|883976_885272_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	37.2
AWV60929.1\|885760_886714_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1162062 : 1171605

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV61181.1\|1162062_1163451_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	7.0e-10	26.0
AWV61182.1\|1163818_1164007_-	hypothetical protein	NA	NA	NA	NA
AWV61183.1\|1164019_1164397_-	hypothetical protein	NA	NA	NA	NA
AWV61184.1\|1164652_1165381_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
AWV61185.1\|1165380_1165635_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AWV61186.1\|1165636_1166308_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AWV61187.1\|1166308_1168531_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
AWV61188.1\|1168515_1169955_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
AWV62802.1\|1169986_1171030_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
AWV61189.1\|1171026_1171605_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1332946 : 1400740

Streptococcus_phage(33.33%)

tail,transposase,integrase

attL 1370285:1370301|attR 1395317:1395333

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV61336.1\|1332946_1333900_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV61337.1\|1333949_1334573_+	hypothetical protein	NA	NA	NA	NA
AWV61338.1\|1335022_1336072_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV61339.1\|1336068_1336950_+	ABC transporter permease	NA	NA	NA	NA
AWV61340.1\|1336952_1337723_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-09	27.3
AWV61341.1\|1338001_1338856_+	shikimate dehydrogenase	NA	NA	NA	NA
AWV61342.1\|1339033_1340197_+	LytR family transcriptional regulator	NA	NA	NA	NA
AWV61343.1\|1340313_1340724_+	VOC family protein	NA	NA	NA	NA
AWV61344.1\|1340897_1343126_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-128	52.6
AWV61345.1\|1343263_1343581_+	hypothetical protein	NA	NA	NA	NA
AWV61346.1\|1343740_1343977_+	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV61347.1\|1343973_1344372_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
AWV61348.1\|1345038_1345983_-	L-lactate dehydrogenase	NA	NA	NA	NA
AWV62811.1\|1346278_1347223_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV61349.1\|1347442_1348657_+	MFS transporter	NA	NA	NA	NA
AWV61350.1\|1348678_1350694_+	alpha-rhamnosidase	NA	NA	NA	NA
AWV61351.1\|1350776_1352150_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
AWV61352.1\|1352175_1352460_-	PTS lactose transporter subunit IIB	NA	NA	NA	NA
AWV61353.1\|1352461_1354477_-	PRD domain-containing protein	NA	NA	NA	NA
AWV61354.1\|1354655_1354961_-	rRNA processing protein	NA	NA	NA	NA
AWV61355.1\|1356286_1357162_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV61356.1\|1357313_1358156_-	class C sortase	NA	NA	NA	NA
AWV61357.1\|1358247_1360125_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV61358.1\|1360121_1361543_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV61359.1\|1361545_1364935_-	VWA domain-containing protein	NA	NA	NA	NA
AWV62812.1\|1365191_1366583_+	HTH domain-containing protein	NA	NA	NA	NA
AWV61360.1\|1366513_1366705_-	hypothetical protein	NA	NA	NA	NA
AWV61361.1\|1366711_1367986_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.2e-57	36.4
AWV61362.1\|1368164_1368812_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV61363.1\|1368819_1369506_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-29	37.0
AWV61364.1\|1369511_1370585_-	ABC transporter permease	NA	NA	NA	NA
1370285:1370301	attL	NA	NA	NA	NA
AWV61365.1\|1370806_1371481_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-29	35.3
AWV61366.1\|1371485_1372826_+	sensor histidine kinase	NA	NA	NA	NA
AWV61367.1\|1372974_1373961_-	DUF2382 domain-containing protein	NA	NA	NA	NA
AWV61368.1\|1374684_1375716_+\|integrase	integrase	NA	NA	NA	NA
AWV61369.1\|1375824_1377357_+	acetate--CoA ligase	NA	NA	NA	NA
AWV61370.1\|1377495_1378308_+	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AWV61371.1\|1378297_1378783_+	ECF transporter S component	NA	NA	NA	NA
AWV61372.1\|1378805_1379351_+	TIGR01440 family protein	NA	NA	NA	NA
AWV61373.1\|1379423_1381067_-	alpha-glucosidase	NA	NA	NA	NA
AWV61374.1\|1381195_1383424_-	VWA domain-containing protein	NA	NA	NA	NA
AWV61375.1\|1383456_1383936_-	hypothetical protein	NA	NA	NA	NA
AWV61376.1\|1384200_1385160_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV61377.1\|1385328_1386624_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
AWV61378.1\|1386742_1387591_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	9.8e-15	37.4
AWV61379.1\|1387747_1389358_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV61380.1\|1389601_1389919_-	AzlD domain-containing protein	NA	NA	NA	NA
AWV61381.1\|1389911_1390691_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AWV61382.1\|1390823_1391759_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
AWV61383.1\|1391834_1392227_-	DUF4430 domain-containing protein	NA	NA	NA	NA
AWV61384.1\|1392207_1392726_-	hypothetical protein	NA	NA	NA	NA
AWV61385.1\|1392873_1393947_-	hypothetical protein	NA	NA	NA	NA
AWV61386.1\|1393939_1394857_-	viral A-type inclusion protein	NA	NA	NA	NA
AWV61387.1\|1395059_1395251_-	hypothetical protein	NA	NA	NA	NA
AWV61388.1\|1395409_1396918_+	DUF1846 domain-containing protein	NA	NA	NA	NA
1395317:1395333	attR	NA	NA	NA	NA
AWV61389.1\|1397153_1398335_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AWV61390.1\|1398423_1398972_+	guanylate kinase	S4W1R9	Pandoravirus	3.3e-11	29.4
AWV61391.1\|1399227_1399740_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV61392.1\|1399783_1400740_-\|tail	phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_6

1447410 : 1490095

Streptococcus_phage(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV61436.1\|1447410_1448559_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
AWV61437.1\|1448575_1448980_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV61438.1\|1450096_1450570_+	DUF2975 domain-containing protein	NA	NA	NA	NA
AWV61439.1\|1450578_1450806_+	transcriptional regulator	NA	NA	NA	NA
AWV61440.1\|1451441_1451813_+	hypothetical protein	NA	NA	NA	NA
AWV61441.1\|1452068_1452311_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AWV61442.1\|1452342_1453245_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
AWV61443.1\|1453257_1453446_-	DUF2273 domain-containing protein	NA	NA	NA	NA
AWV61444.1\|1453459_1454023_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
AWV61445.1\|1454060_1454954_-	SDR family NAD(P)-dependent oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
AWV61446.1\|1455031_1455970_-	magnesium transporter CorA family protein	NA	NA	NA	NA
AWV61447.1\|1456003_1456354_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
AWV61448.1\|1456386_1457289_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
AWV61449.1\|1457281_1458139_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
AWV61450.1\|1458472_1459282_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AWV61451.1\|1459321_1459819_+	cysteine hydrolase	NA	NA	NA	NA
AWV61452.1\|1460463_1460787_+	hypothetical protein	NA	NA	NA	NA
AWV61453.1\|1460950_1461205_+	hypothetical protein	NA	NA	NA	NA
AWV61454.1\|1461274_1461520_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV61455.1\|1461595_1461961_+	hypothetical protein	NA	NA	NA	NA
AWV61456.1\|1462021_1462585_-	hypothetical protein	NA	NA	NA	NA
AWV61457.1\|1463236_1464532_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV61458.1\|1464552_1464732_+	hypothetical protein	NA	NA	NA	NA
AWV61459.1\|1464770_1466072_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
AWV61460.1\|1466175_1466376_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
AWV61461.1\|1467127_1467841_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
AWV61462.1\|1467833_1468919_-	mannonate dehydratase	NA	NA	NA	NA
AWV61463.1\|1468935_1469379_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV62814.1\|1469412_1469766_-	hypothetical protein	NA	NA	NA	NA
AWV61464.1\|1469877_1470279_-	hypothetical protein	NA	NA	NA	NA
AWV61465.1\|1470315_1470825_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV61466.1\|1470846_1471704_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV61467.1\|1471721_1472555_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV61468.1\|1472568_1473366_-	oxidoreductase	NA	NA	NA	NA
AWV61469.1\|1473398_1473683_-	alcohol dehydrogenase	NA	NA	NA	NA
AWV61470.1\|1473679_1474681_-	hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
AWV62815.1\|1474682_1475585_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
AWV61471.1\|1475748_1476597_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV61472.1\|1477242_1477449_+	DUF3955 domain-containing protein	NA	NA	NA	NA
AWV61473.1\|1477650_1478652_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
AWV61474.1\|1478656_1480570_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61475.1\|1480737_1481244_-	cysteine hydrolase	NA	NA	NA	NA
AWV61476.1\|1481403_1481844_+	transcriptional regulator	NA	NA	NA	NA
AWV61477.1\|1481869_1483027_-	hypothetical protein	NA	NA	NA	NA
AWV61478.1\|1483029_1483386_-	hypothetical protein	NA	NA	NA	NA
AWV61479.1\|1483683_1484658_-	peptidase	NA	NA	NA	NA
AWV61480.1\|1484853_1485693_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWV61481.1\|1485877_1486765_+	rotamase	NA	NA	NA	NA
AWV62816.1\|1487358_1488054_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
AWV61482.1\|1488037_1488436_-	PTS sorbitol transporter subunit IIA	NA	NA	NA	NA
AWV61483.1\|1488844_1490095_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_7

1497945 : 1544784

Streptococcus_phage(44.44%)

transposase,integrase

attL 1493135:1493150|attR 1502856:1502871

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1493135:1493150	attL	NA	NA	NA	NA
AWV61495.1\|1497945_1499124_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV61496.1\|1499279_1500233_-\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV61497.1\|1500289_1501417_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
AWV61498.1\|1501634_1502777_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-39	32.4
AWV61499.1\|1502781_1502967_-	DUF3173 domain-containing protein	NA	NA	NA	NA
1502856:1502871	attR	NA	NA	NA	NA
AWV61500.1\|1503320_1503566_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV61501.1\|1503559_1503961_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV61502.1\|1504147_1505956_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	2.3e-154	48.4
AWV61503.1\|1505978_1507745_-	beta-hexosaminidase	NA	NA	NA	NA
AWV61504.1\|1507757_1508552_-	HAD family hydrolase	NA	NA	NA	NA
AWV61505.1\|1508561_1509938_-	MFS transporter	NA	NA	NA	NA
AWV61506.1\|1510057_1510705_-	bifunctional 2-keto-4-hydroxyglutarate aldolase/2-keto-3-deoxy-6-phosphogluconate aldolase	NA	NA	NA	NA
AWV61507.1\|1510788_1512216_-	glucuronate isomerase	NA	NA	NA	NA
AWV61508.1\|1512289_1513369_-	mannonate dehydratase	NA	NA	NA	NA
AWV61509.1\|1513371_1515003_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
AWV61510.1\|1515306_1515978_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV61511.1\|1516990_1518310_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
AWV61512.1\|1518818_1519271_-	hypothetical protein	NA	NA	NA	NA
AWV61513.1\|1519277_1519826_-	peptidase	NA	NA	NA	NA
AWV61514.1\|1520079_1521399_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
AWV61515.1\|1521554_1521887_-	hypothetical protein	NA	NA	NA	NA
AWV61516.1\|1521900_1522158_-	hypothetical protein	NA	NA	NA	NA
AWV62817.1\|1522352_1522895_-	hypothetical protein	NA	NA	NA	NA
AWV61517.1\|1522915_1524007_-	CHAP domain-containing protein	A0A0B5A7F4	Streptococcus_phage	4.6e-25	29.9
AWV61518.1\|1524014_1526225_-	hypothetical protein	NA	NA	NA	NA
AWV61519.1\|1526240_1528769_-	ATPase	NA	NA	NA	NA
AWV61520.1\|1528820_1529231_-	hypothetical protein	NA	NA	NA	NA
AWV61521.1\|1529243_1529462_-	hypothetical protein	NA	NA	NA	NA
AWV61522.1\|1529458_1530451_-	conjugal transfer protein	NA	NA	NA	NA
AWV61523.1\|1530529_1531441_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61524.1\|1531459_1531804_-	hypothetical protein	NA	NA	NA	NA
AWV61525.1\|1532460_1532961_-	hypothetical protein	NA	NA	NA	NA
AWV61526.1\|1532961_1533507_-	hypothetical protein	NA	NA	NA	NA
AWV61527.1\|1533503_1534760_-	transcriptional regulator	NA	NA	NA	NA
AWV61528.1\|1535120_1535432_-	hypothetical protein	NA	NA	NA	NA
AWV62818.1\|1535454_1536765_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.3e-61	36.8
AWV61529.1\|1537378_1537831_-	hypothetical protein	NA	NA	NA	NA
AWV61530.1\|1537832_1538198_-	hypothetical protein	NA	NA	NA	NA
AWV62819.1\|1538296_1541596_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61531.1\|1542726_1542966_-	hypothetical protein	NA	NA	NA	NA
AWV61532.1\|1543055_1543328_-	hypothetical protein	A0A1W6JN36	Lactococcus_phage	1.6e-19	57.4
AWV61533.1\|1543410_1543662_-	hypothetical protein	D2IZL0	Enterococcus_phage	1.1e-06	58.5
AWV61534.1\|1543824_1544784_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1648979 : 1771182

110

Streptococcus_phage(35.14%)

tRNA,protease,transposase,integrase

attL 1661540:1661557|attR 1685026:1685043

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV61625.1\|1648979_1649933_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV61626.1\|1649929_1650511_-	DUF443 family protein	NA	NA	NA	NA
AWV61627.1\|1650697_1651348_-	hypothetical protein	NA	NA	NA	NA
AWV61628.1\|1651338_1651539_-	hypothetical protein	NA	NA	NA	NA
AWV61629.1\|1651890_1652826_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.0e-53	39.1
AWV61630.1\|1652859_1653858_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.6e-115	62.9
AWV61631.1\|1653854_1654739_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.4e-08	31.4
AWV61632.1\|1654873_1655605_-	amino acid racemase	NA	NA	NA	NA
AWV61633.1\|1655608_1656874_-	D-aspartate ligase	NA	NA	NA	NA
AWV61634.1\|1657136_1659953_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.6e-311	57.4
AWV61635.1\|1659962_1661957_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
1661540:1661557	attL	NA	NA	NA	NA
AWV61636.1\|1662215_1663718_+	ABC transporter permease subunit	NA	NA	NA	NA
AWV61637.1\|1663719_1664457_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-34	44.7
AWV61638.1\|1664627_1665821_-\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	3.9e-142	63.8
AWV61639.1\|1665899_1666106_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
AWV61640.1\|1666098_1667241_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.5e-63	35.4
AWV61641.1\|1667752_1668388_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV61642.1\|1668893_1668980_+	tetracycline resistance protein	NA	NA	NA	NA
AWV61643.1\|1668995_1670915_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
AWV61644.1\|1671015_1671201_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
AWV61645.1\|1671260_1671614_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
AWV62821.1\|1671818_1671890_+	hypothetical protein	NA	NA	NA	NA
AWV61646.1\|1672117_1672537_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV61647.1\|1672562_1672769_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV61648.1\|1673181_1673811_+	sugar diacid utilization regulator	NA	NA	NA	NA
AWV61649.1\|1673892_1675059_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7
AWV61650.1\|1675209_1677039_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-136	48.8
AWV61651.1\|1677089_1677653_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AWV61652.1\|1677746_1678790_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AWV61653.1\|1680204_1680432_-	adenosine deaminase	NA	NA	NA	NA
AWV61654.1\|1680915_1681506_+	glutamine amidotransferase	NA	NA	NA	NA
AWV61655.1\|1681695_1682409_+	hypothetical protein	NA	NA	NA	NA
AWV61656.1\|1682588_1683884_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV61657.1\|1684045_1685056_-	LD-carboxypeptidase	NA	NA	NA	NA
1685026:1685043	attR	NA	NA	NA	NA
AWV61658.1\|1685092_1685575_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
AWV61659.1\|1685724_1686093_+	iron chaperone	NA	NA	NA	NA
AWV61660.1\|1686557_1687010_+	DNA-binding protein	NA	NA	NA	NA
AWV61661.1\|1687133_1687985_-	sugar transporter	NA	NA	NA	NA
AWV61662.1\|1687997_1688783_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AWV61663.1\|1689134_1690076_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
AWV61664.1\|1690079_1691003_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AWV61665.1\|1694180_1694354_+	sugar ABC transporter permease	NA	NA	NA	NA
AWV61666.1\|1694624_1695920_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV61667.1\|1696114_1696462_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
AWV61668.1\|1696488_1698795_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
AWV61669.1\|1698807_1699119_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
AWV61670.1\|1699115_1699409_-	YlxR family protein	NA	NA	NA	NA
AWV61671.1\|1699430_1700606_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AWV61672.1\|1700628_1701102_-	ribosome maturation factor RimP	NA	NA	NA	NA
AWV61673.1\|1701246_1705605_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.9e-21	40.8
AWV61674.1\|1705816_1707526_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AWV61675.1\|1707593_1708862_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AWV61676.1\|1709022_1709823_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AWV61677.1\|1709819_1710632_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
AWV61678.1\|1711040_1712291_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV61679.1\|1712622_1713795_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV61680.1\|1713941_1714499_-	ribosome recycling factor	NA	NA	NA	NA
AWV61681.1\|1714501_1715224_-	UMP kinase	NA	NA	NA	NA
AWV61682.1\|1715359_1716241_-	elongation factor Ts	NA	NA	NA	NA
AWV61683.1\|1716339_1717122_-	30S ribosomal protein S2	NA	NA	NA	NA
AWV61684.1\|1717480_1717960_+	ArgR family transcriptional regulator	NA	NA	NA	NA
AWV62822.1\|1718176_1719268_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
AWV61685.1\|1720391_1722083_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
AWV61686.1\|1722502_1723450_-	carbamate kinase	NA	NA	NA	NA
AWV61687.1\|1723564_1724584_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AWV61688.1\|1724674_1725904_-	arginine deiminase	NA	NA	NA	NA
AWV61689.1\|1726364_1727066_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AWV61690.1\|1727674_1728691_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
AWV61691.1\|1728687_1729152_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AWV61692.1\|1729158_1729701_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
AWV62823.1\|1729684_1730509_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AWV61693.1\|1730597_1731578_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
AWV61694.1\|1731601_1733086_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AWV61695.1\|1733097_1734087_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
AWV61696.1\|1734334_1734502_+	DUF3042 family protein	NA	NA	NA	NA
AWV61697.1\|1734563_1736375_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AWV61698.1\|1736371_1736737_-	DUF488 family protein	NA	NA	NA	NA
AWV61699.1\|1736899_1737295_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AWV61700.1\|1737312_1738275_-	ROK family protein	NA	NA	NA	NA
AWV61701.1\|1738274_1738487_-	DUF910 family protein	NA	NA	NA	NA
AWV61702.1\|1738507_1739206_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AWV61703.1\|1739225_1739768_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AWV61704.1\|1739899_1740904_-	iron ABC transporter permease	NA	NA	NA	NA
AWV61705.1\|1740900_1741890_-	iron ABC transporter permease	NA	NA	NA	NA
AWV61706.1\|1741886_1742693_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
AWV61707.1\|1742858_1743815_+	ferrichrome ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV61708.1\|1743891_1744410_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
AWV61709.1\|1744497_1744647_-	50S ribosomal protein L33	NA	NA	NA	NA
AWV61710.1\|1744874_1745321_+	DUF2188 domain-containing protein	NA	NA	NA	NA
AWV61711.1\|1745515_1747411_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
AWV61712.1\|1747735_1748710_-	linear amide C-N hydrolase	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
AWV61713.1\|1749275_1749842_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWV61714.1\|1750097_1751429_+	DUF1576 domain-containing protein	NA	NA	NA	NA
AWV61715.1\|1751394_1751745_+	hypothetical protein	NA	NA	NA	NA
AWV61716.1\|1752256_1752601_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AWV61717.1\|1752866_1753826_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV61718.1\|1754015_1754612_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
AWV61719.1\|1754735_1756535_+	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
AWV61720.1\|1756812_1757025_-	hypothetical protein	NA	NA	NA	NA
AWV61721.1\|1757888_1758848_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
AWV61722.1\|1759060_1759969_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV61723.1\|1760017_1760404_+	YxeA family protein	NA	NA	NA	NA
AWV61724.1\|1760711_1762058_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
AWV61725.1\|1762169_1763519_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
AWV61726.1\|1763635_1764889_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
AWV61727.1\|1764959_1765445_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AWV61728.1\|1765467_1766226_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
AWV61729.1\|1766241_1767420_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
AWV61730.1\|1767649_1769770_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
AWV61731.1\|1769886_1771182_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_9

1776885 : 1947900

184

Streptococcus_phage(21.13%)

capsid,portal,head,transposase,integrase,terminase,tRNA,protease,tail,holin

attL 1769805:1769864|attR 1932428:1933941

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1769805:1769864	attL	NA	NA	NA	NA
AWV61738.1\|1776885_1778181_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV61739.1\|1778499_1778802_+	hypothetical protein	NA	NA	NA	NA
AWV61740.1\|1779549_1779732_+	hypothetical protein	NA	NA	NA	NA
AWV61741.1\|1779945_1780260_-	hypothetical protein	NA	NA	NA	NA
AWV61742.1\|1780376_1781555_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV61743.1\|1781891_1782131_+	hypothetical protein	NA	NA	NA	NA
AWV61744.1\|1782492_1782753_-	hypothetical protein	NA	NA	NA	NA
AWV61745.1\|1782937_1783435_-	GAF domain-containing protein	NA	NA	NA	NA
AWV61746.1\|1783564_1784275_-	acetolactate decarboxylase	NA	NA	NA	NA
AWV61747.1\|1784287_1785952_-	acetolactate synthase AlsS	NA	NA	NA	NA
AWV61748.1\|1786156_1786819_-	DUF624 domain-containing protein	NA	NA	NA	NA
AWV61749.1\|1786828_1787644_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV61750.1\|1787905_1788349_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWV61751.1\|1788482_1788821_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWV61752.1\|1788808_1789186_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWV61753.1\|1789409_1790603_+	MFS transporter	NA	NA	NA	NA
AWV61754.1\|1790768_1791191_-	HTH domain-containing protein	NA	NA	NA	NA
AWV61755.1\|1791585_1791780_+	hypothetical protein	NA	NA	NA	NA
AWV61756.1\|1791776_1792271_+	hypothetical protein	NA	NA	NA	NA
AWV61757.1\|1792238_1792436_-	hypothetical protein	NA	NA	NA	NA
AWV61758.1\|1792432_1793605_-	class C sortase	NA	NA	NA	NA
AWV61759.1\|1793810_1794626_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61760.1\|1794775_1795222_-	cell wall anchor protein	NA	NA	NA	NA
AWV61761.1\|1795218_1796232_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV61762.1\|1796262_1796721_-	cell wall anchor protein	NA	NA	NA	NA
AWV61763.1\|1796717_1799045_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61764.1\|1799686_1799800_+\|protease	CAAX protease	NA	NA	NA	NA
AWV61765.1\|1799887_1800181_-	DUF2087 domain-containing protein	NA	NA	NA	NA
AWV61766.1\|1800217_1800403_+	hypothetical protein	NA	NA	NA	NA
AWV61767.1\|1800583_1801762_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
AWV61768.1\|1801865_1802180_-	DNA-binding protein	NA	NA	NA	NA
AWV61769.1\|1802286_1802502_+	hypothetical protein	NA	NA	NA	NA
AWV62824.1\|1802801_1803044_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWV61770.1\|1803030_1803459_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AWV61771.1\|1803610_1805158_-\|transposase	IS66 family transposase	NA	NA	NA	NA
AWV61772.1\|1805259_1805613_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AWV61773.1\|1805602_1805797_-	hypothetical protein	NA	NA	NA	NA
AWV61774.1\|1805927_1807090_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AWV61775.1\|1807654_1808029_-	lactoylglutathione lyase	NA	NA	NA	NA
AWV61776.1\|1808051_1809452_-	beta-fructofuranosidase	NA	NA	NA	NA
AWV61777.1\|1809455_1809866_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV61778.1\|1809883_1810375_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV61779.1\|1810384_1811176_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV61780.1\|1811168_1811942_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV61781.1\|1812097_1814632_-	PRD domain-containing protein	NA	NA	NA	NA
AWV61782.1\|1814713_1815586_-	ROK family protein	NA	NA	NA	NA
AWV61783.1\|1815621_1816089_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AWV61784.1\|1816098_1817568_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
AWV61785.1\|1817638_1819057_-	beta-fructofuranosidase	NA	NA	NA	NA
AWV61786.1\|1819178_1820159_-	LacI family transcriptional regulator	NA	NA	NA	NA
AWV61787.1\|1820438_1821601_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
AWV61788.1\|1821693_1822203_-	MarR family transcriptional regulator	NA	NA	NA	NA
AWV61789.1\|1822541_1823495_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AWV61790.1\|1823447_1823684_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWV61791.1\|1824103_1825225_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AWV62825.1\|1825552_1826962_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AWV61792.1\|1826958_1827687_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
AWV61793.1\|1827814_1828726_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
AWV61794.1\|1828742_1829750_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
AWV61795.1\|1829746_1831876_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
AWV61796.1\|1832176_1833364_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
AWV61797.1\|1834408_1836235_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
AWV61798.1\|1838468_1838858_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
AWV61799.1\|1838907_1839804_-	phosphoesterase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
AWV61800.1\|1839806_1841654_-	PHP domain-containing protein	NA	NA	NA	NA
AWV61801.1\|1841750_1842251_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
AWV61802.1\|1842263_1842485_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
AWV61803.1\|1842489_1842627_-	DUF3789 domain-containing protein	NA	NA	NA	NA
AWV61804.1\|1842623_1843808_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
AWV61805.1\|1844063_1844318_-	hypothetical protein	NA	NA	NA	NA
AWV61806.1\|1844342_1845485_-	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
AWV61807.1\|1845544_1846897_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
AWV61808.1\|1846967_1847321_-	DNA-damage-inducible protein J	NA	NA	NA	NA
AWV61809.1\|1847321_1847696_-	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
AWV61810.1\|1847708_1848023_-	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
AWV61811.1\|1848136_1851364_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV61812.1\|1851442_1852105_-	hypothetical protein	NA	NA	NA	NA
AWV61813.1\|1852721_1852952_+	hypothetical protein	NA	NA	NA	NA
AWV61814.1\|1852957_1853257_+	hypothetical protein	NA	NA	NA	NA
AWV61815.1\|1854251_1855460_-	hypothetical protein	NA	NA	NA	NA
AWV61816.1\|1855574_1856591_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	9.8e-62	66.7
AWV61817.1\|1856601_1856799_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
AWV61818.1\|1856814_1857057_-\|holin	holin	D2J075	Enterococcus_phage	1.2e-21	63.3
AWV61819.1\|1857091_1857229_-	XkdX family protein	NA	NA	NA	NA
AWV61820.1\|1857230_1857677_-	hypothetical protein	NA	NA	NA	NA
AWV61821.1\|1857839_1859900_-	DUF2479 domain-containing protein	A0A249XZH9	Enterococcus_phage	1.7e-65	44.9
AWV61822.1\|1859917_1860742_-	hypothetical protein	NA	NA	NA	NA
AWV61823.1\|1860745_1861795_-	hypothetical protein	Q5K5I4	Oenococcus_phage	1.9e-31	27.9
AWV61824.1\|1861791_1862664_-	hypothetical protein	NA	NA	NA	NA
AWV61825.1\|1862664_1866513_-\|tail	phage tail protein	A0A0M5M3L4	Enterococcus_phage	0.0e+00	76.0
AWV61826.1\|1866512_1866704_-	hypothetical protein	NA	NA	NA	NA
AWV61827.1\|1866727_1867039_-	hypothetical protein	A0A0S2MY76	Enterococcus_phage	4.0e-14	44.8
AWV61828.1\|1867163_1867724_-\|tail	phage tail protein	V5UQL2	Enterococcus_phage	3.4e-40	46.2
AWV61829.1\|1867739_1868111_-	hypothetical protein	A0A060ANH4	Enterococcus_phage	2.5e-23	46.2
AWV61830.1\|1868107_1868503_-	hypothetical protein	C0LZZ2	Enterococcus_phage	4.3e-21	44.5
AWV61831.1\|1868499_1868835_-\|head,tail	head-tail adaptor protein	A0A249XUC8	Enterococcus_phage	2.2e-18	44.1
AWV61832.1\|1868838_1869165_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
AWV61833.1\|1869179_1870373_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.5e-114	55.4
AWV61834.1\|1870369_1871047_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	4.9e-49	51.0
AWV61835.1\|1871081_1872302_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.2e-61	38.5
AWV61836.1\|1873856_1874636_-	hypothetical protein	A0A220BXN1	Staphylococcus_phage	8.1e-40	45.9
AWV61837.1\|1874710_1874869_+	ribbon-helix-helix domain-containing protein	A0A0A7RUX5	Clostridium_phage	5.3e-07	65.9
AWV61838.1\|1875335_1875857_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.1e-16	34.2
AWV61839.1\|1875958_1876123_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.6e-14	69.8
AWV61840.1\|1876279_1876597_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	2.0e-13	39.8
AWV61841.1\|1876597_1877143_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV61842.1\|1877142_1877331_-	hypothetical protein	NA	NA	NA	NA
AWV61843.1\|1877327_1877558_-	hypothetical protein	NA	NA	NA	NA
AWV61844.1\|1878338_1878752_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-56	81.0
AWV61845.1\|1878954_1879206_+	hypothetical protein	NA	NA	NA	NA
AWV61846.1\|1879238_1879526_-	hypothetical protein	NA	NA	NA	NA
AWV61847.1\|1879522_1879726_-	toxin PIN	NA	NA	NA	NA
AWV61848.1\|1879655_1879925_-	hypothetical protein	NA	NA	NA	NA
AWV61849.1\|1879921_1880452_-	DUF1642 domain-containing protein	A0A059T7S4	Listeria_phage	1.8e-11	37.2
AWV61850.1\|1880444_1880759_-	hypothetical protein	D2IZY1	Enterococcus_phage	4.6e-34	72.7
AWV61851.1\|1880758_1881064_-	hypothetical protein	NA	NA	NA	NA
AWV61852.1\|1881060_1881222_-	antitoxin	NA	NA	NA	NA
AWV61853.1\|1881218_1881536_-	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	3.6e-31	61.5
AWV61854.1\|1881782_1884095_-	DNA primase	R4IBW2	Listeria_phage	1.3e-250	55.9
AWV61855.1\|1884109_1884610_-	DUF669 domain-containing protein	A8ATF2	Listeria_phage	1.1e-34	52.9
AWV61856.1\|1884611_1885085_-	transcriptional regulator	A8ATW6	Listeria_phage	7.7e-09	43.9
AWV61857.1\|1885075_1886425_-	ATP-dependent helicase	A0A0P0ID30	Lactobacillus_phage	4.1e-132	53.4
AWV61858.1\|1886399_1887086_-	DNA-binding protein	A0A1P8VVS4	Streptococcus_phage	1.1e-61	52.7
AWV61859.1\|1887204_1887531_-	hypothetical protein	F0PIH7	Enterococcus_phage	1.6e-26	57.8
AWV61860.1\|1887527_1887959_-	hypothetical protein	NA	NA	NA	NA
AWV61861.1\|1888408_1888888_-	hypothetical protein	E5DV79	Deep-sea_thermophilic_phage	5.3e-34	49.0
AWV61862.1\|1888820_1889138_-	hypothetical protein	NA	NA	NA	NA
AWV61863.1\|1889305_1889764_+	hypothetical protein	NA	NA	NA	NA
AWV61864.1\|1890066_1890315_-	hypothetical protein	NA	NA	NA	NA
AWV61865.1\|1890327_1890513_-	XRE family transcriptional regulator	Q5YAA3	Bacillus_phage	8.4e-12	56.7
AWV61866.1\|1890816_1891191_+	XRE family transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
AWV61867.1\|1891195_1891624_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV61868.1\|1891673_1892327_+	hypothetical protein	NA	NA	NA	NA
AWV61869.1\|1892462_1893029_+	hypothetical protein	A0A0P0IXE0	Lactobacillus_phage	1.9e-06	92.3
AWV61870.1\|1893144_1894281_+\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	8.4e-54	36.8
AWV61871.1\|1894412_1894760_-	50S ribosomal protein L19	NA	NA	NA	NA
AWV61872.1\|1894895_1895657_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AWV61873.1\|1895646_1896168_-	ribosome maturation factor RimM	NA	NA	NA	NA
AWV61874.1\|1896337_1897129_-	hypothetical protein	NA	NA	NA	NA
AWV61875.1\|1897253_1897505_-	KH domain-containing protein	NA	NA	NA	NA
AWV61876.1\|1897516_1897792_-	30S ribosomal protein S16	NA	NA	NA	NA
AWV61877.1\|1898044_1898599_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
AWV61878.1\|1898677_1899199_-	dihydrofolate reductase	NA	NA	NA	NA
AWV61879.1\|1899202_1899781_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AWV61880.1\|1899892_1901311_-	signal recognition particle protein	NA	NA	NA	NA
AWV61881.1\|1901331_1901670_-	putative DNA-binding protein	NA	NA	NA	NA
AWV61882.1\|1901629_1902133_-	DUF523 domain-containing protein	NA	NA	NA	NA
AWV61883.1\|1902263_1902968_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.4e-38	36.2
AWV61884.1\|1902964_1904701_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
AWV61885.1\|1904803_1907275_-	HAD family hydrolase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.1e-45	29.2
AWV61886.1\|1907599_1908490_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
AWV61887.1\|1908686_1909169_-	hypothetical protein	NA	NA	NA	NA
AWV61888.1\|1909376_1909742_+	hypothetical protein	NA	NA	NA	NA
AWV61889.1\|1909945_1910263_-	hypothetical protein	NA	NA	NA	NA
AWV61890.1\|1910992_1911967_-	linear amide C-N hydrolase	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
AWV61891.1\|1912376_1913627_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV61892.1\|1913912_1914170_+	hypothetical protein	NA	NA	NA	NA
AWV61893.1\|1914401_1914815_-	DUF4231 domain-containing protein	NA	NA	NA	NA
AWV61894.1\|1915093_1916433_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
AWV61895.1\|1916502_1917078_-	N-acetylmuramoyl-L-alanine amidase	Q9MCC6	Lactobacillus_phage	4.8e-13	35.9
AWV61896.1\|1917158_1918320_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-79	51.3
AWV61897.1\|1918694_1919264_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AWV61898.1\|1919337_1920627_-	hypothetical protein	NA	NA	NA	NA
AWV62826.1\|1920980_1921829_+	MoxR family ATPase	NA	NA	NA	NA
AWV61899.1\|1921842_1922916_+	DUF58 domain-containing protein	NA	NA	NA	NA
AWV61900.1\|1922905_1925077_+	transglutaminase domain-containing protein	NA	NA	NA	NA
AWV62827.1\|1925188_1927345_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.9e-71	32.3
AWV61901.1\|1927487_1929674_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.4e-121	38.7
AWV61902.1\|1929673_1929883_-	copper-binding protein	NA	NA	NA	NA
AWV61903.1\|1929895_1930336_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
AWV62828.1\|1930409_1930883_-	topology modulation family protein	A0A097BYE2	Leuconostoc_phage	1.1e-10	28.8
AWV61904.1\|1931109_1932405_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
AWV61905.1\|1932714_1934181_-	amino acid permease	NA	NA	NA	NA
1932428:1933941	attR	NA	NA	NA	NA
AWV61906.1\|1934491_1936576_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-117	35.7
AWV61907.1\|1937099_1937459_-	YccF domain-containing protein	NA	NA	NA	NA
AWV61908.1\|1937488_1937830_-	hypothetical protein	NA	NA	NA	NA
AWV61909.1\|1937826_1938501_-	GDSL family lipase	NA	NA	NA	NA
AWV61910.1\|1939295_1940594_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
AWV62829.1\|1940633_1941824_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AWV61911.1\|1941844_1942372_-	peptidase	NA	NA	NA	NA
AWV61912.1\|1942418_1945208_-	DNA polymerase III subunit epsilon	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
AWV61913.1\|1945354_1945555_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
AWV61914.1\|1946006_1946327_-	hypothetical protein	NA	NA	NA	NA
AWV61915.1\|1946604_1947900_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_10

1984043 : 2047655

Bacillus_phage(28.57%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV61951.1\|1984043_1984961_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AWV61952.1\|1985346_1986165_-	DNA repair protein RecO	NA	NA	NA	NA
AWV61953.1\|1986307_1987207_-	GTPase Era	NA	NA	NA	NA
AWV61954.1\|1987221_1987623_-	diacylglycerol kinase family protein	NA	NA	NA	NA
AWV61955.1\|1987600_1988077_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
AWV61956.1\|1988105_1990298_-	HDIG domain-containing protein	NA	NA	NA	NA
AWV61957.1\|1990321_1991293_-	PhoH family protein	W8D063	Erwinia_phage	3.5e-48	49.8
AWV61958.1\|1991997_1993377_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
AWV61959.1\|1993658_1994999_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.9e-65	36.0
AWV61960.1\|1995155_1996451_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
AWV61961.1\|1996585_1997032_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.6e-19	38.8
AWV61962.1\|1997058_1997235_-	30S ribosomal protein S21	NA	NA	NA	NA
AWV61963.1\|1997396_1997825_-	transcriptional repressor	NA	NA	NA	NA
AWV61964.1\|1997916_1998777_+	kinase/pyrophosphorylase	NA	NA	NA	NA
AWV61965.1\|1998870_1999164_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AWV61966.1\|1999236_2000964_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.4e-209	62.9
AWV61967.1\|2001176_2002103_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.3e-89	52.8
AWV61968.1\|2002247_2003681_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AWV61969.1\|2003680_2005084_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AWV61970.1\|2005023_2005245_-	hypothetical protein	NA	NA	NA	NA
AWV61971.1\|2005313_2006216_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV61972.1\|2006256_2008143_-	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
AWV61973.1\|2009426_2011211_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.1e-47	27.6
AWV61974.1\|2011210_2012962_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-56	30.4
AWV61975.1\|2013103_2013328_-	YneF family protein	NA	NA	NA	NA
AWV61976.1\|2013383_2013608_-	hypothetical protein	NA	NA	NA	NA
AWV61977.1\|2013578_2015165_+	divalent metal cation transporter	NA	NA	NA	NA
AWV61978.1\|2015230_2017006_-	glucosyltransferase	NA	NA	NA	NA
AWV61979.1\|2017216_2018119_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.5e-21	30.7
AWV61980.1\|2018397_2020743_+	penicillin-binding protein	NA	NA	NA	NA
AWV61981.1\|2020983_2022162_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
AWV61982.1\|2022251_2022518_-	hypothetical protein	NA	NA	NA	NA
AWV61983.1\|2022510_2022834_-	hypothetical protein	NA	NA	NA	NA
AWV61984.1\|2022845_2024102_-	lipase	NA	NA	NA	NA
AWV61985.1\|2024098_2024494_-	hypothetical protein	NA	NA	NA	NA
AWV61986.1\|2024536_2024788_-	hypothetical protein	NA	NA	NA	NA
AWV61987.1\|2024787_2025183_-	hypothetical protein	NA	NA	NA	NA
AWV61988.1\|2025537_2026539_-	catabolite control protein A	NA	NA	NA	NA
AWV61989.1\|2026748_2027852_+	aminopeptidase P family protein	NA	NA	NA	NA
AWV61990.1\|2027914_2028517_-	YtxH domain-containing protein	NA	NA	NA	NA
AWV61991.1\|2028519_2028960_-	DUF948 domain-containing protein	NA	NA	NA	NA
AWV61992.1\|2029084_2030023_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	5.5e-75	51.2
AWV61993.1\|2030037_2031063_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AWV61994.1\|2031106_2031937_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AWV61995.1\|2031951_2032890_-	HPr kinase/phosphorylase	NA	NA	NA	NA
AWV61996.1\|2033056_2033407_-\|holin	phage holin family protein	NA	NA	NA	NA
AWV61997.1\|2033406_2033724_-	PspC domain-containing protein	NA	NA	NA	NA
AWV61998.1\|2033749_2033947_-	hypothetical protein	NA	NA	NA	NA
AWV61999.1\|2034023_2035592_-	hypothetical protein	NA	NA	NA	NA
AWV62000.1\|2035691_2036459_-	YibE/F family protein	NA	NA	NA	NA
AWV62001.1\|2036455_2037496_-	YibE/F family protein	NA	NA	NA	NA
AWV62002.1\|2037617_2038913_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
AWV62003.1\|2039231_2039909_-	phosphate transport system regulatory protein PhoU	NA	NA	NA	NA
AWV62004.1\|2039921_2040680_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-19	31.3
AWV62005.1\|2040695_2041502_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-13	28.4
AWV62006.1\|2041516_2042401_-	phosphate ABC transporter permease PtsA	NA	NA	NA	NA
AWV62007.1\|2042400_2043321_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AWV62008.1\|2043435_2044293_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
AWV62009.1\|2044629_2046078_-	cardiolipin synthase	NA	NA	NA	NA
AWV62010.1\|2046359_2047655_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_11

2524698 : 2646058

112

Enterococcus_phage(22.86%)

portal,head,tRNA,transposase,terminase,integrase,protease,tail,plate,holin

attL 2575779:2575794|attR 2614728:2614743

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV62444.1\|2524698_2525658_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
AWV62445.1\|2525808_2528511_-	alpha-mannosidase	NA	NA	NA	NA
AWV62446.1\|2528523_2529813_-	glycoside hydrolase family 125 protein	NA	NA	NA	NA
AWV62447.1\|2529962_2531009_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV62448.1\|2531010_2533164_+	alpha-mannosidase	NA	NA	NA	NA
AWV62449.1\|2533636_2535088_-	DNA-binding response regulator	NA	NA	NA	NA
AWV62450.1\|2535084_2536809_-	sensor histidine kinase	NA	NA	NA	NA
AWV62451.1\|2536801_2537416_-	DUF624 domain-containing protein	NA	NA	NA	NA
AWV62452.1\|2537452_2537650_-	hypothetical protein	NA	NA	NA	NA
AWV62453.1\|2537760_2539218_-	DUF3502 domain-containing protein	NA	NA	NA	NA
AWV62454.1\|2539258_2540179_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV62455.1\|2540190_2541138_-	sugar ABC transporter permease	NA	NA	NA	NA
AWV62456.1\|2541616_2542336_-	rRNA pseudouridine synthase	NA	NA	NA	NA
AWV62457.1\|2542384_2544031_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV62458.1\|2544209_2544800_+	membrane protein	NA	NA	NA	NA
AWV62459.1\|2544891_2546397_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
AWV62460.1\|2546480_2547833_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AWV62461.1\|2547832_2548351_-	hypothetical protein	NA	NA	NA	NA
AWV62462.1\|2548366_2548693_-	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
AWV62463.1\|2548705_2550685_-	PRD domain-containing protein	NA	NA	NA	NA
AWV62464.1\|2550705_2551020_-	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
AWV62465.1\|2551187_2551481_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AWV62466.1\|2551558_2552671_-	FUSC family protein	NA	NA	NA	NA
AWV62467.1\|2553057_2553237_+	hypothetical protein	NA	NA	NA	NA
AWV62468.1\|2553230_2553443_+	hypothetical protein	NA	NA	NA	NA
AWV62469.1\|2553430_2553601_+	hypothetical protein	NA	NA	NA	NA
AWV62841.1\|2554024_2554765_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWV62842.1\|2555190_2558232_-	hypothetical protein	NA	NA	NA	NA
AWV62470.1\|2559912_2561085_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV62471.1\|2561500_2562262_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWV62472.1\|2562361_2564083_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-37	28.0
AWV62473.1\|2564097_2565882_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-46	28.2
AWV62474.1\|2566262_2567816_-	glycosyl hydrolase	NA	NA	NA	NA
AWV62475.1\|2568163_2570578_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
AWV62476.1\|2571004_2573023_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
AWV62477.1\|2573392_2574049_+	phosphatase PAP2 family protein	NA	NA	NA	NA
AWV62478.1\|2574048_2575005_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
AWV62479.1\|2575004_2575571_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
2575779:2575794	attL	NA	NA	NA	NA
AWV62480.1\|2576006_2576237_+	hypothetical protein	NA	NA	NA	NA
AWV62481.1\|2576242_2576542_+	hypothetical protein	NA	NA	NA	NA
AWV62482.1\|2576577_2576949_-	hypothetical protein	NA	NA	NA	NA
AWV62483.1\|2576950_2577352_-	hypothetical protein	NA	NA	NA	NA
AWV62484.1\|2577365_2577773_-	hypothetical protein	NA	NA	NA	NA
AWV62485.1\|2578695_2579858_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
AWV62486.1\|2580797_2581823_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
AWV62487.1\|2581819_2582044_-\|holin	holin	NA	NA	NA	NA
AWV62488.1\|2582040_2582334_-	hypothetical protein	NA	NA	NA	NA
AWV62489.1\|2582371_2582509_-	XkdX family protein	NA	NA	NA	NA
AWV62490.1\|2582510_2582942_-	hypothetical protein	NA	NA	NA	NA
AWV62491.1\|2582955_2583450_-	hypothetical protein	NA	NA	NA	NA
AWV62492.1\|2583449_2583899_-	hypothetical protein	NA	NA	NA	NA
AWV62493.1\|2583902_2584523_-	hypothetical protein	NA	NA	NA	NA
AWV62494.1\|2584522_2585431_-\|plate	phage baseplate upper protein	A0A1P8BKW9	Lactococcus_phage	1.1e-08	24.3
AWV62495.1\|2585443_2588206_-	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	1.1e-139	39.5
AWV62496.1\|2588202_2588943_-\|tail	phage tail protein	NA	NA	NA	NA
AWV62843.1\|2588932_2591722_-\|tail	phage tail tape measure protein	D7RWD8	Brochothrix_phage	5.4e-70	38.9
AWV62497.1\|2591963_2592305_-	hypothetical protein	NA	NA	NA	NA
AWV62498.1\|2592304_2592913_-\|tail	phage tail protein	NA	NA	NA	NA
AWV62499.1\|2592913_2593291_-	hypothetical protein	NA	NA	NA	NA
AWV62500.1\|2593292_2593688_-	HK97 gp10 family phage protein	NA	NA	NA	NA
AWV62501.1\|2593680_2594052_-	hypothetical protein	NA	NA	NA	NA
AWV62502.1\|2594051_2594393_-	hypothetical protein	NA	NA	NA	NA
AWV62503.1\|2594404_2594620_-	hypothetical protein	NA	NA	NA	NA
AWV62504.1\|2594642_2595533_-	hypothetical protein	NA	NA	NA	NA
AWV62505.1\|2595547_2596249_-	DUF4355 domain-containing protein	NA	NA	NA	NA
AWV62506.1\|2596167_2596359_-	hypothetical protein	NA	NA	NA	NA
AWV62507.1\|2596297_2596615_-	hypothetical protein	NA	NA	NA	NA
AWV62844.1\|2596616_2597495_-\|head	phage head morphogenesis protein	NA	NA	NA	NA
AWV62508.1\|2597586_2599116_-\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.7e-28	25.0
AWV62509.1\|2599127_2600543_-\|terminase	terminase B	C9E2I7	Enterococcus_phage	1.4e-218	79.4
AWV62510.1\|2600535_2601369_-\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	4.7e-78	67.9
AWV62511.1\|2601527_2601758_-	hypothetical protein	NA	NA	NA	NA
AWV62512.1\|2602504_2602972_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
AWV62845.1\|2603046_2603487_-	transcriptional regulator	D2IYV6	Enterococcus_phage	5.3e-20	38.4
AWV62513.1\|2603516_2603810_-	hypothetical protein	NA	NA	NA	NA
AWV62514.1\|2603840_2604035_-	hypothetical protein	NA	NA	NA	NA
AWV62515.1\|2604140_2604593_-	hypothetical protein	NA	NA	NA	NA
AWV62516.1\|2604618_2605080_-	class I SAM-dependent methyltransferase	A0A2H4PBJ4	Lactobacillus_phage	1.1e-60	67.1
AWV62517.1\|2605080_2605284_-	hypothetical protein	NA	NA	NA	NA
AWV62518.1\|2605280_2606132_-	AAA family ATPase	A0A0P0I3L9	Lactobacillus_phage	2.3e-27	30.2
AWV62519.1\|2606146_2606947_-	replication protein	B4XYS6	Lactobacillus_phage	3.0e-58	54.9
AWV62520.1\|2606989_2607880_-	recombinase RecT	D2IYT9	Enterococcus_phage	1.4e-136	84.5
AWV62521.1\|2607881_2608823_-	endonuclease	D2IZK1	Enterococcus_phage	1.0e-145	79.2
AWV62522.1\|2609055_2609391_-	hypothetical protein	NA	NA	NA	NA
AWV62523.1\|2609716_2609905_-	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
AWV62524.1\|2609967_2610207_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.8e-27	81.1
AWV62525.1\|2610203_2610359_-	hypothetical protein	NA	NA	NA	NA
AWV62526.1\|2610498_2610711_-	hypothetical protein	NA	NA	NA	NA
AWV62527.1\|2610713_2610926_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWV62528.1\|2611200_2611611_+	XRE family transcriptional regulator	Q5YAA4	Bacillus_phage	2.8e-31	51.4
AWV62529.1\|2611623_2612076_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWV62846.1\|2612514_2613447_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.8e-57	53.8
AWV62530.1\|2613518_2614640_+\|integrase	site-specific integrase	C9E2L6	Enterococcus_phage	4.0e-64	38.5
AWV62531.1\|2614721_2616494_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-54	29.5
2614728:2614743	attR	NA	NA	NA	NA
AWV62532.1\|2616496_2618209_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
AWV62533.1\|2618323_2618992_+	TetR family transcriptional regulator	NA	NA	NA	NA
AWV62534.1\|2619058_2619847_-	esterase family protein	NA	NA	NA	NA
AWV62535.1\|2619929_2621402_-	MFS transporter	NA	NA	NA	NA
AWV62536.1\|2621531_2622725_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
AWV62537.1\|2628421_2628619_+	hypothetical protein	NA	NA	NA	NA
AWV62538.1\|2631034_2632531_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.7e-91	40.9
AWV62539.1\|2632641_2633646_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AWV62540.1\|2633646_2634534_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
AWV62541.1\|2634750_2636862_-\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
AWV62542.1\|2636951_2637497_-	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
AWV62847.1\|2637496_2638942_-\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
AWV62543.1\|2639061_2639532_-	RNA-binding protein S1	NA	NA	NA	NA
AWV62544.1\|2639577_2640003_-	septum formation initiator family protein	NA	NA	NA	NA
AWV62545.1\|2640069_2640339_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
AWV62546.1\|2640349_2641945_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AWV62547.1\|2641959_2645481_-	transcription-repair coupling factor	NA	NA	NA	NA
AWV62548.1\|2645497_2646058_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

DBSCAN-SWA_12

2753151 : 2770047

Streptococcus_phage(92.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV62650.1\|2753151_2753466_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
AWV62651.1\|2753478_2753853_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
AWV62652.1\|2753853_2754198_+	damage-inducible protein J	NA	NA	NA	NA
AWV62653.1\|2754280_2755621_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	1.5e-163	65.2
AWV62654.1\|2755698_2756373_+	zeta toxin family protein	NA	NA	NA	NA
AWV62655.1\|2756605_2757040_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
AWV62656.1\|2757040_2757748_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
AWV62657.1\|2757737_2758028_+	hypothetical protein	NA	NA	NA	NA
AWV62658.1\|2758286_2759471_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
AWV62659.1\|2759467_2759605_+	DUF3789 domain-containing protein	NA	NA	NA	NA
AWV62660.1\|2760350_2762261_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
AWV62661.1\|2762364_2762589_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
AWV62662.1\|2762601_2763105_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
AWV62663.1\|2763164_2763554_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
AWV62664.1\|2763540_2765988_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
AWV62665.1\|2765992_2768116_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
AWV62666.1\|2768112_2769117_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
AWV62667.1\|2769135_2770047_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP020489

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2691 : 55756

Bacillus_phage(28.57%)

transposase,integrase

attL 13431:13448|attR 56559:56576

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV62854.1\|2691_3861_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AWV62855.1\|4333_4888_+\|integrase	integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
AWV62856.1\|5060_5534_-\|integrase	integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
AWV62857.1\|5545_6082_+	glyoxalase	NA	NA	NA	NA
AWV62858.1\|6121_6493_+	glyoxalase	NA	NA	NA	NA
AWV62859.1\|6776_8048_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
AWV62860.1\|8292_9318_+	LacI family transcriptional regulator	NA	NA	NA	NA
AWV62861.1\|9611_10721_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV62862.1\|11715_12540_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV62863.1\|12571_13882_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
13431:13448	attL	NA	NA	NA	NA
AWV62864.1\|14029_15289_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV62865.1\|15298_16171_+	sugar ABC transporter permease	NA	NA	NA	NA
AWV62866.1\|16182_17013_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AWV62867.1\|17052_19236_+	alpha-galactosidase	NA	NA	NA	NA
AWV62868.1\|19296_20517_+	oligo-1,6-glucosidase	NA	NA	NA	NA
AWV62869.1\|20513_21974_+	sucrose phosphorylase	NA	NA	NA	NA
AWV62870.1\|23478_23688_+	DUF3173 domain-containing protein	NA	NA	NA	NA
AWV62871.1\|23680_23830_+\|integrase	integrase	NA	NA	NA	NA
AWV62872.1\|24932_26018_-	tyrosine recombinase XerS	NA	NA	NA	NA
AWV62873.1\|26351_26585_+	addiction module antitoxin	NA	NA	NA	NA
AWV62874.1\|26581_26989_+	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	4.0e-14	38.9
AWV63056.1\|27579_27783_-	hypothetical protein	NA	NA	NA	NA
AWV62875.1\|28125_28644_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
AWV62876.1\|29010_29259_+	hypothetical protein	NA	NA	NA	NA
AWV62877.1\|29304_29496_+	fructokinase	NA	NA	NA	NA
AWV62878.1\|29761_30923_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
AWV62879.1\|31421_31898_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AWV62880.1\|31910_33413_-	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
AWV62881.1\|33426_34116_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
AWV62882.1\|34276_35095_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWV62883.1\|35324_35555_+	resolvase	NA	NA	NA	NA
AWV63057.1\|35886_36120_-	hypothetical protein	NA	NA	NA	NA
AWV62884.1\|36140_36596_-\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
AWV62885.1\|36838_38264_+\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
AWV62886.1\|38440_39736_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
AWV62887.1\|39756_39954_+	hypothetical protein	NA	NA	NA	NA
AWV62888.1\|39956_40919_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
AWV62889.1\|40920_42360_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
AWV62890.1\|42544_44491_+	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
AWV62891.1\|44754_45627_+	ROK family protein	NA	NA	NA	NA
AWV62892.1\|47484_47955_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-09	33.6
AWV62893.1\|47999_48167_-	transcriptional regulator	NA	NA	NA	NA
AWV62894.1\|48200_48500_-	hypothetical protein	NA	NA	NA	NA
AWV62895.1\|48540_49158_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
AWV62896.1\|49482_49878_-	hypothetical protein	NA	NA	NA	NA
AWV62897.1\|49957_52309_-	DUF1906 domain-containing protein	NA	NA	NA	NA
AWV62898.1\|52433_53123_-	hypothetical protein	NA	NA	NA	NA
AWV62899.1\|53136_53589_-	hypothetical protein	NA	NA	NA	NA
AWV62900.1\|53823_54965_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
AWV62901.1\|55075_55756_+\|transposase	IS6 family transposase IS1216E	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
56559:56576	attR	NA	NA	NA	NA

DBSCAN-SWA_2

69251 : 110507

Streptococcus_phage(45.45%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV62917.1\|69251_70874_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-121	47.3
AWV62918.1\|71159_72536_-	ABC transporter permease	NA	NA	NA	NA
AWV62919.1\|72535_73192_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
AWV62920.1\|73201_74479_-	ABC transporter permease	NA	NA	NA	NA
AWV62921.1\|74728_75890_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
AWV62922.1\|75920_76370_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
AWV62923.1\|76525_76876_-	hypothetical protein	NA	NA	NA	NA
AWV62924.1\|78055_78742_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.7e-127	99.1
AWV62925.1\|78989_79847_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
AWV62926.1\|80408_80738_-	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV62927.1\|80814_81087_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
AWV62928.1\|81086_81350_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AWV62929.1\|82494_83670_-	MFS transporter	NA	NA	NA	NA
AWV62930.1\|83672_85922_-	alpha-galactosidase	NA	NA	NA	NA
AWV62931.1\|86971_88120_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
AWV62932.1\|88136_88541_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV62933.1\|89847_90783_-	hypothetical protein	NA	NA	NA	NA
AWV62934.1\|91341_91659_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AWV62935.1\|91659_91914_-	AbrB family transcriptional regulator	NA	NA	NA	NA
AWV62936.1\|92272_92677_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
AWV62937.1\|92693_93842_+\|transposase	transposase	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
AWV62938.1\|94548_94743_-	hypothetical protein	NA	NA	NA	NA
AWV62939.1\|96094_97135_+	replication protein RepA	NA	NA	NA	NA
AWV62940.1\|97958_98291_+	conjugal transfer protein TraE	NA	NA	NA	NA
AWV62941.1\|98909_99251_+	hypothetical protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
AWV62942.1\|99487_100738_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
AWV62943.1\|101147_101387_+	hypothetical protein	NA	NA	NA	NA
AWV62944.1\|101453_101663_+	hypothetical protein	NA	NA	NA	NA
AWV62945.1\|101722_102394_+	class A sortase	NA	NA	NA	NA
AWV62946.1\|102446_104423_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV62947.1\|104435_105191_+	class C sortase	NA	NA	NA	NA
AWV62948.1\|105187_106012_+	hypothetical protein	NA	NA	NA	NA
AWV62949.1\|106021_106270_+	hypothetical protein	NA	NA	NA	NA
AWV62950.1\|106300_108412_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
AWV62951.1\|108449_110507_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

146867 : 181964

Streptococcus_phage(36.36%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV62992.1\|146867_147554_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	98.7
AWV62993.1\|147601_148312_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWV62994.1\|148295_149030_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWV62995.1\|149246_150260_+	SIS domain-containing protein	NA	NA	NA	NA
AWV62996.1\|150270_150681_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV62997.1\|150680_151148_+	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV62998.1\|151165_151912_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV62999.1\|151911_152721_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV63000.1\|154683_155085_-	hypothetical protein	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2
AWV63001.1\|155311_156490_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.7e-23	27.1
AWV63002.1\|156537_157275_-	conjugal transfer protein TraG	NA	NA	NA	NA
AWV63003.1\|157432_158362_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.1e-06	23.3
AWV63004.1\|158434_159046_-	VanZ family protein	NA	NA	NA	NA
AWV63005.1\|159261_160170_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
AWV63006.1\|161628_162471_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AWV63007.1\|162795_163212_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWV63008.1\|163208_163679_+	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
AWV63009.1\|163692_164466_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWV63010.1\|164479_165292_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
AWV63011.1\|165345_166311_+	SIS domain-containing protein	NA	NA	NA	NA
AWV63012.1\|166446_169170_+	PRD domain-containing protein	NA	NA	NA	NA
AWV63013.1\|169182_169815_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
AWV63014.1\|170019_170247_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
AWV63015.1\|170243_170582_+	antitoxin	NA	NA	NA	NA
AWV63016.1\|170571_170841_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
AWV63017.1\|171019_172321_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
AWV63018.1\|172549_174097_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
AWV63019.1\|174198_174552_-	IS66 family insertion sequence hypothetical protein	S5VXZ8	Leptospira_phage	5.7e-17	38.7
AWV63020.1\|174541_174736_-	hypothetical protein	NA	NA	NA	NA
AWV63021.1\|174814_176107_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
AWV63022.1\|176869_177838_+	SIS domain-containing protein	NA	NA	NA	NA
AWV63023.1\|177848_178664_+	fructoselysine 6-kinase	NA	NA	NA	NA
AWV63024.1\|178731_179442_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWV63025.1\|179477_180719_+	hydrolase	NA	NA	NA	NA
AWV63026.1\|180776_181964_-\|transposase	IS256 family transposase IS16	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP020490

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2672

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV63062.1\|50_401_+	hypothetical protein	NA	NA	NA	NA
AWV63063.1\|811_1006_-	hypothetical protein	NA	NA	NA	NA
AWV63064.1\|1471_1747_-	type III secretion system protein PrgO	NA	NA	NA	NA
AWV63065.1\|1718_2672_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

DBSCAN-SWA_2

6819 : 14865

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV63069.1\|6819_7506_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV63070.1\|8126_9299_-\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV63071.1\|9450_10146_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
AWV63072.1\|10123_11278_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
AWV63073.1\|11492_12461_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
AWV63074.1\|12453_13485_+	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
AWV63075.1\|13490_14099_+	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
AWV63076.1\|14178_14865_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

DBSCAN-SWA_3

20235 : 47988

Streptococcus_phage(70.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV63082.1\|20235_20853_+	recombinase family protein	A0A219YA40	Aeromonas_phage	2.9e-16	36.6
AWV63083.1\|22483_23131_-	type A-7 chloramphenicol O-acetyltransferase	A0A1X9I6V6	Streptococcus_phage	9.0e-69	54.4
AWV63084.1\|23260_24199_-	replication initiation protein	NA	NA	NA	NA
AWV63085.1\|26040_26280_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	6.8e-22	81.5
AWV63113.1\|26328_26397_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
AWV63086.1\|26434_27607_-\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
AWV63087.1\|27868_28606_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	3.1e-134	99.2
AWV63088.1\|28610_28742_+	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
AWV63089.1\|29106_30445_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
AWV63090.1\|30557_31454_+	chromosome partitioning protein ParA	A0A1X9I765	Streptococcus_phage	1.1e-152	97.9
AWV63091.1\|31545_31761_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
AWV63092.1\|31778_32051_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
AWV63093.1\|32052_32916_+	toxin zeta	NA	NA	NA	NA
AWV63094.1\|33687_34374_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-126	99.1
AWV63095.1\|34762_34987_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWV63096.1\|35001_35871_+	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
AWV63097.1\|35851_36586_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
AWV63098.1\|36618_37527_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
AWV63099.1\|38092_38779_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV63100.1\|38981_39194_+	hypothetical protein	NA	NA	NA	NA
AWV63101.1\|39355_39874_+	hypothetical protein	NA	NA	NA	NA
AWV63102.1\|39880_40393_+	hypothetical protein	NA	NA	NA	NA
AWV63103.1\|40496_41792_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
AWV63104.1\|42185_42809_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
AWV63105.1\|42898_43585_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
AWV63106.1\|43782_44388_+	cell filamentation protein	NA	NA	NA	NA
AWV63107.1\|44403_44976_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
AWV63108.1\|45227_45485_-	hypothetical protein	NA	NA	NA	NA
AWV63109.1\|45610_46426_-	hypothetical protein	NA	NA	NA	NA
AWV63110.1\|46815_47988_+\|transposase	IS256 family transposase IS1542	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP020488

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP020489

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP020490

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection