CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP029098	Klebsiella pneumoniae strain AR438 plasmid unnamed1	0 crisprs	NA	0	0
CP029099	Klebsiella pneumoniae strain AR438 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,RT,DinG,WYL	1	12
CP029101	Klebsiella pneumoniae strain AR438 plasmid unnamed3, complete sequence	0 crisprs	RT,c2c9_V-U4,csa3,cas3	0	3
CP029100	Klebsiella pneumoniae strain AR438 plasmid unnamed2	0 crisprs	NA	0	1
CP029102	Klebsiella pneumoniae strain AR438 plasmid unnamed4, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029099_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029099_2

4591289-4591383

Orphan

Consensus_repeat	Method
ACTATGGTTTTTATGGTTTTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP029099_2

>merge|CP029099|2|4591289-4591383|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATGGTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATGACTGTGGTTTTTATGGTTTTTATT

>CP029099|2|2|4591289-4591383|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATG	GTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATG
ACTGTGGTTTTTATGGTTTTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP029099.1\|AWF08357.1\|4597344_4598631_+\|chaperone-SurA	unknown	unknown	gnl\|CDD\|236758
CP029099.1\|AWF06688.1\|4582047_4582743_+\|L-ribulose-5-phosphate-4-epimerase	unknown	unknown	gnl\|CDD\|236181
CP029099.1\|AWF04723.1\|4580407_4581910_+\|L-arabinose-isomerase	unknown	unknown	gnl\|CDD\|179503
CP029099.1\|AWF03407.1\|4601932_4602412_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|182714
CP029099.1\|AWF04273.1\|4578335_4578506_+\|hypothetical-protein	unknown	unknown	unknown
CP029099.1\|AWF06988.1\|4593870_4594698_-\|dnaJ-like-protein-DjlA	unknown	unknown	gnl\|CDD\|236512
CP029099.1\|AWF07063.1\|4582918_4585276_+\|DNA-polymerase-family-B,-exonuclease-domain-protein	unknown	unknown	gnl\|CDD\|235595
CP029099.1\|AWF08592.1\|4594974_4597290_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|235158
CP029099.1\|AWF08067.1\|4600446_4600824_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180098
CP029099.1\|AWF08682.1\|4591524_4593150_+\|sensor-histidine-kinase-CitA	unknown	unknown	gnl\|CDD\|225827
CP029099.1\|AWF08359.1\|4585547_4588370_+\|RNA-polymerase-associated-protein-RapA	unknown	unknown	gnl\|CDD\|235319
CP029099.1\|AWF05329.1\|4589835_4591200_-\|citrate/malate-transporter	unknown	unknown	gnl\|CDD\|377030
CP029099.1\|AWF03364.1\|4600828_4601677_+\|bis(5'-nucleosyl)-tetraphosphatase	unknown	unknown	gnl\|CDD\|273208
CP029099.1\|AWF06791.1\|4589116_4589656_-\|holo-ACP-synthase-CitX	unknown	unknown	gnl\|CDD\|163145
CP029099.1\|AWF07514.1\|4593139_4593838_+\|transcriptional-regulator-family-protein	unknown	unknown	gnl\|CDD\|226931
CP029099.1\|AWF07490.1\|4588382_4589042_+\|pseudouridine-synthase,-RluA-family-protein	unknown	unknown	gnl\|CDD\|236659
CP029099.1\|AWF03715.1\|4577504_4578350_-\|arabinose-operon-regulatory-protein	unknown	unknown	gnl\|CDD\|236717
CP029099.1\|AWF04618.1\|4599622_4600444_+\|dimethyladenosine-transferase	unknown	unknown	gnl\|CDD\|234708
CP029099.1\|AWF07713.1\|4598636_4599626_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|234696
CP029099.1\|AWF05782.1\|4578687_4580397_+\|L-ribulokinase	unknown	unknown	gnl\|CDD\|235221

Protein	Function_ID	Function_description	E-value
CP029099.1\|AWF08357.1\|4597344_4598631_+\|chaperone-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	0
CP029099.1\|AWF06688.1\|4582047_4582743_+\|L-ribulose-5-phosphate-4-epimerase	gnl\|CDD\|236181	PRK08193, araD, L-ribulose-5-phosphate 4-epimerase AraD.	0
CP029099.1\|AWF04723.1\|4580407_4581910_+\|L-arabinose-isomerase	gnl\|CDD\|179503	PRK02929, PRK02929, L-arabinose isomerase; Provisional.	0
CP029099.1\|AWF03407.1\|4601932_4602412_-\|dihydrofolate-reductase	gnl\|CDD\|182714	PRK10769, folA, type 3 dihydrofolate reductase.	1.71656e-127
CP029099.1\|AWF06988.1\|4593870_4594698_-\|dnaJ-like-protein-DjlA	gnl\|CDD\|236512	PRK09430, djlA, co-chaperone DjlA.	2.63694e-164
CP029099.1\|AWF07063.1\|4582918_4585276_+\|DNA-polymerase-family-B,-exonuclease-domain-protein	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
CP029099.1\|AWF08592.1\|4594974_4597290_+\|LPS-assembly-protein-LptD	gnl\|CDD\|235158	PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional.	0
CP029099.1\|AWF08067.1\|4600446_4600824_+\|hypothetical-protein	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	7.84855e-74
CP029099.1\|AWF08682.1\|4591524_4593150_+\|sensor-histidine-kinase-CitA	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	6.55037e-173
CP029099.1\|AWF08359.1\|4585547_4588370_+\|RNA-polymerase-associated-protein-RapA	gnl\|CDD\|235319	PRK04914, PRK04914, RNA polymerase-associated protein RapA.	0
CP029099.1\|AWF05329.1\|4589835_4591200_-\|citrate/malate-transporter	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	4.87969e-169
CP029099.1\|AWF03364.1\|4600828_4601677_+\|bis(5'-nucleosyl)-tetraphosphatase	gnl\|CDD\|273208	TIGR00668, Bis5'-nucleosyl-tetraphosphatase_symmetrical, bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions. It is hydrolyzed to two ADP by this enzyme. Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase. [Cellular processes, Adaptations to atypical conditions].	0
CP029099.1\|AWF06791.1\|4589116_4589656_-\|holo-ACP-synthase-CitX	gnl\|CDD\|163145	TIGR03124, citrate_citX, holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair].	5.54697e-86
CP029099.1\|AWF07514.1\|4593139_4593838_+\|transcriptional-regulator-family-protein	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	5.03078e-66
CP029099.1\|AWF07490.1\|4588382_4589042_+\|pseudouridine-synthase,-RluA-family-protein	gnl\|CDD\|236659	PRK10158, PRK10158, bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA.	2.4454e-161
CP029099.1\|AWF03715.1\|4577504_4578350_-\|arabinose-operon-regulatory-protein	gnl\|CDD\|236717	PRK10572, PRK10572, arabinose operon transcriptional regulator AraC.	0
CP029099.1\|AWF04618.1\|4599622_4600444_+\|dimethyladenosine-transferase	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	3.65731e-147
CP029099.1\|AWF07713.1\|4598636_4599626_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|234696	PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed.	0
CP029099.1\|AWF05782.1\|4578687_4580397_+\|L-ribulokinase	gnl\|CDD\|235221	PRK04123, PRK04123, ribulokinase; Provisional.	0

>CP029099.1|AWF05329.1|4589835_4591200_-|citrate/malate-transporter
MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA
>CP029099.1|AWF06791.1|4589116_4589656_-|holo-ACP-synthase-CitX
MSVDTPAQAGVSIDALLAAKEQRAARQADWLAHYQQPVISLTLVTPGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKAMCSTLEQSHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDLVVARVEQMIDAWFARD
>CP029099.1|AWF07490.1|4588382_4589042_+|pseudouridine-synthase,-RluA-family-protein
MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDSVMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHPQPAEGLVDLPLICDWPNRPKQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQLRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNAMTFRAPIDF
>CP029099.1|AWF08359.1|4585547_4588370_+|RNA-polymerase-associated-protein-RapA
MVTLLFPAIGENRLYSRNDSPITRVMFNPGDTITSHEGWQLHVDKVNEENGLLSYTGTRLDTQEANVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLHIAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIVVPETLQHQWLVEMLRRFNLRFSLFDDERYAEAQHDAYNPFETEQLVICSLDFVRRSKQRLEHLCDAEWDLMVVDEAHHLVWSEEAPSREYQAIEQLAERVPGILLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQQNYRPVADAVALLLAGNKLSDSELNTLGDLIGEQDIEPLLQAANSDREDAQAARQELISMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIRLPLPTQYQTAIKVSGIMGARKTAEERARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATALQLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRTVYDSVHDELINYLAAPESIDGFDDLIKSCRQQHDALKAQLEQGRDRLLEIHSNGGEKAQALAESIEEQDDDTSLIAFSMNLFDIVGINQDDRGENLIVLTPSDHMLVPDFPGLPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLLELIYVVEAQAPKQLQLNRFLPATPVRMLLDKNGNNLAAQVEFESFNRQLSAVNRHTGSKLVNAVQQDVHAILQQGEAQIAKAAQGLIDAARNEADEKLTAELSRLEALKAVNPNIRDDELAGIESNRQQVMDALAQAGWRLDALRLIVVTHQ
>CP029099.1|AWF07063.1|4582918_4585276_+|DNA-polymerase-family-B,-exonuclease-domain-protein
MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVAFIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVTVYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSRHGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFIASRPLLLEKLNAWFAEHDPDVLIGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGIDALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCELVTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLIEGLAQPDDQHSIEGFLGARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRLASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAEIGRELVSHVNAWWAQELSKSQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPLAEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDHYLTKQLQPVAEGILPFVNDDFATIVTGQLGLF
>CP029099.1|AWF06688.1|4582047_4582743_+|L-ribulose-5-phosphate-4-epimerase
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSGVDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQAFPTLGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRKHGAKAYYGQ
>CP029099.1|AWF04723.1|4580407_4581910_+|L-arabinose-isomerase
MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHVVNSLNAEAKLPCKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFHTQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDISALVDEYESSYRLTPAAQVHGEKRQNVLDAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFDNGNDLVLGSHMLEVCPTIATVEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDLGDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALNLDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR
>CP029099.1|AWF05782.1|4578687_4580397_+|L-ribulokinase
MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDGANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLALREEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHVTREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASFFDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQSVAISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGDIYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYDDIPAAQQRMASQVETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSKAALTH
>CP029099.1|AWF04273.1|4578335_4578506_+|hypothetical-protein
MRFGHTRGSPRRYQWHQLSIFIILSLSALSRLRRRWEFGEKPAQQAKKAPAACIPP
>CP029099.1|AWF03715.1|4577504_4578350_-|arabinose-operon-regulatory-protein
MAETQNDPLLPGYSFNAHLVTGLTPIEAQGYLDFFIDRPLGMKGYILNLTIRGEGVINNHGEQFVCRPGDMLLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYWHEWLNWPTIFAQTGFFRPDEQWQARFGELFGQIVDAGQGAGRYSELLAINLLEQLLLRRMEAINESLHPPLDNRVREACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGVSVLGWREDQRISQAKLLLSTTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE
>CP029099.1|AWF08682.1|4591524_4593150_+|sensor-histidine-kinase-CitA
MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWVGTRLVGGDNQAVLEGKSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASGDMLERDTHDELCRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEAHDAS
>CP029099.1|AWF07514.1|4593139_4593838_+|transcriptional-regulator-family-protein
MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLALVQGLFSDREAHCFSVDEVVSAAGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPRRLYRRAKVKS
>CP029099.1|AWF06988.1|4593870_4594698_-|dnaJ-like-protein-DjlA
MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFANQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDGKADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGISRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDDAATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF
>CP029099.1|AWF08592.1|4594974_4597290_+|LPS-assembly-protein-LptD
MIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQSSL
>CP029099.1|AWF08357.1|4597344_4598631_+|chaperone-SurA
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQIGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNISVTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN
>CP029099.1|AWF07713.1|4598636_4599626_+|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPETRKVVITPGEPAGIGPDLVVQLAQRDWPVELVICADGALLTDRAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARACDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALVTTHLPLKAISEAITPELLREIITILDHDLRTKFGIAQPHVLVCGLNPHAGEGGHMGTEEIDTIIPVLEEMRAKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ
>CP029099.1|AWF04618.1|4599622_4600444_+|dimethyladenosine-transferase
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES
>CP029099.1|AWF08067.1|4600446_4600824_+|hypothetical-protein
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRETEVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAVPTLIH
>CP029099.1|AWF03364.1|4600828_4601677_+|bis(5'-nucleosyl)-tetraphosphatase
MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVAS
>CP029099.1|AWF03407.1|4601932_4602412_-|dihydrofolate-reductase
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP029099_1	1.1\|4107348\|36\|CP029099\|CRISPRCasFinder	4107348-4107383	36	MK448233	Klebsiella phage ST11-VIM1phi8.1, complete genome	8447-8482	1.0
CP029099_1	1.1\|4107348\|36\|CP029099\|CRISPRCasFinder	4107348-4107383	36	MK448235	Klebsiella phage ST512-KPC3phi13.1, complete genome	8447-8482	1.0
CP029099_1	1.1\|4107348\|36\|CP029099\|CRISPRCasFinder	4107348-4107383	36	MK448231	Klebsiella phage ST101-KPC2phi6.1, complete genome	11383-11418	1.0

1. spacer 1.1|4107348|36|CP029099|CRISPRCasFinder matches to MK448233 (Klebsiella phage ST11-VIM1phi8.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

2. spacer 1.1|4107348|36|CP029099|CRISPRCasFinder matches to MK448235 (Klebsiella phage ST512-KPC3phi13.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

3. spacer 1.1|4107348|36|CP029099|CRISPRCasFinder matches to MK448231 (Klebsiella phage ST101-KPC2phi6.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

447243 : 481807

uncultured_Caudovirales_phage(61.11%)

capsid,tRNA,transposase,integrase,head,protease,terminase,tail,portal

attL 464851:464868|attR 482152:482169

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF07898.1\|447243_448191_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.2e-07	37.2
AWF06061.1\|448205_448700_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.5e-18	40.3
AWF07105.1\|448843_449968_+	DNA protecting protein DprA	NA	NA	NA	NA
AWF03961.1\|449939_450413_+	hypothetical protein	NA	NA	NA	NA
AWF07942.1\|450438_450981_+	zinc-ribbon domain protein	NA	NA	NA	NA
AWF06649.1\|450985_451558_+\|tRNA	tRNA threonylcarbamoyladenosine biosynthesis protein RimN	NA	NA	NA	NA
AWF05921.1\|451561_452380_+	shikimate dehydrogenase	NA	NA	NA	NA
AWF08642.1\|452376_452634_+	hypothetical protein	NA	NA	NA	NA
AWF06339.1\|452609_453164_-	bacterial transferase hexapeptide family protein	NA	NA	NA	NA
AWF04917.1\|458959_459181_-	prokaryotic membrane lipolipid attachment site family protein	NA	NA	NA	NA
AWF05971.1\|459474_462585_-	RND transporter, hydrophobe/amphiphile efflux-1 family protein	NA	NA	NA	NA
AWF07081.1\|462597_463737_-	efflux transporter, RND family, MFP subunit	NA	NA	NA	NA
AWF03813.1\|464115_464766_+	putative acrEF/envCD operon repressor	NA	NA	NA	NA
464851:464868	attL	NA	NA	NA	NA
AWF08683.1\|465041_466268_+\|integrase	phage integrase family protein	A0A2H4JB45	uncultured_Caudovirales_phage	1.8e-150	62.2
AWF04727.1\|466444_467302_+	hypothetical protein	NA	NA	NA	NA
AWF06740.1\|467483_467768_+	prophage CP4-57 regulatory family protein	NA	NA	NA	NA
AWF04402.1\|467796_468558_+	phage antirepressor KilAC domain protein	Q8HA02	Enterobacteria_phage	6.1e-40	51.5
AWF04385.1\|469099_469279_+	hypothetical protein	A0A2H4JGW3	uncultured_Caudovirales_phage	2.6e-26	94.9
AWF06537.1\|469271_469460_+	hypothetical protein	NA	NA	NA	NA
AWF03275.1\|469452_469767_+	hypothetical protein	NA	NA	NA	NA
AWF07366.1\|469775_470132_+	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	2.3e-50	81.4
AWF04601.1\|470128_470494_+	hypothetical protein	NA	NA	NA	NA
AWF07729.1\|470499_472629_+	hypothetical protein	A0A1W6JPG0	Morganella_phage	3.4e-205	62.4
AWF05485.1\|472971_473307_+	hypothetical protein	NA	NA	NA	NA
AWF05469.1\|473355_473868_-	hypothetical protein	NA	NA	NA	NA
AWF04464.1\|474131_475298_+\|capsid	phage major capsid protein, HK97 family	A0A2H4JED2	uncultured_Caudovirales_phage	9.8e-207	95.9
AWF05114.1\|475349_475910_+\|head,protease	phage prohead protease, HK97 family	A0A2H4JB68	uncultured_Caudovirales_phage	1.2e-98	95.7
AWF07648.1\|475911_477153_+\|portal	phage portal protein, HK97 family	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.0e-230	96.5
AWF05430.1\|477329_477485_+\|head,tail	phage head-tail joining family protein	A0A1P8DTK6	Proteus_phage	7.2e-09	54.0
AWF08559.1\|477556_477781_+\|head,tail	phage gp6-like head-tail connector family protein	A0A2H4JD08	uncultured_Caudovirales_phage	3.0e-32	87.8
AWF04047.1\|477831_478224_+	HNH endonuclease family protein	A0A2H4JAS8	uncultured_Caudovirales_phage	1.4e-64	90.0
AWF07605.1\|478210_478369_+	hypothetical protein	A0A2H4JCY9	uncultured_Caudovirales_phage	2.5e-17	88.0
AWF03590.1\|478659_478902_+\|transposase	transposase family protein	Q6H9S4	Enterobacteria_phage	2.0e-05	37.0
AWF04862.1\|478898_479777_+	HTH-like domain protein	U5P429	Shigella_phage	2.6e-50	43.5
AWF05735.1\|479949_480162_+\|terminase	phage terminase, small subunit	A0A2H4JHS3	uncultured_Caudovirales_phage	3.5e-30	98.6
AWF04744.1\|480145_481807_+	phage Terminase family protein	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	98.0
482152:482169	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1239478 : 1285713

Salmonella_phage(86.84%)

plate,capsid,lysis,tRNA,integrase,terminase,head,tail,portal

attL 1237772:1237818|attR 1274339:1274385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1237772:1237818	attL	NA	NA	NA	NA
AWF03427.1\|1239478_1240504_-\|integrase	phage integrase family protein	A0A1S6L016	Salmonella_phage	1.5e-190	93.8
AWF03554.1\|1240506_1240824_-	putative phage regulatory protein cI	A0A1S6KZZ7	Salmonella_phage	1.5e-24	49.5
AWF04775.1\|1241384_1241501_+	putative phage regulatory protein	A0A1S6KZZ6	Salmonella_phage	1.6e-13	100.0
AWF04304.1\|1241533_1242043_+	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	1.1e-77	85.8
AWF05783.1\|1242214_1242553_+	putative prophage protein	A0A218M4I7	Erwinia_phage	6.2e-29	58.0
AWF06617.1\|1242620_1242854_+	hypothetical protein	A0A1S6L021	Salmonella_phage	6.0e-31	90.9
AWF07429.1\|1242853_1243081_+	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	A0A1S6L007	Salmonella_phage	5.1e-35	92.0
AWF03705.1\|1243077_1243929_+	DNA adenine methylase family protein	A0A1S6L011	Salmonella_phage	2.2e-115	75.4
AWF06957.1\|1243925_1246310_+	bacteriophage replication protein A	A0A1S6L028	Salmonella_phage	0.0e+00	87.9
AWF03814.1\|1246672_1246906_+	dinI-like family protein	A0A0M4S6H1	Salmonella_phage	2.0e-34	96.1
AWF05861.1\|1247001_1247685_-	hypothetical protein	NA	NA	NA	NA
AWF07414.1\|1247671_1248751_-	hypothetical protein	NA	NA	NA	NA
AWF06880.1\|1248750_1249752_-	hypothetical protein	NA	NA	NA	NA
AWF04883.1\|1250599_1251643_-\|portal	phage portal protein, PBSX family	A0A1S6KZW5	Salmonella_phage	3.1e-172	85.6
AWF07824.1\|1251642_1253397_-	sigma-70, region 4 family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	91.8
AWF07595.1\|1253546_1254380_+\|capsid	phage capsid scaffolding (GPO) serine peptidase family protein	A0A1S6KZW9	Salmonella_phage	4.4e-100	77.6
AWF04294.1\|1254396_1255449_+\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	6.8e-175	91.0
AWF07332.1\|1255452_1256106_+\|terminase	phage small terminase subunit	A0A1S6KZX1	Salmonella_phage	1.9e-90	80.0
AWF06095.1\|1256201_1256666_+\|head	phage head completion family protein	A0A1S6KZW8	Salmonella_phage	1.5e-73	85.7
AWF06541.1\|1256665_1256869_+	phage Tail Protein X family protein	E5G6M9	Salmonella_phage	9.8e-30	89.6
AWF03459.1\|1256872_1257088_+	putative membrane protein	E5G6N0	Salmonella_phage	6.1e-30	88.7
AWF05203.1\|1257068_1257578_+	phage lysozyme family protein	E5G6N1	Salmonella_phage	1.6e-81	85.2
AWF07617.1\|1257582_1257966_+	putative membrane protein	A0A1S6KZZ2	Salmonella_phage	1.9e-18	45.4
AWF04766.1\|1257962_1258391_+\|lysis	phage lysis regulatory, LysB family protein	A0A1S6KZX8	Salmonella_phage	7.1e-54	82.5
AWF04043.1\|1258486_1258909_+\|tail	P2 phage tail completion R family protein	A0A1S6KZY0	Salmonella_phage	8.2e-63	83.2
AWF06525.1\|1258901_1259348_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.5e-54	72.3
AWF07434.1\|1259370_1260237_-	hypothetical protein	NA	NA	NA	NA
AWF08104.1\|1260331_1260904_+\|plate	phage baseplate assembly V family protein	E5G6N6	Salmonella_phage	1.4e-76	70.8
AWF06088.1\|1260900_1261263_+	lysozyme family protein	A0A1S6KZZ4	Salmonella_phage	8.4e-48	85.6
AWF06368.1\|1261249_1262158_+\|plate	baseplate J-like family protein	E5G6N8	Salmonella_phage	1.9e-109	68.9
AWF07262.1\|1262198_1262822_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	6.7e-53	56.0
AWF06149.1\|1262823_1264773_+	cotH family protein	Q6QI97	Burkholderia_phage	1.0e-06	38.9
AWF03443.1\|1264782_1265901_+	hypothetical protein	A0A248XD67	Klebsiella_phage	4.4e-55	38.0
AWF05819.1\|1265952_1267026_+\|tail	phage tail-collar fiber family protein	A0A1S6KZZ8	Salmonella_phage	6.6e-40	53.6
AWF07927.1\|1267174_1268347_+\|tail	phage tail sheath family protein	A0A1S6KZY7	Salmonella_phage	3.4e-207	91.5
AWF07742.1\|1268356_1268872_+\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.4e-80	84.2
AWF05674.1\|1268924_1269224_+	mu-like prophage FluMu gp41 family protein	E5G6P9	Salmonella_phage	8.2e-33	78.0
AWF04301.1\|1269238_1269358_+	phage P2 GpE family protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AWF07738.1\|1269350_1271981_+\|tail	phage tail tape measure protein, TP901 family, core region	E5FFG5	Burkholderia_phage	8.9e-115	41.9
AWF05750.1\|1271977_1272463_+	phage P2 GpU family protein	E5G6Q2	Salmonella_phage	5.2e-61	80.1
AWF06199.1\|1272468_1273554_+	phage late control D family protein	E5G6Q3	Salmonella_phage	4.0e-170	84.3
AWF04733.1\|1274167_1274314_-	hypothetical protein	NA	NA	NA	NA
AWF08677.1\|1274847_1275330_-	ssrA-binding protein	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
1274339:1274385	attR	NA	NA	NA	NA
AWF07921.1\|1275479_1275917_+	ribosome association toxin RatA	NA	NA	NA	NA
AWF05968.1\|1275906_1276197_+	hypothetical protein	NA	NA	NA	NA
AWF08368.1\|1276263_1276605_-	smpA / OmlA family protein	NA	NA	NA	NA
AWF06018.1\|1276586_1276727_-	hypothetical protein	NA	NA	NA	NA
AWF05695.1\|1276752_1278414_-	DNA repair protein RecN	NA	NA	NA	NA
AWF06524.1\|1278500_1279379_-	ATP-NAD kinase family protein	NA	NA	NA	NA
AWF07823.1\|1279503_1280094_+	protein GrpE	NA	NA	NA	NA
AWF08297.1\|1280213_1281455_-	hypothetical protein	NA	NA	NA	NA
AWF03560.1\|1281519_1282311_-	inner membrane protein YpjD	NA	NA	NA	NA
AWF03472.1\|1282474_1283839_+	signal recognition particle protein	NA	NA	NA	NA
AWF03938.1\|1284098_1284347_+	ribosomal protein S16	NA	NA	NA	NA
AWF07394.1\|1284455_1284914_+	16S rRNA processing protein RimM	NA	NA	NA	NA
AWF08657.1\|1284945_1285713_+\|tRNA	tRNA (guanine(37)-N(1))-methyltransferase	NA	NA	NA	NA

DBSCAN-SWA_3

1390438 : 1435141

Salmonella_phage(42.22%)

integrase,head,terminase,protease,tail

attL 1393002:1393016|attR 1404183:1404197

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF06036.1\|1390438_1391905_+	inosine-5'-monophosphate dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-87	38.7
AWF04804.1\|1391972_1393550_+	GMP synthase	NA	NA	NA	NA
1393002:1393016	attL	NA	NA	NA	NA
AWF04715.1\|1393742_1394993_+\|integrase	phage integrase family protein	A0A1X9TCT6	Enterobacter_phage	1.4e-206	85.3
AWF07350.1\|1395009_1395201_-	putative cell division initiation protein	NA	NA	NA	NA
AWF03345.1\|1395376_1395970_-	MT-A70 family protein	T1SA14	Salmonella_phage	4.3e-110	92.4
AWF07757.1\|1395966_1396125_-	hypothetical protein	T1SAR0	Salmonella_phage	1.9e-17	78.8
AWF03793.1\|1396117_1396402_-	perC transcriptional activator family protein	T1S9J5	Salmonella_phage	5.6e-31	72.3
AWF05317.1\|1396520_1396769_-	prophage CP4-57 regulatory family protein	A0A0F6TJ45	Escherichia_coli_O157_typing_phage	1.1e-27	69.5
AWF06414.1\|1396820_1397273_-	recombinase, phage RecT family protein	Q858E1	Salmonella_phage	5.7e-70	91.9
AWF06896.1\|1397852_1398752_-	putative phage-type endonuclease domain protein	Q858E0	Salmonella_phage	1.5e-159	93.0
AWF04235.1\|1398748_1399048_-	hypothetical protein	A0A0F6R7M4	Escherichia_coli_O157_typing_phage	2.1e-20	54.5
AWF03499.1\|1399044_1399194_-	hypothetical protein	G9L6A5	Escherichia_phage	7.9e-13	84.2
AWF05570.1\|1399414_1399996_-	cro/C1-type HTH DNA-binding domain protein	Q858D7	Salmonella_phage	1.9e-65	64.8
AWF08064.1\|1400149_1400383_+	hypothetical protein	T1SAR5	Salmonella_phage	9.2e-24	66.2
AWF04957.1\|1400530_1400740_+	hypothetical protein	A0A193GYW4	Enterobacter_phage	1.8e-26	78.3
AWF04295.1\|1400739_1401507_+	hypothetical protein	A0A193GZ86	Enterobacter_phage	3.4e-139	91.0
AWF08059.1\|1401503_1402289_+	replication P family protein	A0A193GYX1	Enterobacter_phage	8.2e-133	87.4
AWF03524.1\|1402453_1402756_+	hypothetical protein	A0A0F6R8N5	Escherichia_coli_O157_typing_phage	1.4e-43	83.0
AWF03853.1\|1402817_1402952_+	putative membrane protein	NA	NA	NA	NA
AWF07804.1\|1402936_1403359_+	hypothetical protein	A0A2P1MXC5	Escherichia_phage	2.4e-14	40.5
AWF04910.1\|1403342_1403534_+	hypothetical protein	NA	NA	NA	NA
AWF06326.1\|1403530_1403956_+	hypothetical protein	NA	NA	NA	NA
AWF03308.1\|1403952_1404696_+	hypothetical protein	A6N3G8	Burkholderia_virus	1.5e-19	59.5
1404183:1404197	attR	NA	NA	NA	NA
AWF04955.1\|1404695_1404866_+	hypothetical protein	A0A2R2Z308	Escherichia_phage	2.5e-15	69.6
AWF04499.1\|1404866_1405079_+	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	8.1e-11	45.5
AWF03299.1\|1405075_1405744_+	hypothetical protein	Q6UAT8	Klebsiella_phage	1.5e-05	52.5
AWF08475.1\|1405736_1405976_+	hypothetical protein	G8C7S3	Escherichia_phage	4.6e-10	48.0
AWF07779.1\|1405975_1406314_+	hypothetical protein	A0A193GYX4	Enterobacter_phage	4.7e-45	80.0
AWF07825.1\|1406388_1406646_+	hypothetical protein	NA	NA	NA	NA
AWF05835.1\|1406723_1407308_+\|terminase	terminase small subunit	T1SBI8	Salmonella_phage	2.4e-89	88.1
AWF05925.1\|1407304_1408780_+	hypothetical protein	Q858H3	Salmonella_phage	1.9e-279	92.9
AWF06424.1\|1408823_1409345_-	hypothetical protein	A0A1B0VMG3	Pseudomonas_phage	7.8e-47	55.2
AWF08240.1\|1410050_1410254_+	hypothetical protein	NA	NA	NA	NA
AWF07622.1\|1410257_1411937_+\|head,tail	bacteriophage head to tail connecting family protein	T1S9Z7	Salmonella_phage	3.4e-192	58.9
AWF06040.1\|1411933_1412239_+	hypothetical protein	Q2A090	Sodalis_phage	1.1e-16	51.3
AWF05160.1\|1412281_1412479_+	hypothetical protein	NA	NA	NA	NA
AWF06944.1\|1412532_1412919_+\|protease	putative endoprotease	T1SAP9	Salmonella_phage	1.9e-34	58.6
AWF05223.1\|1412931_1413939_+	hypothetical protein	T1S9H9	Salmonella_phage	2.7e-181	92.5
AWF06569.1\|1413948_1414341_+	hypothetical protein	T1SA71	Salmonella_phage	1.5e-55	89.9
AWF07721.1\|1414333_1414612_+	hypothetical protein	T1SA01	Salmonella_phage	6.7e-21	58.9
AWF05577.1\|1414660_1415272_+	hypothetical protein	T1SAQ2	Salmonella_phage	1.2e-46	48.8
AWF04989.1\|1415271_1417749_+	hypothetical protein	G9L6D0	Escherichia_phage	3.6e-267	56.5
AWF03462.1\|1417750_1418221_+	hypothetical protein	Q858G2	Salmonella_phage	7.3e-44	55.3
AWF08149.1\|1418213_1418711_+	hypothetical protein	A0A0F6TJ56	Escherichia_coli_O157_typing_phage	5.7e-23	40.5
AWF07175.1\|1418723_1421468_+	putative bacteriophage protein	A0A193GYI3	Enterobacter_phage	9.1e-94	39.2
AWF03787.1\|1421467_1424857_+	hypothetical protein	G9L6D4	Escherichia_phage	6.3e-121	42.0
AWF05699.1\|1424866_1425481_+	hypothetical protein	NA	NA	NA	NA
AWF05206.1\|1425755_1425920_-	hypothetical protein	NA	NA	NA	NA
AWF05340.1\|1426158_1426371_-	hypothetical protein	NA	NA	NA	NA
AWF05218.1\|1426421_1426538_-	hypothetical protein	NA	NA	NA	NA
AWF07614.1\|1426531_1426987_-	putative anti-repressor protein	A0A193GYJ9	Enterobacter_phage	3.3e-41	54.7
AWF07084.1\|1428604_1430974_+\|tail	phage T7 tail fiber family protein	A0A2H5BN49	Klebsiella_phage	9.1e-268	79.5
AWF05127.1\|1430982_1431135_+	hypothetical protein	A0A2H5BN82	Klebsiella_phage	1.9e-06	54.3
AWF05077.1\|1431258_1431663_+	putative membrane protein	T1SA79	Salmonella_phage	9.3e-56	84.1
AWF03352.1\|1431817_1431952_-	hypothetical protein	NA	NA	NA	NA
AWF05387.1\|1431944_1432574_+	chitinase class I family protein	Q858F0	Salmonella_phage	3.1e-90	76.4
AWF04820.1\|1432570_1433053_+	hypothetical protein	Q858E9	Salmonella_phage	3.0e-61	80.6
AWF06508.1\|1433272_1435141_-	type I phosphodiesterase / nucleotide pyrophosphatase family protein	A0A2P0VMN7	Tetraselmis_virus	2.6e-07	22.6

DBSCAN-SWA_4

1763871 : 1770778

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF07800.1\|1763871_1764735_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
AWF06582.1\|1764745_1765519_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.5e-25	36.3
AWF06189.1\|1765629_1765761_+	hypothetical protein	NA	NA	NA	NA
AWF04131.1\|1765761_1766655_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
AWF05908.1\|1766900_1768262_-	peptidase U32 family protein	Q6DW11	Phage_TP	2.5e-206	94.5
AWF04643.1\|1768580_1769303_-	transcriptional regulatory, C terminal family protein	W8CYM9	Bacillus_phage	6.4e-31	33.2
AWF04490.1\|1769299_1770778_-	signal transduction histidine-protein kinase BaeS	W8CYF6	Bacillus_phage	1.1e-29	28.3

DBSCAN-SWA_5

1807345 : 1814970

Enterobacteria_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF07141.1\|1807345_1808752_+	6-phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	4.7e-38	28.7
AWF04981.1\|1808919_1809033_-	hypothetical protein	NA	NA	NA	NA
AWF08502.1\|1809063_1810041_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.2e-94	54.0
AWF07124.1\|1810067_1810937_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	9.8e-111	67.0
AWF06205.1\|1810968_1811859_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.8e-28	33.6
AWF03390.1\|1811873_1812428_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.8e-52	58.2
AWF04816.1\|1812608_1813775_+	nucleotide sugar dehydrogenase family protein	M1I798	Paramecium_bursaria_Chlorella_virus	4.1e-112	54.7
AWF06776.1\|1813968_1814970_+	3-beta hydroxysteroid dehydrogenase/isomerase family protein	E3T4Y8	Cafeteria_roenbergensis_virus	1.2e-30	28.6

DBSCAN-SWA_6

2781537 : 2792424

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF03753.1\|2781537_2784645_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6
AWF06004.1\|2784699_2785965_+	lactose permease	NA	NA	NA	NA
AWF04960.1\|2785995_2787084_-	recF/RecN/SMC N terminal domain protein	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AWF08164.1\|2787170_2787431_-	hypothetical protein	A0A077SK33	Escherichia_phage	3.5e-40	97.7
AWF05406.1\|2787728_2788589_+	beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AWF05850.1\|2788609_2789371_-	HTH domain protein	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AWF06963.1\|2789631_2790534_+	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain protein	A0A077SLF7	Escherichia_phage	7.7e-159	99.3
AWF05411.1\|2790545_2791811_+	hypothetical protein	A0A077SLJ7	Escherichia_phage	6.6e-233	99.5
AWF06614.1\|2791803_2792424_+	class II Aldolase and Adducin N-terminal domain protein	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_7

3015610 : 3157619

166

Klebsiella_phage(26.73%)

capsid,lysis,transposase,terminase,protease,integrase,tail

attL 3091373:3091388|attR 3154925:3154940

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF07794.1\|3015610_3018634_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	1.6e-22	44.7
AWF04007.1\|3018689_3018887_-	hypothetical protein	NA	NA	NA	NA
AWF03482.1\|3018861_3019029_-	hypothetical protein	NA	NA	NA	NA
AWF05401.1\|3019113_3019278_-	hypothetical protein	NA	NA	NA	NA
AWF06446.1\|3019752_3020199_-	hypothetical protein	A0A0M5M1K4	Salmonella_phage	1.1e-28	46.0
AWF06906.1\|3020522_3021713_-	putative bacteriophage protein	A0A0M4RD32	Salmonella_phage	1.9e-157	72.7
AWF04493.1\|3021718_3022072_-	putative bacteriophage protein	A0A2H4J629	uncultured_Caudovirales_phage	2.3e-50	80.3
AWF06026.1\|3022073_3022727_-	putative translation initiation factor IF-2	A0A2H4J8H6	uncultured_Caudovirales_phage	1.0e-59	63.5
AWF07649.1\|3022780_3023131_-	hypothetical protein	NA	NA	NA	NA
AWF03553.1\|3023383_3023569_+	hypothetical protein	NA	NA	NA	NA
AWF05834.1\|3023621_3023855_-	hypothetical protein	A0A2H4J1A5	uncultured_Caudovirales_phage	5.8e-18	52.6
AWF05852.1\|3023962_3024985_-	putative bacteriophage protein	A0A2H4J1B2	uncultured_Caudovirales_phage	9.2e-100	54.2
AWF06987.1\|3024987_3025215_-	putative bacteriophage protein	A0A2H4J495	uncultured_Caudovirales_phage	4.6e-20	56.0
AWF07954.1\|3025290_3025704_-	hypothetical protein	A0A2H4J1B3	uncultured_Caudovirales_phage	8.1e-31	55.9
AWF08383.1\|3025889_3027893_-	transglycosylase SLT domain protein	A0A2H4J9N7	uncultured_Caudovirales_phage	1.2e-247	63.6
AWF04405.1\|3027882_3028035_-	putative nTP pyrophosphohydrolase including oxidative damage repair enzyme	A0A2H4J1A2	uncultured_Caudovirales_phage	7.6e-19	88.0
AWF07387.1\|3028070_3028496_-	putative bacteriophage protein	A0A2H4J2V6	uncultured_Caudovirales_phage	2.6e-40	63.4
AWF07976.1\|3028499_3028700_-	hypothetical protein	A0A0M5M1K6	Salmonella_phage	1.6e-24	80.3
AWF08213.1\|3028897_3029140_+\|transposase	transposase family protein	Q6H9S4	Enterobacteria_phage	2.0e-05	37.0
AWF07410.1\|3029136_3030015_+	HTH-like domain protein	U5P429	Shigella_phage	2.6e-50	43.5
AWF03714.1\|3030256_3031402_-	hypothetical protein	A0A2H4J8G4	uncultured_Caudovirales_phage	6.3e-166	76.9
AWF07773.1\|3031405_3031846_-	putative bacteriophage protein	A0A2H4J1A0	uncultured_Caudovirales_phage	1.6e-40	51.7
AWF07802.1\|3031940_3032327_-	putative phage protein	A0A2H4J1A4	uncultured_Caudovirales_phage	1.1e-48	78.2
AWF06337.1\|3032326_3032833_-	hypothetical protein	NA	NA	NA	NA
AWF04126.1\|3032829_3033249_-	hypothetical protein	A0A0M5M3S2	Salmonella_phage	3.3e-40	60.7
AWF03901.1\|3033217_3033499_-	hypothetical protein	NA	NA	NA	NA
AWF05938.1\|3033538_3034474_-	hypothetical protein	A0A2H4J191	uncultured_Caudovirales_phage	2.3e-137	77.1
AWF05895.1\|3034491_3034986_-	putative bacteriophage protein	A0A2H4JHM9	uncultured_Caudovirales_phage	4.2e-50	62.7
AWF06122.1\|3034989_3035976_-	hypothetical protein	A0A0M4R5A6	Salmonella_phage	1.7e-79	52.6
AWF07252.1\|3036847_3038299_-	hypothetical protein	A0A0M4S6U1	Salmonella_phage	3.8e-192	68.8
AWF03551.1\|3038536_3039937_-\|terminase	phage terminase, large subunit, PBSX family	A0A077KAW0	Edwardsiella_phage	9.4e-188	69.0
AWF03688.1\|3039887_3040376_-	putative bacteriophage protein	NA	NA	NA	NA
AWF03580.1\|3041356_3041677_+	hypothetical protein	NA	NA	NA	NA
AWF08296.1\|3041682_3042213_-	phage lysozyme family protein	K7PLY1	Enterobacteria_phage	2.7e-79	77.1
AWF06747.1\|3042215_3042464_-\|lysis	lysis S family protein	NA	NA	NA	NA
AWF03389.1\|3042481_3042610_+	hypothetical protein	NA	NA	NA	NA
AWF08048.1\|3042647_3042803_-	hypothetical protein	NA	NA	NA	NA
AWF03456.1\|3042869_3043652_-	antitermination family protein	F1C595	Cronobacter_phage	7.2e-113	76.8
AWF05586.1\|3043648_3044125_-	hypothetical protein	A0A286N2Q1	Klebsiella_phage	1.8e-90	100.0
AWF04146.1\|3044121_3045084_-	zinc-binding domain of primase-helicase family protein	A0A286N2Q0	Klebsiella_phage	4.8e-183	99.4
AWF08673.1\|3045085_3046699_-	helicase domain protein	A0A286N2P9	Klebsiella_phage	2.1e-311	95.9
AWF03271.1\|3047585_3047753_-	hypothetical protein	NA	NA	NA	NA
AWF04067.1\|3048478_3048793_+	hypothetical protein	A0A286S1T9	Klebsiella_phage	1.0e-49	100.0
AWF03693.1\|3048785_3048974_+	hypothetical protein	A0A286S1P8	Klebsiella_phage	4.6e-26	100.0
AWF08679.1\|3049296_3049509_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	2.1e-30	97.1
AWF08020.1\|3049823_3049946_+	hypothetical protein	A0A286S1P6	Klebsiella_phage	1.3e-16	100.0
AWF04565.1\|3049942_3050368_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	3.5e-53	77.9
AWF06757.1\|3050364_3050559_+	putative membrane protein	NA	NA	NA	NA
AWF08444.1\|3050555_3051383_+	SPFH domain / Band 7 family protein	Q8W654	Enterobacteria_phage	5.5e-111	84.0
AWF03780.1\|3051487_3052006_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.7e-94	98.8
AWF05733.1\|3052017_3052722_+	phage regulatory Rha family protein	A0A286S260	Klebsiella_phage	4.7e-111	88.2
AWF06632.1\|3052711_3052936_+	hypothetical protein	A0A286S2B3	Klebsiella_phage	3.1e-29	89.2
AWF06045.1\|3052989_3053145_+	hypothetical protein	A0A286S2B6	Klebsiella_phage	2.8e-21	100.0
AWF04543.1\|3053141_3053621_+	hypothetical protein	NA	NA	NA	NA
AWF07585.1\|3053693_3053840_+	putative bacteriophage protein	A0A1B5FPC2	Escherichia_phage	2.9e-15	70.8
AWF03861.1\|3053841_3054042_+	hypothetical protein	A0A0M4RTZ2	Salmonella_phage	4.1e-20	73.8
AWF08116.1\|3054022_3055204_-\|integrase	phage integrase family protein	A0A0M4QX09	Salmonella_phage	5.6e-202	84.2
AWF07224.1\|3055400_3055949_+\|protease	intracellular protease, PfpI family protein	NA	NA	NA	NA
AWF07700.1\|3056147_3057680_-	HD domain protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.1e-21	30.0
AWF08529.1\|3057896_3058658_-	KR domain protein	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-20	32.5
AWF07719.1\|3058766_3059681_+	lysR substrate binding domain protein	NA	NA	NA	NA
AWF04469.1\|3060240_3060549_-	histidine kinase-like ATPase domain protein	NA	NA	NA	NA
AWF07070.1\|3060554_3060692_+	glycosyl hydrolase family 2 domain protein	NA	NA	NA	NA
AWF04748.1\|3060716_3061586_-	aldo/keto reductase family protein	A0A2H4PQR8	Staphylococcus_phage	5.7e-50	42.1
AWF06505.1\|3061664_3062819_-	major Facilitator Superfamily protein	NA	NA	NA	NA
AWF07489.1\|3062939_3063998_-	hypothetical protein	NA	NA	NA	NA
AWF04991.1\|3064248_3065133_+	lysR substrate binding domain protein	NA	NA	NA	NA
AWF04570.1\|3065257_3066091_-	hypothetical protein	NA	NA	NA	NA
AWF04821.1\|3066321_3066708_+	hypothetical protein	NA	NA	NA	NA
AWF03932.1\|3066875_3068492_-	periplasmic murein peptide-binding protein	NA	NA	NA	NA
AWF03582.1\|3068488_3068605_-	hypothetical protein	NA	NA	NA	NA
AWF03733.1\|3068677_3069385_+	zinc carboxypeptidase family protein	NA	NA	NA	NA
AWF06491.1\|3069381_3070338_-	L-Ala-D/L-Glu epimerase	NA	NA	NA	NA
AWF05190.1\|3070449_3070956_+	thiol peroxidase	NA	NA	NA	NA
AWF08277.1\|3071026_3072079_-	membrane AbrB duplication domain protein	NA	NA	NA	NA
AWF08210.1\|3072180_3073722_-	transcriptional regulatory protein TyrR	NA	NA	NA	NA
AWF05798.1\|3073894_3075190_-	family 4 glycosyl hydrolase C-terminal domain protein	NA	NA	NA	NA
AWF05942.1\|3075366_3076221_+	lysR substrate binding domain protein	NA	NA	NA	NA
AWF07217.1\|3076310_3077372_-	hypothetical protein	NA	NA	NA	NA
AWF06324.1\|3077368_3078766_-	hypothetical protein	NA	NA	NA	NA
AWF05240.1\|3078868_3079087_-	phage shock PspD family protein	NA	NA	NA	NA
AWF06543.1\|3079115_3079475_-	phage shock protein C	NA	NA	NA	NA
AWF07851.1\|3079474_3079699_-	phage shock protein B	NA	NA	NA	NA
AWF06139.1\|3079754_3080423_-	phage shock protein A	NA	NA	NA	NA
AWF06665.1\|3080590_3081565_+	psp operon transcriptional activator	NA	NA	NA	NA
AWF03909.1\|3081555_3082947_-	quinolone resistance protein NorB	NA	NA	NA	NA
AWF04092.1\|3082972_3084142_-	amidohydrolase family protein	NA	NA	NA	NA
AWF08598.1\|3084313_3086623_+	helix-turn-helix domain protein	NA	NA	NA	NA
AWF04856.1\|3086601_3087432_-	helix-turn-helix domain protein	NA	NA	NA	NA
AWF06401.1\|3087542_3088448_+	rmlD substrate binding domain protein	NA	NA	NA	NA
AWF08026.1\|3088781_3090425_+	bacterial extracellular solute-binding, 5 Middle family protein	NA	NA	NA	NA
AWF03639.1\|3090421_3091387_+	peptide transport system permease protein SapB	NA	NA	NA	NA
3091373:3091388	attL	NA	NA	NA	NA
AWF06915.1\|3091591_3092263_+	hypothetical protein	A0A2H4J5W2	uncultured_Caudovirales_phage	4.5e-79	59.6
AWF04772.1\|3093016_3093277_+	hypothetical protein	NA	NA	NA	NA
AWF03323.1\|3093352_3094618_-	IMS HHH motif family protein	I6RSM4	Salmonella_phage	9.6e-208	82.7
AWF08009.1\|3094619_3095039_-	protein UmuD	A0A1W6JNS2	Morganella_phage	1.4e-35	57.5
AWF05609.1\|3095118_3096603_-	reverse transcriptase family protein	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AWF06350.1\|3098000_3098468_-	DNA-invertase hin	A0A286S1P7	Klebsiella_phage	1.4e-76	98.0
AWF03484.1\|3098515_3099220_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWF07227.1\|3099396_3100161_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AWF05133.1\|3101295_3102135_-	dihydropteroate synthase	NA	NA	NA	NA
AWF04311.1\|3102639_3103431_-	nucleotidyltransferase domain protein	NA	NA	NA	NA
AWF05381.1\|3104426_3105131_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWF06769.1\|3105379_3107323_+	putative flagellar biosynthesis, cell-distal portion of basal-body rod	A0A286S1P0	Klebsiella_phage	1.1e-37	69.8
AWF06814.1\|3107330_3107456_+	hypothetical protein	NA	NA	NA	NA
AWF07067.1\|3107564_3108164_+	concanavalin A-like lectin/glucanases superfamily protein	NA	NA	NA	NA
AWF04961.1\|3108388_3109120_-	concanavalin A-like lectin/glucanases superfamily protein	NA	NA	NA	NA
AWF04986.1\|3109123_3112078_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	4.2e-44	68.3
AWF08204.1\|3112154_3115223_-\|tail	phage tail family protein	A0A286S259	Klebsiella_phage	0.0e+00	97.5
AWF05277.1\|3115219_3115600_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	1.8e-72	99.2
AWF04416.1\|3115609_3116092_-	hypothetical protein	A0A286S2B1	Klebsiella_phage	1.7e-80	94.4
AWF07157.1\|3116272_3116572_-	putative alkanesulfonate ABC transporter membrane protein	A0A286S298	Klebsiella_phage	1.4e-37	70.8
AWF07110.1\|3117577_3118558_-	hypothetical protein	Q38213	Escherichia_phage	8.9e-185	99.1
AWF06024.1\|3118670_3121568_-\|tail	prophage tail length tape measure family protein	A0A2H4J107	uncultured_Caudovirales_phage	1.6e-104	32.7
AWF04965.1\|3122245_3122602_-	hypothetical protein	A0A1V0E5P9	Salmonella_phage	1.1e-44	75.0
AWF04236.1\|3122678_3122855_-	hypothetical protein	NA	NA	NA	NA
AWF08405.1\|3123022_3123505_-	hypothetical protein	NA	NA	NA	NA
AWF06634.1\|3123558_3124731_-	bacterial Ig-like domain family protein	A0A0D4DBN5	Acinetobacter_phage	1.2e-23	27.0
AWF07302.1\|3124754_3124907_-	putative electron transfer flavoprotein subunit beta	NA	NA	NA	NA
AWF06903.1\|3125143_3125695_-	hypothetical protein	G8C7Q1	Escherichia_phage	1.3e-28	39.9
AWF03846.1\|3125696_3126080_-	putative glutamate 5-kinase	A0A0S2SYG4	Pseudomonas_phage	7.1e-21	45.2
AWF03981.1\|3126309_3126564_-	hypothetical protein	J9Q7U0	Salmonella_phage	1.0e-20	52.4
AWF03767.1\|3126565_3126961_-	hypothetical protein	A0A1B1P9F2	Acinetobacter_phage	4.3e-13	38.5
AWF07140.1\|3127282_3128236_-\|capsid	putative major capsid protein	A0A1B0VMF8	Pseudomonas_phage	5.0e-132	74.4
AWF05509.1\|3128246_3129032_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	1.0e-66	63.9
AWF06450.1\|3129145_3129322_-	hypothetical protein	NA	NA	NA	NA
AWF05738.1\|3129562_3130588_-	phage Mu F like family protein	I6PD76	Cronobacter_phage	1.9e-100	55.2
AWF04674.1\|3130658_3132059_-	hypothetical protein	A0A1B0VMH0	Pseudomonas_phage	1.1e-127	53.5
AWF07830.1\|3132058_3133318_-\|terminase	terminase-like family protein	A0A1B1P9C9	Acinetobacter_phage	4.8e-143	58.2
AWF04898.1\|3133343_3134348_-\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	1.5e-38	45.5
AWF07725.1\|3134896_3135088_-	putative membrane protein	NA	NA	NA	NA
AWF03351.1\|3135210_3135456_-	hypothetical protein	A0A286N2R1	Klebsiella_phage	4.6e-34	96.3
AWF06592.1\|3135681_3135810_-	hypothetical protein	A0A286N2R0	Klebsiella_phage	1.4e-10	78.6
AWF07293.1\|3136269_3136398_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	6.8e-13	85.7
AWF05265.1\|3136414_3136690_-	hypothetical protein	A0A286N2Q8	Klebsiella_phage	2.2e-08	72.5
AWF07909.1\|3136686_3137031_-	putative membrane protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	80.7
AWF04050.1\|3137027_3137567_-	putative Peptidoglycan domain protein	A0A286N2Q6	Klebsiella_phage	3.3e-101	98.9
AWF05787.1\|3137563_3137875_-	putative membrane protein	A0A286N2Q5	Klebsiella_phage	3.8e-49	100.0
AWF07096.1\|3138341_3139388_-\|integrase	integrase core domain protein	A0A0M3LR35	Mannheimia_phage	1.3e-05	21.9
AWF07255.1\|3139613_3140306_-	phage antitermination Q family protein	I6PDF8	Cronobacter_phage	6.1e-55	52.7
AWF03245.1\|3140302_3140443_-	putative gifsy-1 Prophage Protein	NA	NA	NA	NA
AWF05879.1\|3140439_3141078_-	bacteriophage Lambda NinG family protein	H6WRY9	Salmonella_phage	3.2e-74	69.8
AWF08608.1\|3141070_3141739_-	serine/threonine-protein phosphatase	K7P6H8	Enterobacteria_phage	1.4e-104	78.7
AWF08493.1\|3141735_3141903_-	putative NinE-like protein from lambdoid prophage DLP12	K7P7K0	Enterobacteria_phage	4.6e-09	62.5
AWF07326.1\|3141883_3142351_-	ninB family protein	Q8VNP6	Enterobacteria_phage	3.4e-33	45.8
AWF06257.1\|3142871_3143900_+	hypothetical protein	NA	NA	NA	NA
AWF07726.1\|3143896_3144025_-	hypothetical protein	T1SAP7	Salmonella_phage	1.1e-07	65.1
AWF03667.1\|3144107_3144353_-	phosphoadenosine phosphosulfate reductase family domain protein	NA	NA	NA	NA
AWF07964.1\|3144408_3144711_-	hypothetical protein	NA	NA	NA	NA
AWF03832.1\|3144707_3145556_-	ATPase associated with various cellular activities family protein	K7PLU3	Enterobacteria_phage	5.1e-88	60.1
AWF05755.1\|3145552_3146413_-	phage replication protein O, N-terminal domain	K7PGT1	Enterobacteria_phage	1.0e-59	53.3
AWF06650.1\|3146498_3146720_-	bacteriophage CII family protein	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
AWF08655.1\|3147306_3147798_+	peptidase S24-like family protein	Q76H56	Enterobacteria_phage	1.7e-72	81.6
AWF04876.1\|3148118_3149162_+	cobQ/CobB/MinD/ParA nucleotide binding domain protein	H2BD62	Pseudomonas_phage	8.8e-58	37.9
AWF07492.1\|3149243_3149447_-	hypothetical protein	A0A192Y6Q5	Salmonella_phage	3.9e-18	71.6
AWF03837.1\|3149757_3149883_+	putative membrane protein	NA	NA	NA	NA
AWF07759.1\|3149911_3150070_+	hypothetical protein	NA	NA	NA	NA
AWF05445.1\|3150158_3150443_+	hypothetical protein	G8C7T1	Escherichia_phage	1.1e-39	79.8
AWF04564.1\|3150473_3151304_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	1.4e-69	59.2
AWF07036.1\|3151589_3152270_+	exonuclease	A0A0M3ULE0	Salmonella_phage	8.2e-121	91.2
AWF04083.1\|3152266_3152695_+	hypothetical protein	M9NYX4	Enterobacteria_phage	7.5e-64	80.3
AWF08392.1\|3152691_3153354_+	MT-A70 family protein	G8C7S6	Escherichia_phage	2.7e-105	84.6
AWF06709.1\|3153561_3154749_-\|integrase	phage integrase family protein	K7PGY1	Enterobacteria_phage	1.1e-120	52.4
AWF04169.1\|3154925_3155816_+	peptide transport system permease protein SapC	NA	NA	NA	NA
3154925:3154940	attR	NA	NA	NA	NA
AWF05675.1\|3155815_3156808_+	oligopeptide/dipeptide ABC transporter, ATP-binding, C-terminal domain protein	G9BWD6	Planktothrix_phage	3.0e-07	27.2
AWF07706.1\|3156809_3157619_+	ABC transporter family protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-14	28.9

DBSCAN-SWA_8

3545638 : 3626854

Salmonella_phage(64.81%)

plate,capsid,lysis,tRNA,protease,head,terminase,integrase,tail,portal

attL 3589429:3589447|attR 3626929:3626947

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF03996.1\|3545638_3547360_+	thiol reductant ABC exporter, CydC subunit	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
AWF04787.1\|3547404_3548106_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AWF06421.1\|3548459_3548678_+	translation initiation factor IF-1	NA	NA	NA	NA
AWF06945.1\|3548798_3551045_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AWF04190.1\|3551108_3551426_-\|protease	ATP-dependent Clp protease adaptor ClpS family protein	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AWF04850.1\|3551751_3551973_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AWF06052.1\|3552049_3553990_-	macrolide export ATP-binding/permease protein MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
AWF08032.1\|3553986_3555102_-	macrolide-specific efflux protein MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
AWF07237.1\|3555248_3556907_-	hypothetical protein	NA	NA	NA	NA
AWF07951.1\|3557099_3557273_+	hypothetical protein	NA	NA	NA	NA
AWF08252.1\|3557326_3558022_+	aquaporin Z	NA	NA	NA	NA
AWF03958.1\|3558018_3558132_-	hypothetical protein	NA	NA	NA	NA
AWF07046.1\|3558137_3559037_+	hypothetical protein	NA	NA	NA	NA
AWF03759.1\|3559180_3560833_+	hydroxylamine reductase	NA	NA	NA	NA
AWF06283.1\|3560843_3561812_+	NADH oxidoreductase hcr	NA	NA	NA	NA
AWF06854.1\|3562023_3562458_-	doxX family protein	NA	NA	NA	NA
AWF07681.1\|3562609_3564328_+	pyruvate dehydrogenase	NA	NA	NA	NA
AWF08651.1\|3564366_3565368_+	low specificity L-threonine aldolase	NA	NA	NA	NA
AWF03784.1\|3565378_3566821_+	3-beta hydroxysteroid dehydrogenase/isomerase family protein	NA	NA	NA	NA
AWF03788.1\|3566908_3567922_+	3-beta hydroxysteroid dehydrogenase/isomerase family protein	NA	NA	NA	NA
AWF06734.1\|3567918_3568749_-	N-acetylmuramoyl-L-alanine amidase AmiD	A0A1B0UZW5	Roseobacter_phage	4.1e-05	31.6
AWF04196.1\|3568780_3569920_-	diguanylate cyclase domain protein	NA	NA	NA	NA
AWF03476.1\|3570797_3571313_+	hypothetical protein	NA	NA	NA	NA
AWF04172.1\|3571539_3572268_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.2e-29	37.1
AWF06418.1\|3572288_3573020_+	lysine-arginine-ornithine-binding periplasmic family protein	NA	NA	NA	NA
AWF05810.1\|3573026_3573743_+	amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein	NA	NA	NA	NA
AWF07095.1\|3573742_3574411_+	amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein	NA	NA	NA	NA
AWF05552.1\|3574594_3575326_+	lysine-arginine-ornithine-binding periplasmic family protein	NA	NA	NA	NA
AWF03549.1\|3575368_3576841_-	his Kinase A domain protein	W8CYF6	Bacillus_phage	7.9e-28	31.8
AWF03663.1\|3576837_3577554_-	response regulator	W8CYM9	Bacillus_phage	2.1e-34	36.9
AWF07153.1\|3577632_3578760_-	23S rRNA (uracil-5-)-methyltransferase RumB	A0A2K5B251	Erysipelothrix_phage	1.3e-19	25.6
AWF03735.1\|3578801_3579290_-	inner membrane protein YbjO	NA	NA	NA	NA
AWF04286.1\|3579347_3580193_-	binding-protein-dependent transport system inner membrane component family protein	NA	NA	NA	NA
AWF07969.1\|3580189_3581143_-	binding-protein-dependent transport system inner membrane component family protein	NA	NA	NA	NA
AWF03855.1\|3581153_3582287_-	polyamine ABC transporter, ATP-binding family protein	G3M9Y6	Bacillus_virus	2.2e-30	34.9
AWF06824.1\|3582450_3583563_-	putative lipo family protein	NA	NA	NA	NA
AWF04144.1\|3583911_3584391_-	bacterial sensory transduction regulator family protein	NA	NA	NA	NA
AWF06577.1\|3584479_3585382_-	alpha-L-glutamate ligase, RimK family protein	A0A1D7SR78	Cyanophage	2.0e-34	35.3
AWF06241.1\|3585496_3585826_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AWF06106.1\|3586061_3586220_-	NADPH-flavin oxidoreductase domain protein	NA	NA	NA	NA
AWF05845.1\|3586203_3586491_-	hypothetical protein	NA	NA	NA	NA
AWF05824.1\|3586693_3586957_+	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	1.6e-27	73.1
AWF07013.1\|3586963_3587347_-	inner membrane protein YbjM	NA	NA	NA	NA
AWF04389.1\|3587613_3589299_+	aspT/YidE/YbjL antiporter duplication domain protein	NA	NA	NA	NA
AWF06307.1\|3589290_3589404_-	hypothetical protein	NA	NA	NA	NA
3589429:3589447	attL	NA	NA	NA	NA
AWF08249.1\|3589518_3589674_-	ogr/Delta-like zinc finger family protein	E5G6Q4	Salmonella_phage	3.8e-10	65.3
AWF07693.1\|3589828_3590929_-	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	4.9e-176	87.4
AWF08367.1\|3590925_3591411_-	phage P2 GpU family protein	E5G6Q2	Salmonella_phage	7.2e-63	75.6
AWF06790.1\|3591407_3594035_-\|tail	phage tail tape measure protein, TP901 family, core region	E5FFG5	Burkholderia_phage	5.6e-117	42.0
AWF06573.1\|3594027_3594147_-	phage P2 GpE family protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AWF03824.1\|3594161_3594461_-	mu-like prophage FluMu gp41 family protein	E5G6P9	Salmonella_phage	3.7e-33	79.0
AWF05880.1\|3594513_3595029_-\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.3e-81	85.4
AWF04322.1\|3595038_3596211_-\|tail	phage tail sheath family protein	A0A1S6KZY7	Salmonella_phage	1.9e-210	93.3
AWF03899.1\|3596349_3597426_-\|tail	phage tail-collar fiber family protein	Q37842	Escherichia_phage	1.2e-25	44.8
AWF07647.1\|3597455_3597659_-	hypothetical protein	NA	NA	NA	NA
AWF06147.1\|3597655_3598387_-	concanavalin A-like lectin/glucanases superfamily protein	NA	NA	NA	NA
AWF08621.1\|3598390_3601342_-	hypothetical protein	A0A2H4N7A3	Pectobacterium_phage	1.2e-06	50.9
AWF05917.1\|3601343_3601943_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.3e-58	60.5
AWF07251.1\|3601935_3602844_-\|plate	baseplate J-like family protein	E5G6N8	Salmonella_phage	7.6e-106	66.9
AWF07668.1\|3602830_3603193_-	lysozyme family protein	A0A1S6KZZ4	Salmonella_phage	5.8e-49	84.7
AWF07906.1\|3603189_3603762_-\|plate	phage baseplate assembly V family protein	E5G6N6	Salmonella_phage	4.7e-77	72.3
AWF04136.1\|3603876_3604041_-	hypothetical protein	NA	NA	NA	NA
AWF08447.1\|3604039_3604549_+	hypothetical protein	NA	NA	NA	NA
AWF08006.1\|3604545_3604950_-	phage virion morphogenesis protein	E5G6N4	Salmonella_phage	4.3e-45	72.0
AWF07465.1\|3604984_3605416_-\|tail	P2 phage tail completion R family protein	A0A1S6KZY0	Salmonella_phage	9.9e-64	82.5
AWF07838.1\|3605378_3605525_-	hypothetical protein	A0A1S6KZX6	Salmonella_phage	6.0e-13	76.1
AWF06316.1\|3605511_3605940_-\|lysis	phage lysis regulatory, LysB family protein	A0A1S6KZX8	Salmonella_phage	9.6e-51	77.9
AWF05643.1\|3605936_3606320_-	putative membrane protein	A0A1S6KZZ2	Salmonella_phage	2.1e-17	42.0
AWF06365.1\|3606324_3606834_-	phage lysozyme family protein	E5G6N1	Salmonella_phage	2.1e-81	83.4
AWF04818.1\|3606814_3606937_-	putative secretory protein	E5G6N0	Salmonella_phage	2.9e-13	85.0
AWF07099.1\|3607033_3607237_-	phage Tail Protein X family protein	A0A1S6KZY4	Salmonella_phage	1.3e-29	88.1
AWF06625.1\|3607236_3607701_-\|head	phage head completion family protein	A0A1S6KZW8	Salmonella_phage	8.4e-77	89.0
AWF04798.1\|3607796_3608447_-\|terminase	phage small terminase subunit	E5G6M7	Salmonella_phage	8.7e-112	96.3
AWF06677.1\|3608450_3609509_-\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	1.1e-180	93.1
AWF06031.1\|3609525_3610359_-\|capsid	phage capsid scaffolding (GPO) serine peptidase family protein	A0A1S6KZW9	Salmonella_phage	6.3e-123	88.8
AWF03762.1\|3610501_3612268_+	sigma-70, region 4 family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.0
AWF07491.1\|3612267_3613293_+\|portal	phage portal protein, PBSX family	A0A1S6KZW5	Salmonella_phage	7.6e-171	86.7
AWF06394.1\|3613354_3615097_-	AIPR family protein	NA	NA	NA	NA
AWF08535.1\|3615372_3615561_-	putative fels-2 prophage protein	NA	NA	NA	NA
AWF06479.1\|3616164_3616398_-	dinI-like family protein	E5G6M1	Salmonella_phage	4.7e-36	100.0
AWF03935.1\|3616408_3616597_-	putative levan regulatory protein	E5G6M0	Salmonella_phage	5.5e-27	98.4
AWF06603.1\|3616750_3619165_-	bacteriophage replication protein A	E5G6L9	Salmonella_phage	0.0e+00	97.5
AWF08170.1\|3619161_3620019_-	DNA adenine methylase family protein	E5G6L8	Salmonella_phage	2.0e-156	95.4
AWF08189.1\|3620015_3620243_-	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	E5G6L7	Salmonella_phage	6.0e-36	98.7
AWF08167.1\|3620242_3620476_-	hypothetical protein	E5G6L6	Salmonella_phage	4.1e-32	96.1
AWF03350.1\|3620543_3620885_-	putative fels-2 prophage protein	E5G6L5	Salmonella_phage	4.6e-56	99.1
AWF05088.1\|3620848_3621049_-	protein fil	E5G6L4	Salmonella_phage	1.6e-32	97.0
AWF07038.1\|3621056_3621566_-	phage regulatory CII family protein	E5G6L3	Salmonella_phage	5.8e-87	98.8
AWF07915.1\|3621592_3621745_+	hypothetical protein	NA	NA	NA	NA
AWF06772.1\|3621965_3622844_+	bacteriophage CI repressor helix-turn-helix domain protein	A0A1S6KZZ7	Salmonella_phage	1.7e-30	39.9
AWF05227.1\|3622855_3623800_+	hypothetical protein	NA	NA	NA	NA
AWF08088.1\|3623898_3625383_-	reverse transcriptase family protein	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AWF07958.1\|3625801_3626854_+\|integrase	phage integrase family protein	A0A218M4I3	Erwinia_phage	1.0e-106	57.0
3626929:3626947	attR	NA	NA	NA	NA

DBSCAN-SWA_9

4070089 : 4118438

Cronobacter_phage(27.08%)

lysis,coat,tRNA,terminase,integrase

attL 4066376:4066422|attR 4115510:4115556

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4066376:4066422	attL	NA	NA	NA	NA
AWF04171.1\|4070089_4072996_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	1.6e-19	50.0
AWF06157.1\|4073163_4075641_-	hypothetical protein	F1C5A7	Cronobacter_phage	2.7e-198	45.6
AWF05343.1\|4075627_4076023_-	nlpC/P60 family protein	F1C5F2	Cronobacter_phage	8.0e-36	54.0
AWF06464.1\|4076019_4076490_-	hypothetical protein	R9TPR6	Aeromonas_phage	2.5e-28	41.0
AWF03706.1\|4076489_4076966_-	hypothetical protein	A0A2P1MXB5	Escherichia_phage	3.0e-37	49.7
AWF08568.1\|4077008_4080455_-	tape measure domain protein	Q5G8W8	Enterobacteria_phage	1.4e-163	48.6
AWF03247.1\|4080547_4080805_-	hypothetical protein	NA	NA	NA	NA
AWF06237.1\|4081178_4081964_-	BRO family, N-terminal domain protein	A0A2L1IV39	Escherichia_phage	1.9e-84	59.7
AWF06519.1\|4082029_4082743_-	BRO family, N-terminal domain protein	H6WRU8	Salmonella_phage	3.9e-49	50.2
AWF08595.1\|4082732_4082903_-	hicB family protein	I6R9A8	Salmonella_phage	6.1e-17	87.0
AWF05578.1\|4083164_4083362_+	hypothetical protein	NA	NA	NA	NA
AWF04890.1\|4083378_4083849_-	hypothetical protein	NA	NA	NA	NA
AWF04938.1\|4084142_4084322_-	hypothetical protein	K7PM89	Enterobacteria_phage	3.5e-07	65.8
AWF04045.1\|4084399_4085155_-	kilA-N domain protein	K7PGT4	Enterobacteria_phage	2.4e-60	51.0
AWF05201.1\|4085330_4086008_-	hypothetical protein	F1C5E8	Cronobacter_phage	4.8e-73	57.9
AWF07970.1\|4086060_4086813_-	bacterial Ig-like domain family protein	G0ZNE6	Cronobacter_phage	5.8e-43	42.1
AWF07997.1\|4086881_4087115_-	hypothetical protein	G0ZNE4	Cronobacter_phage	4.3e-13	47.4
AWF04232.1\|4087270_4087696_-	putative gp14	R9TPP7	Aeromonas_phage	5.1e-28	47.9
AWF04071.1\|4087698_4088061_-	hypothetical protein	A0A173GCE0	Salmonella_phage	1.8e-18	45.0
AWF06300.1\|4088233_4088614_-	hypothetical protein	F1C5E2	Cronobacter_phage	5.3e-29	55.3
AWF03800.1\|4088616_4088856_-	hypothetical protein	NA	NA	NA	NA
AWF05287.1\|4088866_4089961_-\|coat	putative phage coat protein	F1C5E1	Cronobacter_phage	1.7e-123	62.8
AWF07754.1\|4089972_4090401_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.6e-42	60.8
AWF04298.1\|4090404_4091790_-	hypothetical protein	F1C5D9	Cronobacter_phage	2.3e-154	60.0
AWF08176.1\|4091862_4092267_-	hypothetical protein	NA	NA	NA	NA
AWF08337.1\|4092380_4093280_-	phage Mu F like family protein	F1C5D8	Cronobacter_phage	8.0e-116	69.7
AWF08591.1\|4093359_4094781_-	hypothetical protein	F1C5D7	Cronobacter_phage	9.6e-148	57.1
AWF04450.1\|4094793_4096266_-\|terminase	putative terminase large subunit	A0A1W6JNY3	Morganella_phage	1.3e-248	82.5
AWF08158.1\|4096265_4096868_-	putative dNA repair protein RecN	G8C7P2	Escherichia_phage	5.4e-76	80.9
AWF05672.1\|4097084_4097246_+	hypothetical protein	NA	NA	NA	NA
AWF06143.1\|4097238_4097568_+	hypothetical protein	NA	NA	NA	NA
AWF04240.1\|4097673_4098138_-\|lysis	bacteriophage lysis family protein	Q76H63	Enterobacteria_phage	2.4e-55	73.2
AWF04413.1\|4098134_4098665_-	phage lysozyme family protein	G9L6J6	Escherichia_phage	6.0e-79	78.5
AWF04428.1\|4098667_4098916_-\|lysis	lysis S family protein	NA	NA	NA	NA
AWF08636.1\|4099825_4100515_-	phage antitermination Q family protein	I6PDF8	Cronobacter_phage	1.4e-56	54.5
AWF04491.1\|4101168_4101804_-	bacteriophage Lambda NinG family protein	M9NYX8	Enterobacteria_phage	2.7e-81	77.9
AWF07907.1\|4101796_4101967_-	putative NinE-like protein from lambdoid prophage DLP12	G8C7V4	Escherichia_phage	1.3e-14	73.2
AWF03703.1\|4101966_4102422_-	putative phage protein	K7P7B8	Enterobacteria_phage	8.0e-56	69.5
AWF04729.1\|4102922_4103570_-	hypothetical protein	A5LH60	Enterobacteria_phage	4.5e-12	32.6
AWF05435.1\|4103742_4104585_-	ead/Ea22-like family protein	A0A2H4FRZ0	Salmonella_phage	1.8e-29	60.8
AWF07709.1\|4104581_4104695_-	hypothetical protein	NA	NA	NA	NA
AWF05551.1\|4104691_4105198_-	hypothetical protein	A0A0A6Z565	Enterobacter_phage	3.0e-27	59.6
AWF04084.1\|4105194_4105407_-	putative protein ren	O48423	Enterobacteria_phage	9.9e-17	69.2
AWF03648.1\|4105487_4106918_-	replicative DNA helicase	Q9MCT4	Escherichia_phage	2.6e-185	66.7
AWF04771.1\|4106907_4107759_-	putative replication protein O	F1C5C3	Cronobacter_phage	5.3e-85	56.3
AWF06815.1\|4107799_4107946_-	hypothetical protein	NA	NA	NA	NA
AWF05230.1\|4108031_4108253_-	bacteriophage CII family protein	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
AWF04210.1\|4109161_4109344_+	hypothetical protein	A0A2I6PIE7	Escherichia_phage	1.5e-18	66.1
AWF04168.1\|4109694_4109910_+	hypothetical protein	B5WZV1	Pseudomonas_phage	1.6e-09	48.6
AWF06235.1\|4110009_4110204_+	hypothetical protein	NA	NA	NA	NA
AWF04448.1\|4110292_4110577_+	hypothetical protein	G8C7T1	Escherichia_phage	8.0e-30	62.8
AWF03278.1\|4110607_4111438_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	6.8e-69	59.2
AWF06973.1\|4111434_4112115_+	exonuclease	A0A0M3ULE0	Salmonella_phage	7.9e-124	93.4
AWF06404.1\|4112266_4112923_+	MT-A70 family protein	G8C7S6	Escherichia_phage	2.7e-113	87.5
AWF06909.1\|4112919_4113687_+	hypothetical protein	D5LH17	Escherichia_phage	1.7e-66	53.4
AWF05233.1\|4113903_4114119_+	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	A0A0K2FI84	Escherichia_phage	4.0e-13	52.9
AWF04361.1\|4114332_4115496_+\|integrase	phage integrase family protein	G8C7S0	Escherichia_phage	3.3e-202	87.3
AWF07315.1\|4115926_4116793_+	bifunctional protein FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
4115510:4115556	attR	NA	NA	NA	NA
AWF05539.1\|4116794_4117007_+	hypothetical protein	NA	NA	NA	NA
AWF04773.1\|4117052_4118438_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4

DBSCAN-SWA_10

4327992 : 4339646

Enterobacteria_phage(70.0%)

integrase,capsid

attL 4327844:4327857|attR 4332057:4332070

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4327844:4327857	attL	NA	NA	NA	NA
AWF06907.1\|4327992_4329096_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.8e-62	40.5
AWF07258.1\|4329106_4330360_+	gamma-glutamyl phosphate reductase	A0A1X9I5D4	Streptococcus_phage	8.9e-89	44.9
AWF04725.1\|4330712_4331903_+\|integrase	phage integrase family protein	Q7M297	Enterobacteria_phage	6.4e-145	62.7
AWF05840.1\|4331890_4332841_+	cobQ/CobB/MinD/ParA nucleotide binding domain protein	A0A1X9IGI7	Lactococcus_phage	1.2e-13	27.1
4332057:4332070	attR	NA	NA	NA	NA
AWF05846.1\|4332840_4333266_+	hypothetical protein	NA	NA	NA	NA
AWF04831.1\|4333612_4333762_-	hypothetical protein	NA	NA	NA	NA
AWF07163.1\|4333834_4334401_-	polarity suppression protein	Q7M2A1	Enterobacteria_phage	1.5e-59	64.3
AWF04687.1\|4334418_4334664_-	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	1.9e-19	58.0
AWF04158.1\|4334660_4335398_-\|capsid	putative glyco3, capsid size determination protein Sid	Q7M2A2	Enterobacteria_phage	9.0e-73	60.7
AWF07100.1\|4335697_4335835_-	hypothetical protein	NA	NA	NA	NA
AWF06647.1\|4335939_4336206_+	prophage CP4-57 regulatory family protein	Q7M299	Enterobacteria_phage	2.6e-30	71.6
AWF07608.1\|4336565_4336760_+	putative phage immunity repressor protein	Q7M2A7	Enterobacteria_phage	3.2e-22	85.5
AWF07428.1\|4336804_4336984_+	hypothetical protein	NA	NA	NA	NA
AWF04515.1\|4336980_4337301_+	putative dNA replication protein	NA	NA	NA	NA
AWF05105.1\|4337312_4339646_+	putative P4-specific DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	82.2

DBSCAN-SWA_11

4806035 : 4813717

Enterobacteria_phage(85.71%)

capsid,integrase,transposase

attL 4798958:4798972|attR 4810792:4810806

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4798958:4798972	attL	NA	NA	NA	NA
AWF06774.1\|4806035_4806515_-\|integrase	integrase core domain protein	A0A0N9SIX5	Staphylococcus_phage	1.6e-06	29.7
AWF04038.1\|4806647_4806803_+	hypothetical protein	NA	NA	NA	NA
AWF05962.1\|4806880_4807147_-\|transposase	transposase family protein	NA	NA	NA	NA
AWF03685.1\|4807743_4807860_-	hypothetical protein	NA	NA	NA	NA
AWF06571.1\|4807892_4810226_-	zinc-binding domain of primase-helicase family protein	Q7M2A8	Enterobacteria_phage	0.0e+00	83.9
AWF05881.1\|4810240_4810561_-	DNA replication protein, phage-associated	NA	NA	NA	NA
AWF08143.1\|4810557_4810785_-	hypothetical protein	NA	NA	NA	NA
AWF07365.1\|4810781_4810976_-	putative phage immunity repressor protein	Q7M2A7	Enterobacteria_phage	7.2e-22	85.5
4810792:4810806	attR	NA	NA	NA	NA
AWF04712.1\|4811326_4811593_-	prophage CP4-57 regulatory family protein	Q7M299	Enterobacteria_phage	2.0e-30	71.6
AWF06216.1\|4812153_4812891_+\|capsid	putative glyco3, capsid size determination protein Sid	Q7M2A2	Enterobacteria_phage	1.1e-70	59.4
AWF05159.1\|4812887_4813133_+	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	5.5e-19	56.8
AWF05232.1\|4813150_4813717_+	polarity suppression protein	Q7M2A1	Enterobacteria_phage	9.7e-59	63.8

DBSCAN-SWA_12

5008856 : 5013943

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF07162.1\|5008856_5009540_+	integral membrane, YjbE family protein	W8EBD0	Pseudomonas_phage	5.1e-30	42.2
AWF08536.1\|5009496_5009610_-	hypothetical protein	NA	NA	NA	NA
AWF05467.1\|5009685_5010603_+	curved DNA-binding protein	A0A1V0SCV5	Indivirus	2.8e-07	42.2
AWF08278.1\|5010602_5010908_+	chaperone modulatory protein CbpM	NA	NA	NA	NA
AWF03795.1\|5011076_5011598_+\|transposase	transposase family protein	A0A1B1P776	Bacillus_phage	1.3e-14	33.5
AWF08311.1\|5011654_5012440_+	DDE domain protein	A0A2I6AZV9	Macacine_betaherpesvirus	3.3e-73	67.7
AWF07664.1\|5012605_5012977_-	plasmid stability family protein	A0A222YWJ6	Escherichia_phage	2.8e-22	53.7
AWF05456.1\|5012986_5013943_-	plasmid segregation protein ParM	A0A222YXF2	Escherichia_phage	1.3e-143	78.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP029101

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4963 : 45972

Macacine_betaherpesvirus(14.29%)

integrase,transposase,holin

attL 12005:12021|attR 43068:43084

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF08888.1\|4963_6043_+\|integrase	integrase core domain protein	NA	NA	NA	NA
AWF08916.1\|6650_6866_-	hypothetical protein	NA	NA	NA	NA
AWF08887.1\|6973_7702_-	psiA family protein	NA	NA	NA	NA
AWF08752.1\|7698_8130_-	plasmid SOS inhibition family protein	NA	NA	NA	NA
AWF08855.1\|8196_10233_-	parB-like nuclease domain protein	G8DH78	Emiliania_huxleyi_virus	9.0e-22	26.0
AWF08837.1\|10302_10551_-	hypothetical protein	NA	NA	NA	NA
AWF08849.1\|10599_11142_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	6.0e-50	76.7
AWF08777.1\|11917_12481_-	methyltransferase small domain protein	M4M9L8	Vibrio_phage	1.7e-18	42.0
12005:12021	attL	NA	NA	NA	NA
AWF08748.1\|12528_13884_-	hypothetical protein	NA	NA	NA	NA
AWF08904.1\|13935_14166_-	hypothetical protein	NA	NA	NA	NA
AWF08800.1\|14257_14485_-	hypothetical protein	NA	NA	NA	NA
AWF08770.1\|14448_14586_+	hypothetical protein	NA	NA	NA	NA
AWF08909.1\|15268_15580_-	putative membrane protein	NA	NA	NA	NA
AWF08859.1\|15620_15875_-	hot	H9C187	Pectobacterium_phage	1.2e-11	50.0
AWF08753.1\|16111_16537_-	antirestriction family protein	NA	NA	NA	NA
AWF08796.1\|17057_17288_-	hypothetical protein	NA	NA	NA	NA
AWF08761.1\|17521_19006_-	reverse transcriptase family protein	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AWF08719.1\|19411_19837_+	peptidase S24-like family protein	A0A1W6JNS2	Morganella_phage	8.3e-31	49.6
AWF08878.1\|19836_21108_+	IMS HHH motif family protein	F1C5A5	Cronobacter_phage	5.6e-155	63.7
AWF08824.1\|21246_21402_+	antitoxin, type II toxin-antitoxin system family protein	NA	NA	NA	NA
AWF08894.1\|21424_22282_-\|transposase	transposase, IS605 OrfB family	A0A1B0VCD8	Salmonella_phage	1.0e-128	80.9
AWF08735.1\|22278_22563_-\|transposase	putative transposase family protein	A0A1W6JP07	Morganella_phage	1.0e-40	86.8
AWF08864.1\|23097_24060_-	hypothetical protein	NA	NA	NA	NA
AWF08724.1\|24059_25031_-	protein SopB	I3WF22	Macacine_betaherpesvirus	4.1e-150	86.6
AWF08737.1\|25030_26197_-	cobQ/CobB/MinD/ParA nucleotide binding domain protein	A0A2I6B2X3	Macacine_betaherpesvirus	1.4e-224	97.7
AWF08883.1\|27260_27959_+	repFIB replication protein A	J9Q7H0	Salmonella_phage	5.2e-54	55.7
AWF08755.1\|28675_29416_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
AWF08744.1\|30550_31507_+	diguanylate cyclase domain protein	G3MA91	Bacillus_virus	1.8e-12	30.6
AWF08764.1\|31533_31659_-	EAL domain protein	NA	NA	NA	NA
AWF08863.1\|31909_32833_+\|transposase	transposase DDE domain protein	Q9MCT5	Escherichia_phage	2.1e-175	98.4
AWF08868.1\|34982_35819_+	EAL domain protein	NA	NA	NA	NA
AWF08857.1\|36801_38079_-	hypothetical protein	NA	NA	NA	NA
AWF08884.1\|38141_40139_-\|holin	transporter, betaine/carnitine/choline transporter family protein	A0A2I7QNT1	Vibrio_phage	9.7e-21	25.9
AWF08847.1\|40290_40794_-\|transposase	putative transposase	U5P0U6	Shigella_phage	1.6e-84	93.2
AWF08785.1\|41178_41994_-	HTH-like domain protein	Q9ZXG3	Shigella_phage	1.5e-92	62.8
AWF08749.1\|42017_42413_-\|transposase	transposase family protein	Q76S41	Shigella_phage	1.4e-43	75.4
AWF08767.1\|42565_42961_+\|transposase	putative transposase	Q71TF0	Escherichia_phage	5.7e-66	92.4
AWF08791.1\|43114_43519_+\|transposase	transposase family protein	NA	NA	NA	NA
43068:43084	attR	NA	NA	NA	NA
AWF08913.1\|43814_44246_-	silver-binding protein SilE	NA	NA	NA	NA
AWF08812.1\|44496_45972_-	heavy metal sensor kinase family protein	W8CYF6	Bacillus_phage	1.0e-27	30.1

DBSCAN-SWA_2

65568 : 108756

Escherichia_phage(36.84%)

transposase,integrase

attL 59986:60002|attR 100551:100567

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
59986:60002	attL	NA	NA	NA	NA
AWF08732.1\|65568_65883_-\|transposase	transposase family protein	NA	NA	NA	NA
AWF08718.1\|66373_67189_-\|transposase	helix-turn-helix domain of transposase ISL3 family protein	A9YX10	Burkholderia_phage	1.7e-11	25.9
AWF08899.1\|67355_67760_+	major intrinsic family protein	NA	NA	NA	NA
AWF08845.1\|67809_68307_-	acetyltransferase family protein	NA	NA	NA	NA
AWF08911.1\|68638_68965_+	helix-turn-helix domain protein	NA	NA	NA	NA
AWF08818.1\|69231_69675_+	NADPH-dependent FMN reductase family protein	A0A2H4J5V6	uncultured_Caudovirales_phage	7.8e-64	78.9
AWF08804.1\|69683_70229_+	RNA polymerase sigma factor, sigma-70 family protein	NA	NA	NA	NA
AWF08846.1\|70304_70667_+	arsenical resistance operon trans-acting repressor ArsD family protein	NA	NA	NA	NA
AWF08786.1\|70691_72026_+	arsenical pump-driving ATPase	NA	NA	NA	NA
AWF08756.1\|72055_72442_+	anion-transporting ATPase family protein	NA	NA	NA	NA
AWF08811.1\|72563_73100_+	acetyltransferase domain protein	NA	NA	NA	NA
AWF08873.1\|73132_73558_-	arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	72.9
AWF08885.1\|73570_74860_-	arsenite/antimonite efflux pump membrane family protein	A0A2H4J144	uncultured_Caudovirales_phage	1.9e-171	74.0
AWF08844.1\|74907_76659_-	arsenical pump-driving ATPase	NA	NA	NA	NA
AWF08740.1\|76676_77039_-	arsenical resistance operon trans-acting repressor ArsD	NA	NA	NA	NA
AWF08862.1\|77088_77439_-	bacterial regulatory, arsR family protein	A0A2H4J145	uncultured_Caudovirales_phage	1.4e-23	50.9
AWF08810.1\|77796_78066_+	hypothetical protein	NA	NA	NA	NA
AWF08723.1\|78053_78629_+	putative ydeA	NA	NA	NA	NA
AWF08790.1\|78659_79154_+	hypothetical protein	NA	NA	NA	NA
AWF08783.1\|79599_79803_+	hemolysin expression-modulating protein Hha	NA	NA	NA	NA
AWF08768.1\|80184_80439_+	putative yaeB	NA	NA	NA	NA
AWF08870.1\|80722_80881_+	hypothetical protein	NA	NA	NA	NA
AWF08823.1\|81550_82909_+\|integrase	integrase core domain protein	NA	NA	NA	NA
AWF08897.1\|83409_84021_-\|integrase	integrase core domain protein	A0A2I6AZV9	Macacine_betaherpesvirus	4.0e-42	45.9
AWF08803.1\|84131_84437_-\|transposase	putative transposase	NA	NA	NA	NA
AWF08881.1\|84751_85714_-	peptidase M48 family protein	NA	NA	NA	NA
AWF08751.1\|85700_86135_-	phosphate-starvation-inducible E family protein	NA	NA	NA	NA
AWF08730.1\|86687_86885_-	hypothetical protein	NA	NA	NA	NA
AWF08882.1\|86884_89680_-	AAA domain protein	K4FB40	Cronobacter_phage	5.2e-129	41.0
AWF08906.1\|89794_90364_-	hsp20/alpha crystallin family protein	NA	NA	NA	NA
AWF08835.1\|90382_90520_+	hypothetical protein	NA	NA	NA	NA
AWF08903.1\|91652_91775_-	hypothetical protein	NA	NA	NA	NA
AWF08779.1\|91904_92408_+\|transposase	putative transposase	U5P0U6	Shigella_phage	1.8e-88	92.2
AWF08896.1\|92666_93647_+	hypothetical protein	Q38213	Escherichia_phage	8.9e-185	99.1
AWF08833.1\|94112_94748_-	hypothetical protein	Q38213	Escherichia_phage	1.2e-33	52.8
AWF08819.1\|94855_95722_-	lysR substrate binding domain protein	NA	NA	NA	NA
AWF08865.1\|95718_96729_-	phosphonate dehydrogenase	A0A1V0SBV6	Catovirus	1.4e-15	25.1
AWF08773.1\|96737_97565_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWF08781.1\|97573_98437_-	phosphate/phosphite/phosphonate ABC transporter, periplasmic binding family protein	NA	NA	NA	NA
AWF08834.1\|98433_99021_-	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.2e-14	38.9
AWF08893.1\|99602_99923_+	hypothetical protein	Q38213	Escherichia_phage	3.2e-27	52.9
AWF08742.1\|100116_100821_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.2e-138	99.6
100551:100567	attR	NA	NA	NA	NA
AWF08900.1\|100811_102077_+\|transposase	tn3 transposase DDE domain protein	A0A1B0V7H9	Salmonella_phage	5.4e-142	67.1
AWF08789.1\|102187_102793_+\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	6.4e-117	99.5
AWF08901.1\|102982_103798_-	phosphotransferase enzyme family protein	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
AWF08787.1\|103948_104653_+\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWF08861.1\|104774_105680_+	phosphotransferase enzyme family protein	NA	NA	NA	NA
AWF08821.1\|105676_106915_+	major Facilitator Superfamily protein	NA	NA	NA	NA
AWF08874.1\|106914_107499_+	erythromycin resistance repressor protein	NA	NA	NA	NA
AWF08797.1\|107991_108756_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	4.3e-86	65.7

DBSCAN-SWA_3

114175 : 169602

Stx2-converting_phage(23.81%)

integrase,transposase,bacteriocin

attL 105526:105542|attR 164544:164560

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
105526:105542	attL	NA	NA	NA	NA
AWF08872.1\|114175_115189_+\|integrase	integron integrase family protein	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AWF08802.1\|115541_115742_+	hypothetical protein	NA	NA	NA	NA
AWF08716.1\|115867_116428_+	resolvase, N terminal domain protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
AWF08792.1\|116430_119397_+	hypothetical protein	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6
AWF08866.1\|119463_119841_+	acetyltransferase family protein	NA	NA	NA	NA
AWF08763.1\|120041_120701_-	chloramphenicol acetyltransferase	G3CFL0	Escherichia_phage	8.4e-131	100.0
AWF08806.1\|121173_121677_+\|transposase	putative transposase	Q71TF0	Escherichia_phage	1.5e-95	100.0
AWF08895.1\|121917_123297_+	4Fe-4S single cluster domain protein	S5VT21	Leptospira_phage	2.4e-50	28.8
AWF08850.1\|123289_124402_+	4Fe-4S single cluster domain protein	S5WIP3	Leptospira_phage	1.5e-47	33.8
AWF08734.1\|125964_126312_+\|transposase	putative transposase	A0A0P0ZDM8	Stx2-converting_phage	2.0e-59	95.7
AWF08840.1\|126361_127336_+\|transposase	transposase IS66 family protein	A0A0P0ZBS5	Stx2-converting_phage	2.7e-149	91.8
AWF08880.1\|127380_127899_+\|transposase	putative transposase	A0A0P0ZEB3	Stx2-converting_phage	1.7e-86	90.1
AWF08886.1\|127966_128314_+\|transposase	putative transposase	A0A0P0ZEB3	Stx2-converting_phage	2.6e-62	98.3
AWF08774.1\|130134_131868_-	nickel import ATP-binding protein NikE	G9BWD6	Planktothrix_phage	6.9e-15	29.6
AWF08757.1\|131875_132823_-	acetamidase/Formamidase family protein	A0A1V0S8X7	Catovirus	9.6e-11	22.7
AWF08831.1\|132867_134472_-	bacterial extracellular solute-binding, 5 Middle family protein	NA	NA	NA	NA
AWF08750.1\|134484_135405_-	binding-protein-dependent transport system inner membrane component family protein	NA	NA	NA	NA
AWF08726.1\|135404_136253_-	N-terminal TM domain of oligopeptide transport permease C family protein	NA	NA	NA	NA
AWF08801.1\|136249_136843_-	response regulator	NA	NA	NA	NA
AWF08822.1\|136839_137967_-	periplasmic binding family protein	NA	NA	NA	NA
AWF08782.1\|138251_138419_-\|integrase	putative integrase catalytic region	NA	NA	NA	NA
AWF08722.1\|138677_139046_+	putative tnpA	U5N3F9	Enterobacteria_phage	2.4e-58	89.9
AWF08720.1\|139521_140043_+	putative RNA polymerase sigma factor FecI	NA	NA	NA	NA
AWF08775.1\|140039_140993_+	fecR family protein	NA	NA	NA	NA
AWF08784.1\|141078_143403_+	fe(3+) dicitrate transport protein FecA	NA	NA	NA	NA
AWF08836.1\|143447_144350_+	periplasmic binding family protein	NA	NA	NA	NA
AWF08738.1\|144346_145345_+	ABC 3 transport family protein	NA	NA	NA	NA
AWF08729.1\|145341_146298_+	fe(3+) dicitrate transport system permease protein FecD	NA	NA	NA	NA
AWF08815.1\|146298_147066_+	ABC transporter family protein	G3M9Y6	Bacillus_virus	9.8e-14	25.2
AWF08871.1\|147164_147458_+\|transposase	putative transposase	A0A0P0ZDM8	Stx2-converting_phage	2.7e-49	96.9
AWF08825.1\|147505_147625_-	hypothetical protein	NA	NA	NA	NA
AWF08910.1\|147788_147914_-	EAL domain protein	NA	NA	NA	NA
AWF08820.1\|148409_149420_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
AWF08839.1\|149442_149658_-	hypothetical protein	NA	NA	NA	NA
AWF08838.1\|149880_150963_+	periplasmic binding and sugar binding domain of LacI family protein	C6ZCU4	Enterobacteria_phage	6.8e-186	96.4
AWF08816.1\|151084_154159_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.7
AWF08860.1\|154210_155464_+	lactose permease	NA	NA	NA	NA
AWF08891.1\|155600_156212_+\|transposase	transposase DDE domain protein	Q9MCT5	Escherichia_phage	3.5e-99	99.4
AWF08793.1\|156315_156525_+\|transposase	transposase family protein	Q9MCT5	Escherichia_phage	4.1e-31	98.6
AWF08830.1\|157169_159479_+	tellurite resistance TerB family protein	NA	NA	NA	NA
AWF08898.1\|159482_160799_+	hypothetical protein	NA	NA	NA	NA
AWF08762.1\|160795_162991_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
AWF08843.1\|164437_165295_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
164544:164560	attR	NA	NA	NA	NA
AWF08747.1\|166180_166561_-	endonuclease	A0A1B2LRT6	Wolbachia_phage	5.2e-16	37.9
AWF08745.1\|167280_169602_-\|bacteriocin	DNase/tRNase domain of colicin-like bacteriocin family protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP029100

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7580 : 18567

Escherichia_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF08701.1\|7580_8114_-\|transposase	tn3 transposase DDE domain protein	Q1MVP5	Enterobacteria_phage	3.5e-95	100.0
AWF08704.1\|8269_11287_+	hypothetical protein	A0A125RQ78	Bacillus_phage	5.5e-52	24.7
AWF08715.1\|11273_11855_-	hypothetical protein	A0A077SLJ7	Escherichia_phage	8.3e-82	98.2
AWF08688.1\|11851_12484_-	hypothetical protein	A0A077SLJ7	Escherichia_phage	8.5e-96	98.9
AWF08713.1\|12495_13398_-	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain protein	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AWF08692.1\|13659_14421_+	HTH domain protein	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AWF08703.1\|14441_15302_-	beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AWF08685.1\|15438_16143_+\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AWF08684.1\|16511_16751_+	hypothetical protein	NA	NA	NA	NA
AWF08698.1\|16861_17524_-	resolvase, N terminal domain protein	M9Q1K0	Clostridium_phage	9.7e-10	29.1
AWF08697.1\|17904_18567_+	cobQ/CobB/MinD/ParA nucleotide binding domain protein	E5FFJ3	Burkholderia_phage	2.6e-07	25.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP029102

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21104 : 33196

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF08920.1\|21104_21734_-	DNA methylase family protein	A0A2I7RE86	Vibrio_phage	1.5e-20	36.0
AWF09038.1\|22242_22410_-	putative membrane protein	NA	NA	NA	NA
AWF09028.1\|22533_23205_-	plasmid stability family protein	NA	NA	NA	NA
AWF09003.1\|23207_24182_-	plasmid segregation protein ParM	A0A222YXF2	Escherichia_phage	1.4e-73	46.8
AWF09015.1\|24410_24842_+	protein UmuD	A0A1W6JNS2	Morganella_phage	1.0e-28	52.5
AWF08954.1\|24841_26113_+	IMS HHH motif family protein	F1C5A5	Cronobacter_phage	3.6e-154	63.7
AWF09020.1\|26513_27410_+	replication protein RepA	Q71TL8	Escherichia_phage	3.3e-69	53.8
AWF09048.1\|27794_28937_+	plasmid partition protein A	Q1MVJ3	Enterobacteria_phage	7.6e-196	90.0
AWF09009.1\|28933_29908_+	parB	Q1MVJ4	Enterobacteria_phage	1.4e-105	62.3
AWF08939.1\|31168_33196_+	hsdM N-terminal domain protein	A0A220A2U5	Liberibacter_phage	2.1e-26	26.6

DBSCAN-SWA_2

37771 : 109307

Escherichia_phage(29.03%)

transposase,holin,integrase

attL 51093:51152|attR 105935:106372

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWF08982.1\|37771_39040_+\|transposase	helix-turn-helix domain of transposase ISL3 family protein	Q6V7R1	Burkholderia_virus	5.2e-60	34.7
AWF08941.1\|40345_40462_-	hypothetical protein	NA	NA	NA	NA
AWF09006.1\|40846_41629_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	4.6e-51	90.2
AWF08972.1\|41628_41961_-	hypothetical protein	NA	NA	NA	NA
AWF09050.1\|41967_42324_-	hypothetical protein	NA	NA	NA	NA
AWF09041.1\|42391_42670_-	hypothetical protein	NA	NA	NA	NA
AWF08928.1\|42748_43021_-	hypothetical protein	NA	NA	NA	NA
AWF09010.1\|43102_43222_-	hypothetical protein	NA	NA	NA	NA
AWF09022.1\|43543_43978_-	hypothetical protein	NA	NA	NA	NA
AWF08944.1\|43961_44192_+	antidote-toxin recognition MazE family protein	NA	NA	NA	NA
AWF09057.1\|44188_44605_+	PIN domain protein	NA	NA	NA	NA
AWF08971.1\|44699_45389_+	AAA domain protein	NA	NA	NA	NA
AWF08929.1\|45473_45698_+	insA N-terminal domain protein	A0A2L1IV22	Escherichia_phage	1.7e-35	94.6
AWF08947.1\|45742_46120_+\|transposase	putative transposase	Q71TF0	Escherichia_phage	1.9e-63	93.6
AWF08938.1\|46281_46704_+	merC mercury resistance family protein	NA	NA	NA	NA
AWF08965.1\|46755_48450_+	mercuric reductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
AWF09054.1\|48467_48830_+	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AWF08932.1\|48826_49063_+	merE family protein	NA	NA	NA	NA
AWF08977.1\|49059_49767_+	EAL domain protein	NA	NA	NA	NA
AWF09031.1\|50057_51110_+\|integrase	integrase core domain protein	NA	NA	NA	NA
51093:51152	attL	NA	NA	NA	NA
AWF09017.1\|51156_51567_+\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.9e-72	100.0
AWF08990.1\|51677_52538_-	beta-lactamase TEM	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
AWF08970.1\|52720_52843_-	helix-turn-helix domain of resolvase family protein	Q1MVP4	Enterobacteria_phage	1.0e-13	97.5
AWF09030.1\|53726_54077_-	beta-lactamase OXA-18 domain protein	NA	NA	NA	NA
AWF09027.1\|54281_54986_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWF09032.1\|55058_57956_+	hypothetical protein	A0A1B0V7H9	Salmonella_phage	2.7e-181	37.7
AWF08921.1\|58044_58665_+	resolvase, N terminal domain protein	A0A219Y912	Aeromonas_phage	2.0e-09	31.5
AWF08961.1\|58814_59174_+	putative membrane protein	NA	NA	NA	NA
AWF09036.1\|59463_59598_-	hypothetical protein	NA	NA	NA	NA
AWF08981.1\|59830_60190_-	hypothetical protein	A0A218MND9	uncultured_virus	3.6e-19	62.0
AWF09044.1\|60361_60583_-\|transposase	putative transposase	A0A1V0E8E1	Vibrio_phage	2.4e-13	64.3
AWF08986.1\|60693_61908_+	DDE_Tnp_1-associated family protein	NA	NA	NA	NA
AWF08968.1\|62153_63473_+	hypothetical protein	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AWF08955.1\|63722_64604_-	carbapenem-hydrolyzing beta-lactamase Sme-1	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
AWF08959.1\|64891_65671_-	phoH-like family protein	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
AWF09008.1\|65667_66672_-\|integrase	integrase core domain protein	A0A2L1IVA1	Escherichia_phage	8.7e-87	50.8
AWF09023.1\|66799_69775_-	hypothetical protein	NA	NA	NA	NA
AWF08964.1\|69938_71654_+\|integrase	phage integrase family protein	NA	NA	NA	NA
AWF08930.1\|71948_72104_+	hypothetical protein	NA	NA	NA	NA
AWF09002.1\|72152_73145_+\|holin	choline kinase N terminus family protein	NA	NA	NA	NA
AWF09037.1\|73171_73333_+\|transposase	putative transposase	NA	NA	NA	NA
AWF08992.1\|73664_78926_+	conjugative transfer relaxase protein TraI	NA	NA	NA	NA
AWF08953.1\|79006_79732_+	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	7.1e-06	28.8
AWF09039.1\|79803_80397_+	fertility inhibition protein	NA	NA	NA	NA
AWF09043.1\|80563_81160_+	hypothetical protein	NA	NA	NA	NA
AWF08963.1\|81209_81854_+	hypothetical protein	NA	NA	NA	NA
AWF08975.1\|82260_82560_+	hypothetical protein	NA	NA	NA	NA
AWF08996.1\|82556_82865_+	hypothetical protein	K7PKY8	Enterobacterial_phage	1.1e-08	31.7
AWF08922.1\|83040_83520_+	endonuclease	A0A1B2LRT6	Wolbachia_phage	2.7e-17	31.7
AWF08976.1\|83784_83907_+	replication regulatory RepB family protein	NA	NA	NA	NA
AWF08948.1\|84208_85066_+	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
AWF08958.1\|86284_86848_+	proQ/FINO family protein	NA	NA	NA	NA
AWF08991.1\|86831_87443_+	hypothetical protein	NA	NA	NA	NA
AWF08925.1\|87651_87813_-\|transposase	putative transposase	NA	NA	NA	NA
AWF09052.1\|87839_88832_-\|holin	choline kinase N terminus family protein	NA	NA	NA	NA
AWF08997.1\|88880_89036_-	hypothetical protein	NA	NA	NA	NA
AWF08984.1\|89330_91046_-\|integrase	phage integrase family protein	NA	NA	NA	NA
AWF08983.1\|91209_94185_+	hypothetical protein	NA	NA	NA	NA
AWF09046.1\|94312_95317_+\|integrase	integrase core domain protein	A0A2L1IVA1	Escherichia_phage	8.7e-87	50.8
AWF09058.1\|95313_96093_+	phoH-like family protein	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
AWF09040.1\|96380_97262_+	carbapenem-hydrolyzing beta-lactamase Sme-1	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
AWF08926.1\|97511_98831_-	hypothetical protein	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AWF08966.1\|99433_100291_-	DDE_Tnp_1-associated family protein	NA	NA	NA	NA
AWF09049.1\|100401_100623_+\|transposase	putative transposase	A0A1V0E8E1	Vibrio_phage	2.4e-13	64.3
AWF08919.1\|100794_101154_+	hypothetical protein	A0A218MND9	uncultured_virus	3.6e-19	62.0
AWF09004.1\|101386_101521_+	hypothetical protein	NA	NA	NA	NA
AWF09047.1\|101810_102170_-	putative membrane protein	NA	NA	NA	NA
AWF08940.1\|102319_102940_-	resolvase, N terminal domain protein	A0A219Y912	Aeromonas_phage	2.0e-09	31.5
AWF09025.1\|103028_105926_-	hypothetical protein	A0A1B0V7H9	Salmonella_phage	2.7e-181	37.7
AWF08957.1\|105998_106703_+\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
105935:106372	attR	NA	NA	NA	NA
AWF08989.1\|106907_107258_+	beta-lactamase OXA-18 domain protein	NA	NA	NA	NA
AWF08973.1\|108141_108264_+	helix-turn-helix domain of resolvase family protein	Q1MVP4	Enterobacteria_phage	1.0e-13	97.5
AWF08931.1\|108446_109307_+	beta-lactamase TEM	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP029099

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP029101

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP029100

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP029102

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection