CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP029358	Azospirillum thiophilum strain CFH 70021 plasmid unnamed3	1 crisprs	csa3,WYL	10	1
CP029359	Azospirillum thiophilum strain CFH 70021 plasmid unnamed4	0 crisprs	NA	0	2
CP029360	Azospirillum thiophilum strain CFH 70021 plasmid unnamed5	0 crisprs	NA	0	1
CP029356	Azospirillum thiophilum strain CFH 70021 plasmid unnamed1	3 crisprs	csa3,RT,cas9,cas1,cas2	36	0
CP029352	Azospirillum thiophilum strain CFH 70021 chromosome 1, complete sequence	0 crisprs	cas7,cas8u1,cas3,RT,cas8e,cse2gr11,cas5,cas6e,cas1,cas2,csa3	0	3
CP029357	Azospirillum thiophilum strain CFH 70021 plasmid unnamed2	0 crisprs	csa3,RT	0	0
CP029355	Azospirillum thiophilum strain CFH 70021 chromosome 4, complete sequence	1 crisprs	NA	6	0
CP029353	Azospirillum thiophilum strain CFH 70021 chromosome 2, complete sequence	0 crisprs	DEDDh,RT,csa3,cas3,DinG	0	0
CP029354	Azospirillum thiophilum strain CFH 70021 chromosome 3, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029358_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029358_1

328246-328650

Orphan

Consensus_repeat	Method
GCTTCAATGAGGCCTGGGCATTACTGCCCAG--------GAAGAC	PILER-CR
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCG	CRISPRCasFinder
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	CRT

5 spacers

The CRISPR arrays of CP029358_1

>merge|CP029358|1|328246-328650|PILER-CR,CRISPRCasFinder,CRT
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCCGGTGATGCTGAGTTCGGCCTTGACCGTCGCCAGTGGTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCCTGGTCGATGGTCCTCATGTCCGGACGCTCCGGCCGGTCTTCCTGGGCAGTAATGCTCAGGCCTCATTGAAGCGGGAAGTCCCAGCCCTTCATCCACATCAGCAGCGCAAGTCTTCCTGGGCAGTAATGCCAAGGCCTCATTGAAGCAAGAGCCATCGCTAGGCGTATGTGAAGGTGTGCTCGTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCGTCGAGGCGGCCGTCCAGTCGCTCTGCCGGCGCCTCTGGTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCG

>CP029358|1|1|328246-328649|PILER-CR
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	CGGTGATGCTGAGTTCGGCCTTGACCGTCGCCAGTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	CTGGTCGATGGTCCTCATGTCCGGACGCTCCGGCCG
GTCTTCCTGGGCAGTAATGCTCAGGCCTCATTGAAGC	GGGAAGTCCCAGCCCTTCATCCACATCAGCAGCGCAA
GTCTTCCTGGGCAGTAATGCCAAGGCCTCATTGAAGC	AAGAGCCATCGCTAGGCGTATGTGAAGGTGTGCTC
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	GTCGAGGCGGCCGTCCAGTCGCTCTGCCGGCGCCTCTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC

>CP029358|1|1|328246-328650|CRISPRCasFinder
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCC	GGTGATGCTGAGTTCGGCCTTGACCGTCGCCAGTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCC	TGGTCGATGGTCCTCATGTCCGGACGCTCCGGCCG
GTCTTCCTGGGCAGTAATGCTCAGGCCTCATTGAAGCG	GGAAGTCCCAGCCCTTCATCCACATCAGCAGCGCAA
GTCTTCCTGGGCAGTAATGCCAAGGCCTCATTGAAGCA	AGAGCCATCGCTAGGCGTATGTGAAGGTGTGCTC
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCG	TCGAGGCGGCCGTCCAGTCGCTCTGCCGGCGCCTCTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGCG

>CP029358|1|1|328246-328649|CRT
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	CGGTGATGCTGAGTTCGGCCTTGACCGTCGCCAGTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	CTGGTCGATGGTCCTCATGTCCGGACGCTCCGGCCG
GTCTTCCTGGGCAGTAATGCTCAGGCCTCATTGAAGC	GGGAAGTCCCAGCCCTTCATCCACATCAGCAGCGCAA
GTCTTCCTGGGCAGTAATGCCAAGGCCTCATTGAAGC	AAGAGCCATCGCTAGGCGTATGTGAAGGTGTGCTC
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	GTCGAGGCGGCCGTCCAGTCGCTCTGCCGGCGCCTCTG
GTCTTCCTGGGCAGTAATGCCCAGGCCTCATTGAAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP029358.1\|AWK90072.1\|326960_327629_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
CP029358.1\|AWK90069.1\|322183_325150_-\|chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
CP029358.1\|AWK90071.1\|326195_326909_-\|hydrolase	unknown	unknown	gnl\|CDD\|375542
CP029358.1\|AWK90064.1\|311454_311889_+\|hypothetical-protein	unknown	unknown	unknown
CP029358.1\|AWK90067.1\|316962_319353_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379882
CP029358.1\|AWK90066.1\|315530_316403_+\|RNA-polymerase-sigma-factor-RpoH	unknown	unknown	gnl\|CDD\|235838
CP029358.1\|AWK90074.1\|331865_332402_+\|hypothetical-protein	unknown	unknown	unknown
CP029358.1\|AWK90073.1\|330360_331869_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|143587
CP029358.1\|AWK90065.1\|311994_315408_+\|transcription-repair-coupling-factor	unknown	unknown	gnl\|CDD\|224118
CP029358.1\|AWK90157.1\|319921_320329_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
CP029358.1\|AWK90080.1\|340115_340721_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377423
CP029358.1\|AWK90068.1\|320455_322141_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365897
CP029358.1\|AWK90078.1\|337741_339529_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|226646
CP029358.1\|AWK90076.1\|334842_336126_-\|alpha-glucosidase/alpha-galactosidase	unknown	unknown	gnl\|CDD\|133433
CP029358.1\|AWK90081.1\|340847_341201_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377825
CP029358.1\|AWK90079.1\|339566_340046_-\|flavodoxin	unknown	unknown	gnl\|CDD\|223728
CP029358.1\|AWK90070.1\|325514_325994_-\|ArsR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
CP029358.1\|AWK90158.1\|329067_330354_+\|cytoplasmic-protein	unknown	unknown	gnl\|CDD\|225755
CP029358.1\|AWK90077.1\|336315_337650_+\|beta-glucosidase	unknown	unknown	gnl\|CDD\|274539
CP029358.1\|AWK90075.1\|332408_334445_-\|NAD(+)-synthase	unknown	unknown	gnl\|CDD\|235057

Protein	Function_ID	Function_description	E-value
CP029358.1\|AWK90072.1\|326960_327629_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.35735e-07
CP029358.1\|AWK90069.1\|322183_325150_-\|chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.93661e-41
CP029358.1\|AWK90071.1\|326195_326909_-\|hydrolase	gnl\|CDD\|375542	pfam18089, DAPG_hydrolase, DAPG hydrolase PhiG domain. This domain is found in 2,4-diacetylphloroglucinol hydrolase PhiG present in Pseudomonas fluorescens. 2,4-diacetylphloroglucinol hydrolase is the gene product of PhiG that is responsible for cleaving toxic 2,4-diacetylphloroglucinol (DAPG). The small N-terminal region of the domain is involved in dimerization through hydrogen bonding of the dimer interface. The C-terminal catalytic region resembles the tetracenomycin aromatase/cyclase and has a Bet v1-like fold. DAPG PhiG is the first discovered hydrolase whose catalytic domain belongs to the Bet v1-like fold, rather than the classical alpha/beta-fold hydrolases.	1.02191e-48
CP029358.1\|AWK90067.1\|316962_319353_-\|hypothetical-protein	gnl\|CDD\|379882	pfam16841, CBM60, Ca-dependent carbohydrate-binding module xylan-binding. CBM60 is a family of xylan-binding modules found in conjunction with xylanase enzymes in many bacterial species that attack plant cell walls. Xylan is the major hemicellulose component of most plant cell walls, and is one of the most complex carbohydrates targeted by CBMs. CBM60 modules are evolutionarily related to CBM36 domains as both show circular permutation in the beta-barrel folds. CBM60 targets xylan but is also able to bind cellulose and galactan and thus contribute towards breakdown of the plant cell wall. Recognition of the ligand is conferred primarily through the polar interactions of O2 (oxygen) and O3 of a single sugar with a protein-bound calcium ion.	2.49116e-27
CP029358.1\|AWK90066.1\|315530_316403_+\|RNA-polymerase-sigma-factor-RpoH	gnl\|CDD\|235838	PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed.	7.82698e-153
CP029358.1\|AWK90073.1\|330360_331869_+\|hypothetical-protein	gnl\|CDD\|143587	cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes. This superfamily (also known as the C-N hydrolase superfamily) contains hydrolases that break carbon-nitrogen bonds; it includes nitrilases, cyanide dihydratases, aliphatic amidases, N-terminal amidases, beta-ureidopropionases, biotinidases, pantotheinase, N-carbamyl-D-amino acid amidohydrolases, the glutaminase domain of glutamine-dependent NAD+ synthetase, apolipoprotein N-acyltransferases, and N-carbamoylputrescine amidohydrolases, among others. These enzymes depend on a Glu-Lys-Cys catalytic triad, and work through a thiol acylenzyme intermediate. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. These oligomers include dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers, as well as variable length helical arrangements and homo-oligomeric spirals. These proteins have roles in vitamin and co-enzyme metabolism, in detoxifying small molecules, in the synthesis of signaling molecules, and in the post-translational modification of proteins. They are used industrially, as biocatalysts in the fine chemical and pharmaceutical industry, in cyanide remediation, and in the treatment of toxic effluent. This superfamily has been classified previously in the literature, based on global and structure-based sequence analysis, into thirteen different enzyme classes (referred to as 1-13). This hierarchy includes those thirteen classes and a few additional subfamilies. A putative distant relative, the plasmid-borne TraB family, has not been included in the hierarchy.	4.07389e-11
CP029358.1\|AWK90065.1\|311994_315408_+\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
CP029358.1\|AWK90157.1\|319921_320329_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	3.47898e-29
CP029358.1\|AWK90080.1\|340115_340721_-\|hypothetical-protein	gnl\|CDD\|377423	pfam04940, BLUF, Sensors of blue-light using FAD. The BLUF domain has been shown to bind FAD in the AppA protein. AppA is involved in the repression of photosynthesis genes in response to blue-light.	8.31746e-30
CP029358.1\|AWK90068.1\|320455_322141_+\|hypothetical-protein	gnl\|CDD\|365897	pfam00135, COesterase, Carboxylesterase family.	7.26258e-119
CP029358.1\|AWK90078.1\|337741_339529_+\|ABC-transporter	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	8.59938e-167
CP029358.1\|AWK90076.1\|334842_336126_-\|alpha-glucosidase/alpha-galactosidase	gnl\|CDD\|133433	cd05297, GH4_alpha_glucosidase_galactosidase, Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. Glucosidases cleave glycosidic bonds to release glucose from oligosaccharides. Alpha-glucosidases and alpha-galactosidases release alpha-D-glucose and alpha-D-galactose, respectively, via the hydrolysis of alpha-glycopyranoside bonds. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the alpha-glucosidases. Other organsisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. Alpha-glucosidases and alpha-galactosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	4.41219e-161
CP029358.1\|AWK90081.1\|340847_341201_-\|hypothetical-protein	gnl\|CDD\|377825	pfam07369, DUF1488, Protein of unknown function (DUF1488). This family consists of several hypothetical bacterial proteins of around 85 residues in length. The function of this family is unknown.	1.10218e-06
CP029358.1\|AWK90079.1\|339566_340046_-\|flavodoxin	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	1.7035e-10
CP029358.1\|AWK90070.1\|325514_325994_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	9.28935e-61
CP029358.1\|AWK90158.1\|329067_330354_+\|cytoplasmic-protein	gnl\|CDD\|225755	COG3214, COG3214, Uncharacterized protein conserved in bacteria [Function unknown].	7.79458e-144
CP029358.1\|AWK90077.1\|336315_337650_+\|beta-glucosidase	gnl\|CDD\|274539	TIGR03356, BGL, beta-galactosidase.	0
CP029358.1\|AWK90075.1\|332408_334445_-\|NAD(+)-synthase	gnl\|CDD\|235057	PRK02628, nadE, NAD synthetase; Reviewed.	0

>CP029358.1|AWK90072.1|326960_327629_+|TetR/AcrR-family-transcriptional-regulator
MPGWEICQREISVSDSAHKVQKPRGRPPLSEDVLRGKVAEAATRVILAHGYPAMTMEAVAQQAGVAKKTVYRFAANRDELVGLIVGSWTEALPPAFDAEATDAAEAVRILENILVLIAERVLTADAVGLFRLLVNDLPARDDVLAIYGRNGIERSRGMLADWLARHRSRGVLALADPAMAADLILSMVVAEPLRRIAIGISQPQPAWDIRPRVRAALDLLRL
>CP029358.1|AWK90071.1|326195_326909_-|hydrolase
MTANATLSQDPARAGIAYVDDLLRPAPMRLETGISRLDGGALVVAVRTDLHGCKGRMLDWWFKQFDSSQHLHWWHPLDHVEHRGWDRHWRKGEAYVGATIRAVEALGDIPPVSAVIKFHEPAEIFDPQAYREALAAGQVSAAVYARIGFGDDVVLDADGDPTDGQMVHVVRDTSYGAVLRSRFILGQSTRATGHEVPDAIGLGLLQHCHTEFSYLAKVLPSLYWGDKANREDVPLLW
>CP029358.1|AWK90070.1|325514_325994_-|ArsR-family-transcriptional-regulator
MDRALDSTDLKILRELQEDGRISNVELARRINLSPAACLERVKRLQNDGIIQRYVALLDPQRLGAGMMVFIQVVLDRTTPENFDAFKGTVQRMPQVMECHMVAGGFDYLVKARVRDMNEYRLFLGEFLATTRGVRETHTYAVMEEVKNVTAIPLDQIAR
>CP029358.1|AWK90069.1|322183_325150_-|chemotaxis-protein
MRVNEPITNIEVELKEGVPLVSRTDSHGRITFVNKAFVEISGFSEDELMGAPHNIVRHPHMPKEAFANLWVTVKAGRPWDGLVKNRTKDGNFYWVRANVTPIIENGAVVGYTSIRSKPTREEIAGAEAAYAAIREGRGRGLGLRDGGLIRTGAAARLRDWANSVAGRLTSLVVTLILITALASGAGLMGMTDSNKALKTVYEDRTVPAAQMGDILDLMRDNVHQMTLLVIDTRDGSGPQAVEDRVRRVTGNIQRIDTVWAEYLLTYLTPEEKQLADQFQARRSAFVREALLPALEMAKAGDSLRLETHLRKTVLPLFEGAFAVNRELLALQIRVAKQEYDEAAEDLLWHTGGILGAVGAGALAAAAMGLLILRAMRRPLRRMEESFERIARNDFVTPVPDMEVKEFWRLGSELRSMKAKIAYGLQEKKELDTRREEITRIALLETCKAIESDLDATWIGVEQSAQRAGDGIGHLMEALSVVRQNTVVVSAASEQASANASSVAAATEELNAAGSEIARQAVRSSEVARRAVTSARESADAIQRMETATEEIGKVAGLIAEIAGQTNLLALNATIEAARAGEAGKGFAVVAGEVKSLAGQTARATGDIATQIAQLQQAVNGSVSAIQTVIRVIEEIDEAAAATAAAVEEQAAANAEIGRSAANSAGGASQVSLSVLEIRDQTDGINGIATDVSRRMNDTRRSVMDLKRRLVIALRQSVAGDRRTSDRIPCEIPVSLTVEGRICSTTMLDLSLDGMLVDPAGLPALAEQTRVSVTLREVGEIPCMVAGVSDLGLHLAFGVHDGPITARLEAFYRKLVDGDARFIDKAKEVAAATARLLEEALRRGEITEEALFTTTLETIPGSDPEQFRAPFTDLADSRFPALFEPVLEFDPRIQFCVATNSIGYVPTHNARYSQPQRPGDTAWNTANCRNRRVFADRAGLAAARNTRPFLLQAYRRDMGGGQMVRLKEVDAPIMVRGRQWGGLRLAFKA
>CP029358.1|AWK90068.1|320455_322141_+|hypothetical-protein
MRRTATRRAAARFAVTLPAAALGIGLLAAGPAAPAKAAAEGCVESEGIVCTDAGPVRGTLEGGTLAFKGIPYARPPVGPLRWRPPAAPEPWMEVRDASRYGEVCPQLTGSGQPVGDEDCLTVNVWKPAAPASTAAATAATAATAAEQRPVMVWFTGGGNHSLSGQGSAQYGGVSYDGRALAERAGVVFVSFNYRLGALGFLTHPALGAEGPEKVSGNYGTQDQIALLGWVRRNIARFGGDPQRVMLFGTSAGGANICALMTAPAAAGLFQAAAMHSSVPTGCELPTLKEAEASTGARVAAALGCEGGEAGACLRGKSMAEVVRAVPGTFGVFPRLYGPVVDGRVLPGQPIARIRAGRHQPVPVLLGNSAEETMQFVDAAGPVTDGASYAAAVEKVFGSAARDRILARYPESAYPSARRAFVQATTDALFTCRTLAVARTLAAHQKEPVFRSLFAHPLENDPALKALGINHTIEHPFFFAWSGSYRPTAADRAVQAVMLDGWSNLARAGNPNGGAMPPWPAVTPANPGARLLIGPAGAAADPGTDLEICRFWEGIRLPRPHL
>CP029358.1|AWK90157.1|319921_320329_+|acyl-CoA-thioesterase
MQRLIRFSHTDPAGIVYFPVYFDMFNGVVEDWFTHALGLNYASMILDRRLGLPIVHAECDFLVPSRMGETLTMGVVIERLGRSSLQIRINGEIGDQVRLSGGLTMVTTSLDAFGPVPIPDDIRAAMEAYDAACRA
>CP029358.1|AWK90067.1|316962_319353_-|hypothetical-protein
MATSTKIVINAKGTVAGGKYAHFKVLLDGKQIGEATVGSTAKDYVFTTSATNAAHKIQIQYDNDALINGQDRNLTVNKVTLNGHAYDPASSAMSYDKGALDGRDVVAGKATLAWNGTLVLNAPASDFAGTAPTPTPTPTQPSNPPVSGNPTPPVPVSGPAFYVATNGNDKWSGKLAAPNADGTDGPFATLQKAQLAMRSSDIDTTYVRGGDYYLQHGLWLDGQDSGVRFAAYGSEKPVIHGGTAVTNWVSRGDGLWSAQLPAGTKVYDLTMDGTRQTLARTPNEVPGNPIEGGWMTAGPTKAGLNPTSQFTVQGDLPHFSTTSGLKVAMFGQHGYDSFDANVKSIDYANKVVTLESGSWDKLGEGSRFYFYNTKDQLNAAKEWAYDGNSGQLLFKPEGGSPVGHKVVVGNVPVTIGLGGAKNVTIEGLTLADGQPNGHAVYAVDAANLTFKNNMVKNTGYGVTVERGPGAKITGNTFDHTGREAIFLKDHSDKGVISDNLIKYASDARHGGDSLWVTGSSDVQITHNQIENSPGKAIAVGSVYGASDATYRNTIAYNKVINANQETADGGGIYLINRQQDNAGHIVQNNEVTGTSAAGKNTWDGKAHADFLPASKLVSWGIYLDDWTSGTTVKGNYVHGNEGGGVFLHGGWNNTVTDNLIAGNQGTQIGLQQDVGWSGWKGTPMSNNRIYDNVIDGQTGDAVSLNGPKGAGSFYSNDYVNLIASDRAFEAWPQSMKSGAEGTFSDWKGAGYDTDSLVVNGVFKNAAAGNYEIASGSSVYQHGFDHLPLDQMGLLHG
>CP029358.1|AWK90066.1|315530_316403_+|RNA-polymerase-sigma-factor-RpoH
MSTALALPSPDSGEGLASYIQQTHRYPILGAEEEYMLAKAWAEHGDVKAAHALVTSHLRLVVKIAAGYRGYGLSFSDLIAEGNVGLMQAVKKFEPDRGFRLSTYAMWWIKASIQEFILRSWSLVKIGTTGAQKKLFFSLGRLKRRLGELGNGDMKAENVARIAAELEVPEDDVVDMNRRLSQPVASLNAPLSADGEAEWQDLLADERPTVEDVLVERSEAGRRAALLHKAMDVLNERERTILTARRLSETPLTLEDLSVRFGVSRERIRQIEERAFEKVARQAQLLAAAA
>CP029358.1|AWK90065.1|311994_315408_+|transcription-repair-coupling-factor
MPDASPSQFPLAVPSEGALGLRLTGLARRLPGGLLFLARSDSRASRLARLARDLAPDLQVVLLPIDESAPGDRAAPSRAILGRRAAGLAALAEPPPPGGRLVLASADLALQRLPPPEAWRGSGFRIARGMAFDEAAWRAYFASTGYVLDERVDEPGEAAIRGAVVEVFPGHCDQPIRCDIAQGVVEDIRLYDPVSQRSIATIEEVTLHPVTEIVTDAATLDRLFATLAALGCALPPDLRRRLEEGRRPYAFDLQVPNAFDRCVLLPDYLPDAALLLDAGARDRIEARDEQLAEACPEAHHDRLSRRGDAGLLPVPSPERRMIGRAALDALLAARTVLTVETAEPATPAKPAKPDDGAPEAPRTERTLLRRTAALVEEGARVLIAAAGRPEAERLAGLAARALDRPVPVLDRWPDGADPGSCAVLPLRVAEPFVADGITVLTSPRRPARDAGAARPPLAPSELSPGDFAVHLDYGIGRLVGLEAVERGDQTADFLVLEYAHEDRLLVPAADMDRVWRYGSADSGARLDSLKSGAWQERRQALEQEIGETARGLIHAARRRAREAAPAIEPPADRMRRFNARFGFDLTDGQARATAAVLQAMRTGSPMDHLLCADVGYGKTEVALRAAAAVAFCGHQVAVMAPTSILARQHLDLFRRRFAGFGLRVEPLTGAMTGADAGRVRAGLADGSVHIVVGTHALLSRQVGFHALGLMVVDEEQRFGARQKQLLRQRTRGVHCLALSATPIPRTLQGALAGLRGLSVIDTPPARRRPVRTTVAPLDPGTARAALLRERARGGQTFCVTPRIADLKALEGWIRGLMPDARIAVAHGRMAEADLDDAMMGFVEGESDVLVATPIIESGIDIPRANTLLLFRPDLFGLGQLHQLRGRVGRAAAQGYAYLFVDPGHPLDERAARRLGSLEVIESLGGGFVLSMLDLDQRGAGDLLGEDQTGHLRAVGTELYQRILADALRRLRRQPAEGDAPELAVGAPQTIPADYIPEEELRIGLHRRLARLREVGEIDALREEIEDRFGALPDAMEQLLEVTALRCRCRRLGVAALGAGPSGVSLTLQGARAGARAARLARASRRLLRADGERLVAALDAADAQSVLANAGRVLDVIEDIVRKARQRVAARRRPPQS
>CP029358.1|AWK90064.1|311454_311889_+|hypothetical-protein
MTLTPRIHGLIDWAATALLAAAPTALGWRGDTRRLMHAASAGTAAYALATDYEWGAAPLLSMEQHLALDAAQGAGFLVAALSLRREPLEARIAMAAFGAVAIAAAAFTERHPVPRARQRRYGRDSAILSRREAAARLSLADAPQ
>CP029358.1|AWK90158.1|329067_330354_+|cytoplasmic-protein
MTGRDSLSLAEARRIALAAQGFAKRDIAATDPADAVEARHLRRTIGRIGLLQVDSVNVLVRSHYLPLFSRLGPYRAGLLDRLAYDGRRRRLFEYWGHEASLIPVEHQPLLRWRMARARNGEGTYGRLSRFARERRPFVDAVLAEVAARGPLGASELSQGGRGSGSWWGWSDGKIALEYLFWAGLVTTAGRRGFERLYDLTERVLPTAVLAAPTPEEEEAQRALLRIAARAHGVATERDLRDYHRLDAADARQRLAELVEAGELLPVTVEGWDRPAYLHPEARIPRRVQASALLSPFDSLIWERQRTERLFGLRFRLEIYTPAAKREHGYYVLPFLLGDRIVARVDLKADRQARRLLVQAAHAEPGWAGPGTPHGPVAGALAAELWRMAGWLGLDSVAVAGPGDLAPTLREALGRVPPSDAERDGAAAG
>CP029358.1|AWK90073.1|330360_331869_+|hypothetical-protein
MHPSPAPPSPADLFIALLKRLEADPDATRRAAERHEADPPAVRRPARHLDLLLREAGTAGLLAWIRQEQDGLPEVERVLLAAQAIDRWYAPFAAVHDPAGPPAPDHLLVRRRFNRHGRLNGDPADGQLIVRHGYLGRRMAVGEAAEPGEFDAADLFRTLFLVPPRVPAGTAHDDSCRRMIDVRFTRRREPADRNPFDPDWAPAVAVVPLAQAEEDIAIRQFRRDGTDWYDPVPRDLGARAAGAIRALAGDGATFVIFPEVALHPDALGAVKQALRAQAVDGPIRYVLAGTRQPAPDGGKPFNRAVLLDRTGAEVVVQTKLHCWDLDSDQCRSYDLRSPDGRVLGGVNEFIAPGGRLELVELPNLGRLAVMICEDLDRSQPGDWLRRSMLLDWVVTPVLDSGLTTGRWQAREGAATSQSGSCRVVVANSMTFSHRFNRAARGGGHDRDVIADCGVALFFQPRRSQQGRPRVRLLTLPLDAPDGSRVCARWQPADWDELPEPKP
>CP029358.1|AWK90074.1|331865_332402_+|hypothetical-protein
MTTASTSPVPFADAIAALSDGLLAALAGERWEDADAELETLAEEVLGAILAGRGADLDALARATARCHTALRLRDAPGPEAAHRLGQLQAIGVLVNAGLRRRPAGTPDALAVPGTATAAILAALADGPRSGPQLVADTGRSVEEVAQALPALRGAGLVRSWSAGRLVMTELTEEAPRS
>CP029358.1|AWK90075.1|332408_334445_-|NAD(+)-synthase
MSFRSIYRHGFARVAACTVRCTLADPQANAEAVLRGATACHDQGVAVALFPELALSGYAIDDLLLQDPLLDAVERAVARIVEESRDLSPLILVGAPLRRGLRLYNCAVAVQRGRLLGVVPKVHLPNYREFYERRHFASGADTAGGGIRIGDLEAPFGPDLLFEAEDVPGLTVHAEICEDLWVAIPPSAAAALAGATVLANLSASNITIGKADTRRLLCKSQSARCLAAYLYSSAGAGESTTDLAWDGQASIFENGETLVETGRFPEGDQMAVADIDLDLLRQERARMGTFDDNRRLHDPAFRRQGFRVGPPAGDLGLKRPVPRFPFVPANPERLEQDCYEAYNIQVAGLVQRLRATGMKTLVIGVSGGLDSTHALIVAAHALDLLELPRRNILAFTMPGFGTSSGTKGNAWRLMTALGVTAREIDIRPAATRMLTDMEHPFGRGEPVYDVTFENVQAGLRTDYLFRLANQHDGLVLGTGDLSELALGWCTYGVGDQMSHYNVNAGVPKTLIQHLIRWVARSGQFHGDVPDTLDAILQTEISPELVPAGEDQAIQSTEAVIGPYALQDFTLFYTLRYGFRPSKIAFLALHAWGDAARGDWPAGFPDDKRRAYELKEIRSWLGVFLRRFFGFSQFKRSAMPNGPKVTAGGSLSPRGDWRAPSDGNARVWLEELEREVPEE
>CP029358.1|AWK90076.1|334842_336126_-|alpha-glucosidase/alpha-galactosidase
MANTTKIVFIGAGSAAFGLSLFQDLFTTTELAGSTLTLVDTNPEALERMAALARVLNERGGAGILIETTTDRRAALPGARFVLNAVAIDRNRLWKLDFEVPKKHGIRHTLGENGGPGGLFFTLRTLPLIFDIARDVEELCPDALFINLSNPESRIVLGLAKYTSVRTLGLCHGIFLARWFICQILGMAEKEVDVWGAGLNHFQWLTAIRERATGRDLYPLLREREKDYDPAFTPLTRRMFNAFGLWVSCSDDHMGEYVPYGWEGGEHGFDFENDERGRVILKDLMDGVIDGSKPIPEDWTRPSWGERAVAVICGMTHNQKRFIESGVVMNRGVVPGLPHDLAVEVPLVADAAGVHPVSLGPLPDPITKLLSIQASVQQLAVEAAVRGSKELALQALLIDPVINSTTAALAILDELWEANKPYIRPCV
>CP029358.1|AWK90077.1|336315_337650_+|beta-glucosidase
METLTFPSDFLWGASTSSYQIEGALDVDGRGPCVWDTFAANGHIQDGSTAAVACDHYHRYPEDIALMKAAGFNAYRFSIAWPRILPTGTGRVEPRGLAFYDRLVDSLLEAGIRPMACLYHWDLPQPLEDRGGWQSRDIVGPFADYARIVAARLADRVKDWMMLNEPNVVAIFGYGVGEHAPGHRLGEQGILRALHHQNLAQGAALRAIAAEHGGLTLGTVLNLQPAVPDSDRPEDVRAAAMWDAVWNRVALDGVMKGEIPALLADRMAGFVQPGDGEAMRYPIDLLGINYYSRNTMKHEPGRIFEAGWGEARCRRWTGMAWPVQPEGLYDLLCELKRDYANPAVYIAENGCAYDDVVAPDGTVHDAERVLYYREHLESVARAVRDGCNVKGYLCWSLLDNFEWAFGLSKRFGIVRVDYDTLVRTPKDSYRFLGAVAKSGRLDPA
>CP029358.1|AWK90078.1|337741_339529_+|ABC-transporter
MNGTTDSLKRKAAAQAGFARRFIDLAGGYWAGEEKWKVRLLTVALLVLTVGQVVVPVMINLWSEKLFDALEQRSMDRFFTMIGAVGVIILFSIVNTFLHLRVKRRLQLGWRRWLTRKVLDGWLARGRQHQVTYLPGDHDNPDGRIAEDIRIATEMAIDLGHSLTYCVILLISFTNILWMLSGTVAVTVWDTELSVPGHLLFIALIYAAIGTSIAWVVGQPLVRAVNRRQGYEADFRFGLARIRENAQPIALLHGETAERGRLVRLFEGVRLGWHGQTVALGHMMLFSATYSVLSAAFPILVAAPRYIAGTISLGVLMQTAQAFQQTVGALSWPIDNLPRAAEWKASVERVLSLQDALRQLDDEVCGDADHIVVERSDVHRSLCFHQTSISDPDGKRILLPFDLEVHRGDRVLIVGDPVAAIRLFRAVAGVWPWGSGRIALPAHTRVFFMPERPYLPHDTLRAVLSYPGPITLEGNDVAAAALARVGLAHLIRRLDDTDSWDSVLAVPEQQRLGFARLLIRRPDWIFIEDATDSLDPASEEELLELLEQELPTATLLTIGSHAALEPHHRRKLVLDRGDGFVQLREETCAKAVTAA
>CP029358.1|AWK90079.1|339566_340046_-|flavodoxin
MDPEPARKRLLIVAHCPSENTRLLCDAVLRGARSPEVEGVDCRAVAPLQAGPEDVLAADALILGTPENLGYMSGALKDFFDRIYYPCLERTQGRPYALYVRAGQDGTGTCRAVATIATGLRWRPVQEPLVLRGPFQEGFAARCEELGLLMAAGLEAGVF
>CP029358.1|AWK90080.1|340115_340721_-|hypothetical-protein
MEGWSRVGRWAMMSLMYRSEALRPPSMLELAEIALTSAYNNRDGGITGFLVHFEGTFLQVLEGEPERVEPLFGRIAADGRHENIRILERDMDRRSPVFGFWAMNIGPFDGPLFQRAVFGRRVDGREFAERSADRDYSFQVLLRAYLHACVIEDVTPIVRGRRPGAIPLLPNRRGAPWAMEAEPWAEPWAESWVEPPRGGNG
>CP029358.1|AWK90081.1|340847_341201_-|hypothetical-protein
METGTGAAGTGDGQPVWRQDIEALAFRPPGHDGRCAVHRLAFRTLIGGGQPPAAAECLAYFRLHRPAFERAAADKIARRGLPPDASLHLTSRDVGRAMTAEATDTGTAGAGAGRRVN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328283-328318	0	1.0
CP029358_1	1.2\|328356\|36\|CP029358\|PILER-CR,CRT	328356-328391	36	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328356-328391	0	1.0
CP029358_1	1.3\|328429\|37\|CP029358\|PILER-CR,CRT	328429-328465	37	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328429-328465	0	1.0
CP029358_1	1.4\|328503\|35\|CP029358\|PILER-CR,CRT	328503-328537	35	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328503-328537	0	1.0
CP029358_1	1.5\|328575\|38\|CP029358\|PILER-CR,CRT	328575-328612	38	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328575-328612	0	1.0
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328284-328318	0	1.0
CP029358_1	1.7\|328357\|35\|CP029358\|CRISPRCasFinder	328357-328391	35	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328357-328391	0	1.0
CP029358_1	1.8\|328430\|36\|CP029358\|CRISPRCasFinder	328430-328465	36	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328430-328465	0	1.0
CP029358_1	1.9\|328504\|34\|CP029358\|CRISPRCasFinder	328504-328537	34	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328504-328537	0	1.0
CP029358_1	1.10\|328576\|37\|CP029358\|CRISPRCasFinder	328576-328612	37	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	328576-328612	0	1.0
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	565141-565176	3	0.917
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	199705-199740	3	0.917
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	152932-152967	3	0.917
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	159447-159482	3	0.917
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	23784-23819	3	0.917
CP029358_1	1.1\|328283\|36\|CP029358\|PILER-CR,CRT	328283-328318	36	NC_010355	Azospirillum phage Cd, complete genome	23784-23819	3	0.917
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	565142-565176	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	199705-199739	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	152933-152967	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	159448-159482	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	23784-23818	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NC_010355	Azospirillum phage Cd, complete genome	23784-23818	3	0.914
CP029358_1	1.6\|328284\|35\|CP029358\|CRISPRCasFinder	328284-328318	35	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	551917-551951	9	0.743
CP029358_1	1.7\|328357\|35\|CP029358\|CRISPRCasFinder	328357-328391	35	MN234206	Arthrobacter phage Racecar, complete genome	152892-152926	10	0.714

1. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cggtgatgctgagttcggccttgaccgtcgccagtg	Protospacer
************************************

2. spacer 1.2|328356|36|CP029358|PILER-CR,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ctggtcgatggtcctcatgtccggacgctccggccg	CRISPR spacer
ctggtcgatggtcctcatgtccggacgctccggccg	Protospacer
************************************

3. spacer 1.3|328429|37|CP029358|PILER-CR,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gggaagtcccagcccttcatccacatcagcagcgcaa	CRISPR spacer
gggaagtcccagcccttcatccacatcagcagcgcaa	Protospacer
*************************************

4. spacer 1.4|328503|35|CP029358|PILER-CR,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

aagagccatcgctaggcgtatgtgaaggtgtgctc	CRISPR spacer
aagagccatcgctaggcgtatgtgaaggtgtgctc	Protospacer
***********************************

5. spacer 1.5|328575|38|CP029358|PILER-CR,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gtcgaggcggccgtccagtcgctctgccggcgcctctg	CRISPR spacer
gtcgaggcggccgtccagtcgctctgccggcgcctctg	Protospacer
**************************************

6. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ggtgatgctgagttcggccttgaccgtcgccagtg	Protospacer
***********************************

7. spacer 1.7|328357|35|CP029358|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tggtcgatggtcctcatgtccggacgctccggccg	CRISPR spacer
tggtcgatggtcctcatgtccggacgctccggccg	Protospacer
***********************************

8. spacer 1.8|328430|36|CP029358|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggaagtcccagcccttcatccacatcagcagcgcaa	CRISPR spacer
ggaagtcccagcccttcatccacatcagcagcgcaa	Protospacer
************************************

9. spacer 1.9|328504|34|CP029358|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

agagccatcgctaggcgtatgtgaaggtgtgctc	CRISPR spacer
agagccatcgctaggcgtatgtgaaggtgtgctc	Protospacer
**********************************

10. spacer 1.10|328576|37|CP029358|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tcgaggcggccgtccagtcgctctgccggcgcctctg	CRISPR spacer
tcgaggcggccgtccagtcgctctgccggcgcctctg	Protospacer
*************************************

11. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

12. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

13. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

14. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

15. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

16. spacer 1.1|328283|36|CP029358|PILER-CR,CRT matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 3, identity: 0.917

cggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ccgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
* *******.************************.*

17. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

18. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

19. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

20. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

21. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

22. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 3, identity: 0.914

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
cgtgatgccgagttcggccttgaccgtcgccagcg	Protospacer
 *******.************************.*

23. spacer 1.6|328284|35|CP029358|CRISPRCasFinder matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 9, identity: 0.743

ggtgatgctgagttcggccttgaccgtcgccagtg	CRISPR spacer
ttcgatgccgagttcggcctcgaccgtctcgaccg	Protospacer
  .*****.***********.******* * * .*

24. spacer 1.7|328357|35|CP029358|CRISPRCasFinder matches to MN234206 (Arthrobacter phage Racecar, complete genome) position: , mismatch: 10, identity: 0.714

tggtcgatggtcctcatgtccggacgctccggccg	CRISPR spacer
tacaaaatcgtcatcatgtccggacgctccgacgc	Protospacer
*.   .** *** ******************.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

24263 : 33672

Methanothermobacter_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK90128.1\|24263_25799_-	GNAT family N-acetyltransferase	Q9HH59	Methanothermobacter_phage	4.1e-35	29.1
AWK90127.1\|25773_26571_-	Cro/Cl family transcriptional regulator	Q9HH58	Methanothermobacter_phage	2.6e-09	31.7
AWK89857.1\|27049_28675_+	2-aminobenzoate-CoA ligase	Q75ZG1	Hepacivirus	2.0e-24	24.7
AWK89858.1\|28717_30670_-	acyltransferase	B5WZU0	Pseudomonas_phage	3.2e-77	46.3
AWK89859.1\|30807_31590_-	hydroxyacid aldolase	NA	NA	NA	NA
AWK89860.1\|31829_32846_+	chromosome partitioning protein	Q7Y3Y6	Yersinia_phage	3.3e-17	34.7
AWK89861.1\|32832_33672_+	chromosome partitioning protein	S5VTK0	Leptospira_phage	1.3e-14	38.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP029359

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27884 : 37409

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK90177.1\|27884_28766_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	2.7e-100	60.8
AWK90178.1\|28791_29694_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	2.0e-29	36.3
AWK90179.1\|29686_30760_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.2e-89	47.3
AWK90180.1\|30802_31357_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	8.6e-28	42.8
AWK90181.1\|31463_32393_-	hypothetical protein	A0A1C9C5B8	Heterosigma_akashiwo_virus	5.9e-21	28.6
AWK90182.1\|32392_33736_-	class I SAM-dependent methyltransferase	A0A2H4UUL2	Bodo_saltans_virus	2.4e-68	38.1
AWK90183.1\|33866_34448_-	hypothetical protein	NA	NA	NA	NA
AWK90184.1\|34444_35602_-	hypothetical protein	NA	NA	NA	NA
AWK90185.1\|35688_35898_-	hypothetical protein	NA	NA	NA	NA
AWK90186.1\|35906_37409_-	glycosyl transferase	A0A0N9P7Z4	Sulfolobales_Virus_YNP2	6.6e-06	29.8

DBSCAN-SWA_2

113554 : 121758

Trichoplusia_ni_ascovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK90294.1\|113554_114298_+	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	7.5e-19	33.5
AWK90239.1\|114294_115179_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
AWK90240.1\|115184_115961_+	hypothetical protein	Q06VL0	Trichoplusia_ni_ascovirus	8.7e-10	26.8
AWK90241.1\|115935_116781_+	oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-05	33.0
AWK90242.1\|116887_117751_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	1.3e-51	47.8
AWK90295.1\|117747_119010_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	7.0e-41	32.5
AWK90243.1\|119160_119910_-	hypothetical protein	NA	NA	NA	NA
AWK90244.1\|119933_120860_-	hypothetical protein	NA	NA	NA	NA
AWK90245.1\|120741_121758_-	acylneuraminate cytidylyltransferase	A0A140XBD6	Dickeya_phage	7.1e-12	33.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP029360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37735 : 51431

Azospirillum_phage(66.67%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK90346.1\|37735_44503_-	hypothetical protein	I6ZXX9	Escherichia_phage	1.3e-16	34.5
AWK90347.1\|44510_45212_-	hypothetical protein	B0VK42	Azospirillum_phage	1.6e-63	54.6
AWK90359.1\|45220_45550_-	hypothetical protein	NA	NA	NA	NA
AWK90360.1\|45600_46065_-	hypothetical protein	B0VK41	Azospirillum_phage	1.0e-37	59.7
AWK90348.1\|46227_47709_-	hypothetical protein	B0VK40	Azospirillum_phage	1.0e-112	44.8
AWK90349.1\|47771_47951_-	hypothetical protein	NA	NA	NA	NA
AWK90350.1\|47954_48389_-	hypothetical protein	NA	NA	NA	NA
AWK90351.1\|48390_48741_-	hypothetical protein	NA	NA	NA	NA
AWK90352.1\|48745_49390_-	hypothetical protein	B0VK37	Azospirillum_phage	1.5e-23	45.3
AWK90353.1\|49391_49604_-	hypothetical protein	NA	NA	NA	NA
AWK90354.1\|49653_50109_-	hypothetical protein	NA	NA	NA	NA
AWK90355.1\|50174_51431_-\|capsid	phage major capsid protein	Q8W6U5	Burkholderia_virus	7.4e-59	39.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP029356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029356_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029356_1

343675-343844

Orphan

Consensus_repeat	Method
GGCCTTCCACAAGACTACGCA	PILER-CR

2 spacers

The CRISPR arrays of CP029356_1

>merge|CP029356|1|343675-343844|PILER-CR
GGGCTTCCACAAGACTACGCAGGCCGGCACCGGCGCCGCTGCGGCACCGGCGGCCACCCTCCACCAGATTACGAATCGGCCGGCGTCCTTCTCCACAAGACTACGCACGGCCGCCGGCCATCCTGCGACTCGCGGACCGCGAGCGGCGCGGCCTTCCACAAGACTACGCA

>CP029356|1|1|343675-343844|PILER-CR
GGGCTTCCACAAGACTACGCA	GGCCGGCACCGGCGCCGCTGCGGCACCGGCGGCCACCCTCCACCAGATTACGAATCGGCCGGCGTCCTTC
TCCACAAGACTACGCACGGCC	GCCGGCCATCCTGCGACTCGCGGACCGCGAGCGGCGCGGCCT
TCCACAAGACTACGCA

Protein	Signature genes	Signature genes Name	Protein_function
CP029356.1\|AWK88881.1\|350601_351168_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182158
CP029356.1\|AWK88878.1\|345441_346488_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270307
CP029356.1\|AWK88883.1\|354137_355049_+\|EamA/RhaT-family-transporter	unknown	unknown	gnl\|CDD\|307170
CP029356.1\|AWK88871.1\|337370_338510_+\|hypothetical-protein	unknown	unknown	unknown
CP029356.1\|AWK88879.1\|346644_347895_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224097
CP029356.1\|AWK88880.1\|348868_350557_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
CP029356.1\|AWK88868.1\|333344_334385_-\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
CP029356.1\|AWK88884.1\|355058_355433_-\|hypothetical-protein	unknown	unknown	unknown
CP029356.1\|AWK88874.1\|340134_340995_-\|chromosome-partitioning-protein	unknown	unknown	gnl\|CDD\|275105
CP029356.1\|AWK88869.1\|334401_335253_-\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
CP029356.1\|AWK88875.1\|340981_341971_-\|chromosome-partitioning-protein	unknown	unknown	gnl\|CDD\|224113
CP029356.1\|AWK88882.1\|352810_354097_+\|4-aminobutyrate--2-oxoglutarate-transaminase	unknown	unknown	gnl\|CDD\|236032
CP029356.1\|AWK89270.1\|351324_352782_+\|succinate-semialdehyde-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|143421
CP029356.1\|AWK88877.1\|344261_345374_+\|spermidine/putrescine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
CP029356.1\|AWK88872.1\|338609_339062_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
CP029356.1\|AWK88870.1\|336131_337145_-\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP029356.1\|AWK88873.1\|339406_340039_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293823
CP029356.1\|AWK89269.1\|347981_348719_+\|polyamine-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
CP029356.1\|AWK88867.1\|331581_333300_+\|potassium-transporter-KefB	unknown	unknown	gnl\|CDD\|235131
CP029356.1\|AWK88876.1\|342495_343443_+\|pirin	unknown	unknown	gnl\|CDD\|309782

Protein	Function_ID	Function_description	E-value
CP029356.1\|AWK88881.1\|350601_351168_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|182158	PRK09943, PRK09943, HTH-type transcriptional regulator PuuR.	2.02611e-45
CP029356.1\|AWK88878.1\|345441_346488_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270307	cd13589, PBP2_polyamine_RpCGA009, The periplasmic-binding component of an uncharacterized ABC transport system from Rhodopseudomonas palustris CGA009 and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic binding domain that serves as the primary high-affinity receptor of an uncharacterized ABC-type polyamine transporter from Rhodopseudomonas palustris Cga009 and related proteins from other bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.31754e-86
CP029356.1\|AWK88883.1\|354137_355049_+\|EamA/RhaT-family-transporter	gnl\|CDD\|307170	pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Members of this family usually carry 5+5 transmembrane domains, and this domain attempts to model five of these.	9.50927e-11
CP029356.1\|AWK88880.1\|348868_350557_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.21669e-38
CP029356.1\|AWK88879.1\|346644_347895_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	3.11628e-78
CP029356.1\|AWK89270.1\|351324_352782_+\|succinate-semialdehyde-dehydrogenase-(NADP(+))	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
CP029356.1\|AWK88868.1\|333344_334385_-\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	2.63464e-157
CP029356.1\|AWK88874.1\|340134_340995_-\|chromosome-partitioning-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	4.51341e-50
CP029356.1\|AWK88869.1\|334401_335253_-\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	7.08317e-157
CP029356.1\|AWK88875.1\|340981_341971_-\|chromosome-partitioning-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.26764e-73
CP029356.1\|AWK88882.1\|352810_354097_+\|4-aminobutyrate--2-oxoglutarate-transaminase	gnl\|CDD\|236032	PRK07495, PRK07495, 4-aminobutyrate--2-oxoglutarate transaminase.	0
CP029356.1\|AWK88877.1\|344261_345374_+\|spermidine/putrescine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	7.80667e-156
CP029356.1\|AWK88872.1\|338609_339062_-\|transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	1.31138e-44
CP029356.1\|AWK88870.1\|336131_337145_-\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP029356.1\|AWK88873.1\|339406_340039_+\|hypothetical-protein	gnl\|CDD\|293823	cd07737, YcbL-like_MBL-fold, Salmonella enterica serovar typhimurium YcbL and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes Salmonella enterica serovar typhimurium YcbL which has type II hydroxyacylglutathione hydrolase (EC 3.1.2.6, also known as glyoxalase II) activity, and has a single metal ion binding site, and Thermus thermophilus TTHA1623 which does not have GLX2 activity and has two metal ion binding sites with a glyoxalase II-type metal coordination. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.28462e-121
CP029356.1\|AWK89269.1\|347981_348719_+\|polyamine-ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	1.41156e-74
CP029356.1\|AWK88867.1\|331581_333300_+\|potassium-transporter-KefB	gnl\|CDD\|235131	PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional.	2.9809e-133
CP029356.1\|AWK88876.1\|342495_343443_+\|pirin	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	5.4366e-55

>CP029356.1|AWK88876.1|342495_343443_+|pirin
MAEIHDLIMQHGRERARELVPRDQRPLVDAAAAVLADESRAMGITYSGFCLTALPHKRIPDDQTWRRDGHRVTLVVQPGVLLVGGKEKLFGVPYGSRARLIMLYLQTRALQSNSREVELGASMRDWMSRMNVSTGGQSYRDVKEQCNRLSACHLTFFWDEADAKGRGSKFAKDSIVVGGLTFTEEDYRQGSLWEERVLLSESFFKSLREHPVPVLESAIREISSKSMAIDVYIWLAYRLHSLSEATKISWQSLYAQFGGGYDEIRHFKTRFPDTLRVALNVYPEAKVEVNREGMVLHPSLPPIASDRRQAALFAM
>CP029356.1|AWK88875.1|340981_341971_-|chromosome-partitioning-protein
MTGEELQAIREARGVTQQEFASWLNERLGRRYDRARMSRWESGAERIPPRVELFLKTEQANAKPDRSNRRAQVVAVANQKGGVGKTTTAVNVAYALAKRGERVLLIDADPQASATIFLGQDPRQLEGRKATLYYALLKDVPLSSIVLPGEFGLVPSSIMLAAADTELMAEPFASSVLREKIADLRSDYDHIIIDCPPNLSLLTVNALSAADQVIIPVKTEFLDIMGIPLLLDTVEKIRRRGNPDLTVLGILPTMFNARYTQDNETLRELRESLGGKTRIFAPINRSTGYGQSAAAGRPTLEVLPDTPGVQGYVDLARELAEEVTSHGEA
>CP029356.1|AWK88874.1|340134_340995_-|chromosome-partitioning-protein
MAKPKTRNFGLFRGAVEEQGRDALFGVSSDFPRLVEVELDRIERNPDQPRRIFDPEDMQTLAESIERYGMKQPILVQDTGDGRFLLVAGERRYRAHEMLGRDTIFAIVTSGDADELALVENVQRVDLNAIELAQALARLMERHGYTQEELGRIVGKSQSAISHTLRLNALPDRIKDEYATSHRDVSRSVLVEIAWIKDEVEQLALWERVKAGEGTVKAARSRKDSAKEPAAAPSPARATPVARFLDTLRKATKQLGDPAELRSQIDDTQRSELMELRRRIDLLLGE
>CP029356.1|AWK88873.1|339406_340039_+|hypothetical-protein
MHYTIVPVTPFQQNCTVLWCPETMKGAAVDPGGDLPLILRAVQAKGVTLEKILVTHGHIDHAGGVADLAEQLTLPIEGPQREDQFWIDGMPSQSKMFGFPPVRSFTPDRWLEDGDTVTVGKLTLDVRHCPGHTPGHVVFIHQPSRLAIVGDVLFQGSIGRTDFPRGNHADLLDSIRTRLFPYGDDMAFIPGHGPMSTFGEERLYNPFLTD
>CP029356.1|AWK88872.1|338609_339062_-|transcriptional-regulator
MLSQKAKYALRALIMLAERPDDELVLIADIAERENIPRKFLEAILVELRKQGLLFAKRGKSGGYRLARPANEISFGEVIRLIDGHLAPIPCASKYSFKPCEDCIDPDTCSVRWLMVQVRDATAGVLDKRTLADALRHRQATGGLAANFDI
>CP029356.1|AWK88871.1|337370_338510_+|hypothetical-protein
MQTALSPALSPALLTALLEAERALGRLAELMQDAERRRRLWADAARREACAAARLDGIAVDTTDFLIATVSTDLVPTAGRGDAQSVRSLWQGCRFSQGALPAPERRPSPAALSRGGMSVASEVWQAVADLEAGLTDPEEGEDGRPSPSAAAMPESWTLDWMECCWRVLQAEVSGRDPDRLAFSAEREAEACTLLGRLDAAARPPALLGGVGLLAELLRPAPDLRLPSWAVPTARLLAAQAVARCCRLPALWLPLSVSLWTDRTAAAIAARGRDEEWLAWLADMVAETARRERQRVYSLDQAAESWRRRVGTRRRNSRLPEVLDRLFEEPAFTVRRIQRTLGTTFRGAQLIVDDLIEAGIAREVTNRALDRVFVAVDLMP
>CP029356.1|AWK88870.1|336131_337145_-|sulfate-ABC-transporter-substrate-binding-protein
MPIRRSLTILAAGLTLAWLGAAAADAQDTLLNVSYDPTREFYVEFNQAFAKKWKAETGRAVTIKQSHGGSGKQARSVIDGLDADVVTLALGYDIDAIADSGLLAKDWQARLPNNSSPYTSTIVFLVRKGNPKQVKDWDDLVKPGVQVITPNPKTSGGARWNYLGAWAYALEKSGNDEAKAKEFVGQLFRNVPVLDSGARGSTVTFTQRGIGDVLLAWENEAFLSLQEFGADKFEIVVPSLSILAEPPVAVVDSVVDRKGTRKAAEAYLQFLYTREGQELAAKHFYRPRQPELATQYAGRFANVKLVTIDQTFGGWRPTQEKHFADGGVFDQIYQKGR
>CP029356.1|AWK88869.1|334401_335253_-|sulfate-ABC-transporter-permease-subunit-CysW
MRASRQTSALADPVWVRLALIGTALAFLVLFLVLPLVAVFTEALRRGFDAYWAALVEPDAMAAIRLTLLVAAIAVPANLIFGVAASWCVAKFEFRGKNLLITLIDLPFSVSPVISGLIYVLLYGMRGLLGPWLKSEGIQIIFAVPGLVLATIFVTFPFVARELIPLMQEQGSEEEEAALVLGASGWQTFWRVTLPNIKWGLLYGVLLCNARAMGEFGAVSVVSGHIRGETNTMPLHVEILYNEYNFVAAFAVASVLALLALVTLVVKTVLEWRFEAEIAATRH
>CP029356.1|AWK88868.1|333344_334385_-|sulfate-ABC-transporter-ATP-binding-protein
MAIQVSGITKRFGAYTALDSVDLEVRSGELLALLGPSGSGKTTLLRIMAGLEHPDGGSLQLNGEEALGLKPRDRQVGFVFQHYALFRHMTVFDNVAFGLKVRPRGERLGRAEIRRRVLELLELVQLGHFAERYPAQLSGGQRQRVALARALAIEPKVLLLDEPFGALDAKVRKELRRWLRKLHDDIHITSVFVTHDQEEALELADRVVVMSQGRIEQIGTPAEVYDHPSSAFVYEFLGQVNRFDCVVDGGVAVAANGALSIPAEISLRGPGIAYVRPHDLGLSPASGGPGRVSGIHVVGPDARVEIDLAGLALEAEMDRERLQMLGLRTGDPCAVHVDRARIFPRA
>CP029356.1|AWK88867.1|331581_333300_+|potassium-transporter-KefB
MHDPLLFRDILFLLLAAIIAVPLFQALRIPAVLGYLVAGMALGPHTPGPVVDLEMPQILAEFGVVFLLFAIGLELPLSRLQAMRRYIFGLGLMQVFFTSAIIGAIGYGFGLTPEAAIVTGGMLAFSSTATVLKLLVERGETVARFGRISVAVLIFQDLAVVPLLTLLPLLAGESTSIPYALGLAGVKAVAAILVIMLLGRFVVRPAYRFVASANSPEVFTAANLFVLLAIGWLTAEAGMSMALGAFLAGMLLADTPYRHQVEADIEPFRGLLLGLFFMTVGMTLDLPAMADRADMILLVTVSLLAGKSTLLFLLCRLSGLGLATSLRIGLLLAQGGEFAFVLIGKATALKVMDGETGLLLSSSVALSMAVTPLIGTAAQRLAQAIEARRGAETFGVEADGRTGHVLIAGYGRVGAAVARLLAAHDVPFLALDLEPQRVARARQHGLPVYYGDASQEVVLRVAGIERARAAVITLNRPERAERAVEAIRRAAPDLPIVARAHDLGQRGILSAAGATAVVPETIEASLHMAALVLRKAGIDPQTVDRNLQAYRDGNYEALMELETKGKEAAGAD
>CP029356.1|AWK88877.1|344261_345374_+|spermidine/putrescine-ABC-transporter-ATP-binding-protein
MDGGMIATTQALVRFAGVQKTYDGEHLVVKSLDLDIRKGEFLTLLGPSGSGKTTTLMMLAGFEIPTQGEIYLADRPIKNMPPHKRDIGMVFQNYALFPHLTIEENVAFPLSVRGVPKAEIRERVTKALRMIKLETLASRRPGQLSGGQQQRVALARALVFNPTLVLMDEPLGALDKRLREHMQLEIKHLHETMGITVVYVTHDQGEALTMSDRIAVFNDGIVQQIDRPAALYERPVNSFVANFIGENNVLNGTVENIEQEYCRVALDAGGSVVATAVNIAGAGARTSLSIRPERVTILAGPDAAGEGPNRLPAVIQDMIYLGDHTLAVLTAAGNDEFMVKLPAGAHAGLSHGEPVTITFRPEDCRALDPV
>CP029356.1|AWK88878.1|345441_346488_+|spermidine/putrescine-ABC-transporter-substrate-binding-protein
MSKFRVALGFVATFTAISALAPAASARDLTVVSWGGAYQEAQKKVYFEPFKATGTAMNDESWDGGIGVLRAKVQGGNATWDVVQVESEELALGCEEGLFEKINYSRIGGEGQYLPATVNPCGVGAIVYDFVLGYDKDKLKEAPKSWADFFDTKKFPGKRGLRQGAKTTLEIALMADGVAPADVYKVLATDAGVERAFKKLDTIKNDIVWWKAGAQPPQLLASGEVAMTSVYNGRIDAANKTEKKNFGMVWNGALFTIDSWVILKGSPNAEAAYKFLDFVGKAENQAKLSENIAYGTSNKNAPAKIAPAILADLPTAPANMKNAVEIDTNFWLENIDRLTERFNKWAAK
>CP029356.1|AWK88879.1|346644_347895_+|polyamine-ABC-transporter-substrate-binding-protein
MTAAFVAGADVPLKRRLKRAERARQLRALGLVLPLLLFLLLTFLGPIAGMLWRSVDDWEVPQVLPKTVEALAGWDGRDLPGEAAFAALAADLQVARASGTTAIAAKRLNYSVNGFRTILTSTARNLKTMPEPGQARASLVAVNPAWGERSTWVAIKGASGPVTGFYLLAALDLTRNLDGAIVAAPEDQAIYRDVFARTFTIGLGVTALCLLLGFPVAYLLATLPTGQSNLLMIFVLLPFWTSLLVRTCAWIVLLQSEGIVNGVMQWLGIIDAPLRLIYNRFGVYMAMTHVLLPFMILPLYSVMRSISPAYMRAAASLGAPPAVAFLRIYLPQTLPGIGAGSLLVFILAIGYYITPALVGGAADQMISAFIAFYTTETVNWGLASALGTVLLFATLILAVVYGKLVHGRQNTGGLKN
>CP029356.1|AWK89269.1|347981_348719_+|polyamine-ABC-transporter-permease
MAPILAIVPLSFSSGAYLTYPLPGLSLRWYEDFLTSPRWMMSLKNSVIIGVSSTILSMILGTLAALGLAQWKSRWKSLVLAVVLSPMVVPVVITAVGVYFFFAPLGLTGNYAGLILAHTALSTPFVVITVSATLQGFDMTLARAAASLGAPPLLAFRKVILPLILPGMASGALFAFATSFDEVVTVLFLAGPEQRTLPREMFSGIRENISPTITAVAVILTVISVILLSVVEALRRRNERLKGAA
>CP029356.1|AWK88880.1|348868_350557_+|methyl-accepting-chemotaxis-protein
MRFPTLSIRSRIIGAAACMMLFVCGFGAFTLDRLETLNGAAETIRGSSLTGAQVAGQLLAAAQNYRIAEAAYALSTNAMQVGQVEAGHAAVAGAVQTLRDQAGPLFGSGRMADRLAAFDAAWTEYRQVSDRVRSLAREGNSQSAASVFKRPSAVAFVRVQESLSALVDSAVTEAGEIADHGAAVYRQARSLVLLALALCALGAVASGVLMVRGISRPILRVAGALERLAARDTTVTFDDGGRRDEIGRMAAAARVFRESMLETDRLQAEQERLKAAAAEERRRELDRLAGSFEATVMALVETLASSTAGMAAAAGTMASSASETAEHADAVSAAAQMASASADSVAGATVELSASFAEIGRLVSDSASIARAASGDAERGSQVMGGLAAAAQEIGKVVELISGIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKQLAAQTGKATDEIQARIAEIQSASGTAVAAITAVTRTIARINEISAQISAAVGQQSAAVDEIASSITHTAAGTRDVSTNIAAVTDAAAAARQASVTMVRSAESVSGEASRMRREVSGFLDALRAA
>CP029356.1|AWK88881.1|350601_351168_-|XRE-family-transcriptional-regulator
MDFDVGSRLKQVREQHGLSQRALAQRAGVTNGTISLIEQNRCSPSVSSLRKVLQGIPMSLAEFFASDDLPPPEQIFFKSGDLIELADELKGTVGQVSFRQVGDLRGRNLQVLHERYAPGADTGRTMLQHESEEGGIVVRGRIELTVGDRKEILGPGDAYLFDSRIPHRFRNIGDEECELISACTPPYL
>CP029356.1|AWK89270.1|351324_352782_+|succinate-semialdehyde-dehydrogenase-(NADP(+))
MSLNDQSLLQTNGYVNGAWRGAASGRSFPVTNPATGAVIATVADMGAEETREAIRAAADALPAWRGRTAKERAAILRRWFELILANQEDLAQLMTAEQGKPLTESRGEVVYGASFIEWFAEEAKRVYGDVIPSFAANKRLVVLKEPIGVVAAITPWNFPLAMITRKVAPAIAAGCTVVVKPAEDTPLTALALAELAGRAGVPAGVLNIVMGSDPVAIGGELTGSPIVRKVSFTGSTEVGKILMRQSADTVKKVSLELGGNAPFIVFDDADLDAAVQGALASKYRNAGQTCVCANRLLVQASVYEAFTAKLVEAVSRFKVGNGAEAGVTQGPLINPQAVEKVEELLGDAVAKGARVVLGGKRHELGGTFFEPTVVTGLTPEMRVSREEIFGPVAPLFKFETEDDAVRMANDTEYGLAAYFYSRDIGRVWRVAEKLEYGIVGINEGIISTEVAPFGGMKESGIGREGSKYGIEDFLEIKYLCVGLGA
>CP029356.1|AWK88882.1|352810_354097_+|4-aminobutyrate--2-oxoglutarate-transaminase
MSNQSFVARREAAVSRGISAGLPIYIDRAENAEMWDVEGRRFIDFAGGIAVLNTGHRHPKVMEAVKAQLDRFTHTCAMVTPYDSFVELAEKLNALVPGPTPKKTAFFTTGAEAVENAVKIARAATGRPAVVAFSGAFHGRTLLGMALTGKVVPYKVGFGPFPAEVYHVPFPNPYRDISVADSLKALDTLFKSDVDPARVAAIIVEPVQGEGGFNIASPEFLQKLRALCDQHGIVFVVDEIQTGFARTGKMFAFEHAGIEPDLVTMAKSLAGGFPLSAVTGKAALMDAPVPGGLGGTYAGSPLATTAALAVIEAIEEEKLVERAQALGERIAGRFRSMAQRNSLSVIGDVRNLGAMVAMELVKDRDSKEPAADLTKALVAKAAEKGLILLSCGTYANVIRILVPLTASDAVVDEGLDIIERSLEELVGA
>CP029356.1|AWK88883.1|354137_355049_+|EamA/RhaT-family-transporter
MTASTATDSRLGILMMLLGMSLFTFNDALGKWLVAEYPVGMLVAVRSLFGTAILLPLIWREGLAAVFAVGRLKMHLLRVVCVTADIGCFYWAVRYLPLADVMTIYMSAPLIVTALSVLFLGEKVGWRRWAAVVVGFVGVVVVLNPTGTFDPLPSAMALLGAVIFSAGLIFTRVLRGAGTLSLVTYQTLGGLVLGGVTLPMAWVDPGWLDFLLLGLLGVTALAGHSAINRSLQLSPAAVVVPFQYVSIVWAVVLDLLVWGTMPTARIGLGAALIIGSGLFIFYREQRLNRSAATQASADLGAAD
>CP029356.1|AWK88884.1|355058_355433_-|hypothetical-protein
MRMGYTGWALPEEERARLLTLVPARYERLIAHHVTREYNVPEGHPLPAATAGDVVGVVDDGEGVQALIVEIDGTTDRPDGSTNHITWSLGPGRQPVESNSVIAGYGWRPVEPVTIRLEPRFFPL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029356_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029356_2

517508-517846

Orphan

Consensus_repeat	Method
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	CRT
GTCTT--------CCTGGGCAGTAATGCCCAGGCCTCATTGAAGC	PILER-CR
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	CRISPRCasFinder

4 spacers

The CRISPR arrays of CP029356_2

>merge|CP029356|2|517508-517846|CRT,PILER-CR,CRISPRCasFinder
GGCATCAAGGGTCCTGGGCATTGCCGGGCAGGAGGACGGCTTGCCGAACATGCGCAAGTATGGCCAGACCGCGCAGCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGACCAGTTTCACGTACAACAATCTGCTGATGCGCCAATGGCAGCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGACTCGCGCGCTGGTACACCAGCCTTGATGAGACCGGCCGGCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGACGGGCGCTGCGCTATAGTCATCGCCACCCAGCTTGGCGCAGGCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC

>CP029356|2|1|517508-517846|CRT
GGCATCAAGGGTCCTGGGCATTGCCGGGCAGGAGGAC	GGCTTGCCGAACATGCGCAAGTATGGCCAGACCGCGCA
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	CAGTTTCACGTACAACAATCTGCTGATGCGCCAATGGCA
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	TCGCGCGCTGGTACACCAGCCTTGATGAGACCGGCCG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	GGGCGCTGCGCTATAGTCATCGCCACCCAGCTTGGCGCAG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC

>CP029356|2|2|517583-517846|PILER-CR
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	CAGTTTCACGTACAACAATCTGCTGATGCGCCAATGGCA
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	TCGCGCGCTGGTACACCAGCCTTGATGAGACCGGCCG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	GGGCGCTGCGCTATAGTCATCGCCACCCAGCTTGGCGCAG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC

>CP029356|2|1|517583-517846|CRISPRCasFinder
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	CAGTTTCACGTACAACAATCTGCTGATGCGCCAATGGCA
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	TCGCGCGCTGGTACACCAGCCTTGATGAGACCGGCCG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC	GGGCGCTGCGCTATAGTCATCGCCACCCAGCTTGGCGCAG
GCTTCAATGAGGCCTGGGCATTACTGCCCAGGAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP029356.1\|AWK88991.1\|509307_510078_-\|ethanolamine-ammonia-lyase	unknown	unknown	gnl\|CDD\|235482
CP029356.1\|AWK89004.1\|531470_532499_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|224157
CP029356.1\|AWK88995.1\|513368_514853_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380205
CP029356.1\|AWK88994.1\|512499_513372_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
CP029356.1\|AWK88990.1\|507806_509228_-\|ethanolamine-permease	unknown	unknown	gnl\|CDD\|129986
CP029356.1\|AWK89284.1\|534255_535191_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270265
CP029356.1\|AWK89000.1\|527681_528263_-\|S-(hydroxymethyl)glutathione-synthase	unknown	unknown	gnl\|CDD\|235451
CP029356.1\|AWK89003.1\|531191_531419_-\|SlyX-protein	unknown	unknown	gnl\|CDD\|377222
CP029356.1\|AWK89005.1\|537326_538274_-\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|381307
CP029356.1\|AWK88989.1\|506553_507633_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
CP029356.1\|AWK88998.1\|519249_520314_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223669
CP029356.1\|AWK88999.1\|525595_527659_+\|penicillin-binding-protein-1C	unknown	unknown	gnl\|CDD\|227289
CP029356.1\|AWK88988.1\|505786_506374_-\|ArsR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP029356.1\|AWK89002.1\|529720_531169_+\|copper-oxidase	unknown	unknown	gnl\|CDD\|259954
CP029356.1\|AWK88992.1\|510074_511469_-\|ethanolamine-ammonia-lyase-large-subunit	unknown	unknown	gnl\|CDD\|237897
CP029356.1\|AWK89001.1\|528549_528759_-\|hypothetical-protein	unknown	unknown	unknown
CP029356.1\|AWK88993.1\|511673_512300_-\|ATP-dependent-Clp-protease-proteolytic-subunit	unknown	unknown	gnl\|CDD\|237133
CP029356.1\|AWK88997.1\|515993_517235_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP029356.1\|AWK89285.1\|535451_536744_-\|metal-transporter	unknown	unknown	gnl\|CDD\|234815
CP029356.1\|AWK88996.1\|515065_515863_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277347

Protein	Function_ID	Function_description	E-value
CP029356.1\|AWK88991.1\|509307_510078_-\|ethanolamine-ammonia-lyase	gnl\|CDD\|235482	PRK05465, PRK05465, ethanolamine ammonia-lyase subunit EutC.	2.49528e-118
CP029356.1\|AWK89004.1\|531470_532499_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|224157	COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis].	2.41757e-21
CP029356.1\|AWK88995.1\|513368_514853_-\|hypothetical-protein	gnl\|CDD\|380205	NF033203, entero_EhxA, enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.	1.35772e-12
CP029356.1\|AWK88994.1\|512499_513372_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	2.0046e-14
CP029356.1\|AWK88990.1\|507806_509228_-\|ethanolamine-permease	gnl\|CDD\|129986	TIGR00908, putative_ethanolamine_permease, ethanolamine permease. The three genes used as the seed for this model (from Burkholderia pseudomallei, Pseudomonas aeruginosa and Clostridium acetobutylicum are all adjacent to genes for the catabolism of ethanolamine. Most if not all of the hits to this model have a similar arrangement of genes. This group is a member of the Amino Acid-Polyamine-Organocation (APC) Superfamily. [Transport and binding proteins, Amino acids, peptides and amines].	3.49807e-174
CP029356.1\|AWK89284.1\|534255_535191_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270265	cd13547, PBP2_Fbp_like_2, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.03911e-101
CP029356.1\|AWK89000.1\|527681_528263_-\|S-(hydroxymethyl)glutathione-synthase	gnl\|CDD\|235451	PRK05417, PRK05417, glutathione-dependent formaldehyde-activating enzyme; Provisional.	1.16738e-133
CP029356.1\|AWK89003.1\|531191_531419_-\|SlyX-protein	gnl\|CDD\|377222	pfam04102, SlyX, SlyX. The SlyX protein has no known function. It is short less than 80 amino acids and is found close to the slyD gene. The SlyX protein has a conserved PPH(Y/W) motif at its C-terminus. The protein may be a coiled-coil structure.	5.07833e-21
CP029356.1\|AWK88989.1\|506553_507633_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.66421e-42
CP029356.1\|AWK88998.1\|519249_520314_-\|hypothetical-protein	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.14137e-19
CP029356.1\|AWK88999.1\|525595_527659_+\|penicillin-binding-protein-1C	gnl\|CDD\|227289	COG4953, PbpC, Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane].	0
CP029356.1\|AWK88988.1\|505786_506374_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	2.11522e-65
CP029356.1\|AWK89002.1\|529720_531169_+\|copper-oxidase	gnl\|CDD\|259954	cd13887, CuRO_2_MCO_like_2, The second cupredoxin domain of uncharacterized multicopper oxidase. Multicopper Oxidases (MCOs) are multi-domain enzymes that are able to couple oxidation of substrates with reduction of dioxygen to water. MCOs oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre which binds a dioxygen. The dioxygen, following the transfer of four electrons, is reduced to two molecules of water. These MCOs are capable of oxidizing a vast range of substrates, varying from aromatic to inorganic compounds such as metals. This family of MCOs is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.	8.09185e-62
CP029356.1\|AWK88992.1\|510074_511469_-\|ethanolamine-ammonia-lyase-large-subunit	gnl\|CDD\|237897	PRK15067, PRK15067, ethanolamine ammonia-lyase subunit EutB.	0
CP029356.1\|AWK89005.1\|537326_538274_-\|alcohol-dehydrogenase	gnl\|CDD\|381307	cd19081, AKR_AKR9C1, AKR9C family of aldo-keto reductase (AKR). Haloferax volcanii aldo-keto reductase is a founding member of aldo-keto reductase family 9 member C1 (AKR9C1).	0
CP029356.1\|AWK88993.1\|511673_512300_-\|ATP-dependent-Clp-protease-proteolytic-subunit	gnl\|CDD\|237133	PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed.	8.55868e-99
CP029356.1\|AWK88997.1\|515993_517235_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.3623e-11
CP029356.1\|AWK89285.1\|535451_536744_-\|metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	6.34687e-147
CP029356.1\|AWK88996.1\|515065_515863_-\|hypothetical-protein	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	8.29353e-74

>CP029356.1|AWK88997.1|515993_517235_-|MFS-transporter
MTGTVIETRENHWDAKRRSIAALALAQVLALSLWFSGTAVVPALRAEAGLTDFQAAAFTSAVQIGFVAGTLVSALLGLADRLDPRRLFMASALVAGAANAALLLVDPAGMVALALRFVTGACMAGIYPVGMKIAASWARGDLGLLVGLLVGALSVGSASPHLIGALGGVGWRSTIAFTSLLAGLSALVAASVSLGPNAAAPRRFVLATAWEVWSVPSLRLVNLGYLGHMWELYALWAWVGVFLQASFAHSLPPGDAAFWAKCATFAVVAVGGIGCVLAGLMADRIGRTAVTAGALAISGSCALLAGTSFGAAPALTTALCLVWGASAVADSAQFSAAATELAVPQHLGTILTAQVCGGFTLTLLSIHLLPELAAAAGWSVAPAVLALGPAVGIWAMLRLRGRPEAKRLAGGRR
>CP029356.1|AWK88996.1|515065_515863_-|hypothetical-protein
MLIAQISDLHVTARGTRPFPAADTNQRLAATVAHLNAMTPRPDLVLITGDLINGPAEGEYEAVLEGLEPLEIPFRVLPGNHDDRAGLRRAFGDRGWLPMEGQFLHYAVEEFPVRVLMLDSVIPGSPVGALCPARLAWIAARLAEQPDRPTLVALHHPPFPIGMQFLDTMRCIEGAEELGAMLRRHGKVLGVVCGHIHRQATVNWGGLTGFVAPSSAYVIAFDLAPKPPYRWTEEPPAVALHLHRPDVGLVTHLSPVGDFPGKAFK
>CP029356.1|AWK88995.1|513368_514853_-|hypothetical-protein
MAVEYVYGSNGSDRIFRGRGSQWIFGRDGNDTLGGGNGSDTVEGGSGHDVLYGGDDASRDLLIGGTGNDSFWVNGPEDGIIEERGQGTDTVHARSSWILGRNLENLVLQEAGATANGSATGNELANRITGNSGSNRIDGLAGNDTLLGLDGRDTMWGGAGNDWLYGGTGNDLMGGGSGSDRLFGGAGNDTLYAGDDASSDTLAGGLGNDVYWINGTAPDRIDALRDTVQEGAGGGTDTVYIKGSGWLAANVERMIAQEQDPGSRSLLIGNGLSNGIRGNSGANSLAGGGGDDTLDGMAGNDTLLGQSGDDVLLGRDGTDSLTGGSGDDLLMGGDGDDVLTAHDLFQYGNAGRDTLIGGRGDDRIDGGGTPTRWDAVDFGDPGDLFLFSKEVGGFGTDELTGFNDENDRIVFSRYGRDDLAGAVTVTSLGALPNNPGTVQWAADFSFRDGSSLHVTGVSIGAPAFTEGRDYVFAGSDTSGAGGLPLPLSGGGVPF
>CP029356.1|AWK88994.1|512499_513372_+|glycosyltransferase-family-2-protein
MDGVVAGAGVSVLIAAHRAHGTIVRAVESLMAQSWGAWEAVIASDDGTDYRATLLAAGLDDPRLVFTGTGRIGAGAPAARNAALRASRLPLVAPLDADDRFAPDRLALLAPLAARHGAAADNVAVVRDSDGRPLSTLFPETGGTGWLDADAFLRTSVPMFPVVRRDLDPLWEEDVTFCDDVVFNVRVLDRAGRMALVRRPLYEYRQREGSITFSADSGDRAERCYRHVLARLEGDGLGIADPGLRARFAAAIAAKRALNAAFEEAFRAGRCANFQEFLALRPQPAAEGVV
>CP029356.1|AWK88993.1|511673_512300_-|ATP-dependent-Clp-protease-proteolytic-subunit
MAQDGYTRFDDEPEQEPDEKSKESAQPPFAAVQQNLFKARTVLIFGQIDMKLAQAVSAQLLALAHESDDDITVVVNSPGGHVEAGDTIHDMIRFIKPRVKMLGTGWVASAGCHIYLAARKENRFCLPNTRFLIHQPLGGTGGRATDIAIEAKEIIRMRERLNRIIAQETGQPLEKVSKDTDRNYWMLADEAKEYGIVSHIIGTMEEFK
>CP029356.1|AWK88992.1|510074_511469_-|ethanolamine-ammonia-lyase-large-subunit
MAEYRHRLGQNSYRFADLKAVMACASPRRSGDELAGLAAESDEQRVAARRVLADLPLKTFLEEPLIPYETDEVTRLILDSHDAGAFRPVAHMTVGQFRDWLLSYEADAAALPALAPGLTPEMAAAVSKIMRNHDLVTVAAKCPVVTGFRTTVGLPGRLSSRLQPNHPTDDPTGIAGAVLDGLLYGMGDAVIGINPATDNLPACIALLEMLDTVRRRFDIPVQSCVLAHVTTTIQAIERGAPVDLVFQSVAGTEKANRGFGVTLALLREAHEAALSLKRGTVGSNVMYFETGQGAALSAEAHHGVDQQTVEARAYAVARAFDPLLVNTVVGFIGPEYLYDAKQIIRAGLEDHFCAKLLGVPMGCDVCYTNHAEADQDDMDVLMTLLATAGVNFLIAVPGADDVMLNYQSLSYHDVLGLRHLLKRPPAPEFEAWLERAGWLDDRRRLPPWPDQSSTVSALLGRIPA
>CP029356.1|AWK88991.1|509307_510078_-|ethanolamine-ammonia-lyase
MTDRGLPPDPWARFRTATRARIGLGRSGDGLPTAALLDFQLAHARARDAVHGAVDFDRLAADLAPLPSLRVHSAAADRAVYLRRPDLGRRLDEASRAALAAGRWDIVFVVADGLSAAAVQAHAAPLVRACAERLRGWEIAPVVLAGQGRVALGDEVAERLGARLVAMLVGERPGLSVADSLGVYLTWDPKPGRLDSERNCISNIHADGLPIGAAADKLCWLATEAARLKLTGVALKEDAPALPRPDAGLPPVLDGR
>CP029356.1|AWK88990.1|507806_509228_-|ethanolamine-permease
MSGSSKPELSKSLSGLQLWGIAVGLVISGEYFGWSYGWAAAGTLGFLVTTILIALMYTTFIFSFTELTTAIPHAGGPFAYSFRAFGPNGGFLAGFATLIEFVFAPPAIALAIGAYLNVQFPALDPKLVAVGAYVVFMGLNIAGVSIAASFELFVTVLAIFELLVFMGVVAPGFSWANFTAKGWAGSDTLTLEGFGGIFAAIPFAIWFFLAIEGAAMAAEETKDPRRTVPRAYIGGILTLVALAFGTMIFAGGVGDWTQLSNINDPLPQAMKAVVGESSGWLHMLVWIGLFGLIASFHGIIMGYSRQIFALARAGYLPPVFATLHPTRRTPHWATLAGGVVGIAAIYSDELVTIGGQPLTANIVTMSVFGAIVMYIMSMASLFRLRTVEPGLERPFRAPFYPVFPAISLVLAVLALGTMIYFNPLVFGLFVGLLAAAWVIYRLTAGLRTTGTLDPLLNLSAADLAQVEARTLTD
>CP029356.1|AWK88989.1|506553_507633_-|AraC-family-transcriptional-regulator
MTSHSLSLGRFPVSEPGRCPPIVQRHILAAAACGVTSFIERQGGRADRVLRRAGVDERSLDQPTLPLDLGSYVAMMEAAAEDTGNDNFGLLYGRQFQPEMLGLIGSIALASPTLGAALDNLARLFPFHQQATETRFCRDGDLLRLEYRILDGRVVERRQDAELTMGMFANVVRACLGPGWMPEEVQFEHARPEGWRQHEAVFDAPAHFGQRTNALIMRNRDLDRRMPGGDLGRLTELSDRLIRIARDTGPPGLLDRVKTEIRARLPEGCPYVEQVADSLGIARWTLQRRLADEGLAFSDLVEQVRRDLATIYVRQRHVPVADIAFLLGYSEVSAFSRAFRRWYGLSPNALRARAPKAVN
>CP029356.1|AWK88988.1|505786_506374_-|ArsR-family-transcriptional-regulator
MNLPPLVQAFVLHFGEMGSRWGINRTVGQIYALLFLSSEALNADDICDRLGFSRSNVSMGLKELQSWNLVRLQHRPGDRREYFSTPDDLWTIVRTLVEERKKREVDPTLSMLRELLMQSPASEEERHAQERMREMHELIELLTRWHADVQRLETDRLVQLLTLGSRVQKVLEMKDRLLSLPGGKKKSGKAEHDNE
>CP029356.1|AWK88998.1|519249_520314_-|hypothetical-protein
MGDTFRAGTLRRLNQLLGVIAEQSRAGEQGRVKARFKLASPAIPSAARPAARPAARACHLDRRTKPSREFVSRPRSRPLDSGAMHAIPADPSRSLLGHLRVGSGPRPVVVLHEWLADHRNYAAMTGWLDGGRFTWILADLRGYGLSRDLPGDFTAAEASADVLRLMDGLGHRRFDLVGHSMSGMIAQRVALDAPERVGRLVLISPVPPSGFRADAATLDRMAALIHDDVAAREAIAARTGHRYGAVWLDRKLALLRSSARPEAMRGYLRMFTGTDFAAQAAGLPLPILALLGEHDIEPYREPRIRAALEPLYPALAVRVCREAGHYMMLEAPVFTASSIDAALDAAGPPEGDTP
>CP029356.1|AWK88999.1|525595_527659_+|penicillin-binding-protein-1C
MAGAAAGVGLLAGGLLTLDLLFPPPLQRLQDLSVTVTDRTGEPLRVFTNRAGAWRLPAAAEQVAPLFVDLLLAYEDRRFNDHPGVDPLAVLRAAGQNLTAGHVVSGASTLTMQVARLLEPRPRTLRSKLIEMARAAQLEWRYDKQAILGMYLTLAPYGGNVEGIRAASLTLFGKPPKELTPAEAALLVALPQAPSLLRPDRAAERARAARDKVLDRAVLAGALSPRAAQEAKQEPVPAGKLALPASAPHLADLLRAAHPGAPLVATTLDGGLQRSVELLARREVETLHERAGIAVLVVDNRTRRILAWVGSPDFLDERRQGPIDMVRAVRSPGSALKPFIYGLGFDDGVIHPLTQVADVSTRFGDYAPRNFDRGFSGDLTIAEALQRSLNVPAVLVLDRVGPVRFAEALRRAGVTLVMPPGTTQPGLPVALGGASISLLDMATLYAGLARDGLVAPLRADPAAEGKAQEGEEVRLLSSAAAQQVRAILEGAPPPAGVVQDQGQQALGPIALKTGTSFGFRDAWAFGVTERFTVGVWVGRPDGTPSPDRYGRNTAAPLLYRVYDLLPRDRGRPAGPLAAGNAPPVLLRRLNAGDPTLAAGPRQPDRLRLVFPSNDMVLEALGPDGQGDPLTLSATGGRRPLSWLVDGRRVAVTPIRRDVEWRPDGAGTVRITVLDADGRSDSATVEIR
>CP029356.1|AWK89000.1|527681_528263_-|S-(hydroxymethyl)glutathione-synthase
MNDQTIRIHPSVDTGIRHGDPAFAGGRLHCNCAENPVEITITGNTAHNHVCGCTKCWKPSGALFSMVAVVPRDNLQVTANGDKLRVVDPAATIQRHACRDCGVHMFGRIENKDHPFYGLDFVHTELSDEEGWSAPEFAAFVSSIIESGASPDMMPAVRARLRELGLEPYDCLSPPLMDLIAAHVAKSRSAMAA
>CP029356.1|AWK89001.1|528549_528759_-|hypothetical-protein
MIASVRPGRTLHCTCCGRPFARPSNRGPAPLYCSSDCRKQMRVRLRMWSDASGGRRAMAGKRTDLLRAS
>CP029356.1|AWK89002.1|529720_531169_+|copper-oxidase
MTISRRQFLGTAGAALLVPALPGGLPAAPPAPRPLAIERRTLEVKGRAARVFGIRQPDGTSGLTLEPGRRFLVSLANRSGEEAIIHWHGQRPPYVQDGVADRNRPTLPDGAEQLYDFAAQPGTHWMHSHFGLQEQLLMAAPLVVRSEEDIRADLQEVTVLLHDFTFRDPAEVLGALTGGMMAHGAHGGGHGGGHAMPGHGTPNHAMPQGMAMDLNDVEYDAYLANDRTLDDPEVVRVEKGGRVRLRLINGATSTAFHIELGRLTGRVVAVDGLPVEPVEGSRFGMAMGQRLDILLSLPAEGGAFPVLARREGERQRTGIVLASAGAPVARLAGEAETAAGPVDLSLERRLVPLAPPAARPADVTATLRLTGGMMPYVWTIDDQPFGEHRPLRVAPGQRVEVTMVNQSHMAHPMHLHGHHFQVVGLDGTPLAGAVRDTVLVPVGGSVTIAFDADNPGRWPLHCHNLLHMAVGMMTEVVYDGYA
>CP029356.1|AWK89003.1|531191_531419_-|SlyX-protein
MADTPDPSTDQRLTDLEIRLAHHEKMAEEMSQVLFEQGRTIDRMAQQIKRLRDRLLELESSAARAPIDEPPPPHY
>CP029356.1|AWK89004.1|531470_532499_-|MBL-fold-metallo-hydrolase
MLPGGGRRAPPSPRPREGPDAGLLPDVSGIGPVDALLVSHGHPDHVGALHLLAQLGNPPVWATEPVLAGLPAGLDRRILPPQGAVEIVDVAVATGRAGHAPGGVWLHLAVGDGLLYMGDVCVESPVYAFDAPPRAGTIILDASYGIYDEGMGACREGLLPFLSGPALLPVPAGGRGPEIALLILSMGRPAPMMDDAVRGALGRLLGPDAAYVRDEARDGLARLFGDAPPPSSGPDRVVLAADANATGGTAAALVAAWEEQPGPPIVFTGYRAAGTPSQRLVESGRAVWRRWNVHPRLSDNAALVRSTGARQVIPAFGDARHLPVWREAFAPAAVTLDRTLDL
>CP029356.1|AWK89284.1|534255_535191_-|ABC-transporter-substrate-binding-protein
MAQQAAPSGTLTVYTSQPSDQMAEVIKLFNASYPDVKVELFRSGTTEVMNKLQAEFAAGGAKADVVLIADAVAASQLKKDGRLQPYAEAKVGSIPKSLVDPDMSWFGTKLITTGIVYNTTLVKAPPKSWKDLLAPEAARSTIMPSPLYSGAAAIHIGTLVQQPGFGWPYVETLAKNGAVAGKGNGSVIEAVARGEKAYGIIIDYMTYNAKAKGSPVDFVVPAEGVSVISQPVAILKGTRNPEAAKAFVDWQLGEASQRQAVAQGYYPVIPSVEAPKGYPPVSSMTLMSADPAAMMAADEAMKQKFAELFGG
>CP029356.1|AWK89285.1|535451_536744_-|metal-transporter
MSDAKPVPIQTTPLQGLPQGRHFWSLLGPGFVVAVGYVDPGNWATDIAAGSQFGFALLSAVLIACIAGVFIQTLIVRLTLATGRDLAALIRERFPKPVAMVVWAVSELAMVATDLAELLGSAIALKLLFGIPILWGVLISAVATFAILLMPGLRGRAPEMIISALMCVVVICFASELLITKPDVGLMAAGLVPTLELARDPEMLYLSLGIIGATVMPHNLFLHSGLVRSRLAACGDDLDRRRAARILTIDLGAALALAGLVNGSILAVAAVAFQGAAAAGATPGIEDAYALLGSSIGSGAALIFAVALLAAGQSSTATGTMAGQIVTEGFLGLRLSPLVRGVVTRSAALVPALAILWHADDSSVDALLVFSQVVLALTLPFILVPMLLMLRNRDLMGVLAMNPMTLRFASLTVALLTGLSGWLAGTTAIA
>CP029356.1|AWK89005.1|537326_538274_-|alcohol-dehydrogenase
MMLRELGRSGLRIAPFAFGGNVFGWTADEATSFRLLDAFVDAGFTLVDTADVYSRWVPGHSGGESETIIGRWLTRSGKRNRVVIATKVGMEMGPGEKGLSAAYIRRSVERSLQRLQTDVIDLYQSHEDDPATPLEETLGAYADLIREGKLRAIGASNYSATRLAEALEVSARNGLPRYETLQPRYNLYDRAEFEEALQPLCLREGIGVIPYYGLASGFLTGKYRTEADLSKSPRGQAARQRLNERGLRILAALDEVAAARRSTPAAVALAWLMTRPSITAPIASATSLDQLRELTAAAALSLSQPDLDRLDRASA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029356_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029356_3

666726-668743

TypeII

Consensus_repeat	Method
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	PILER-CR
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CRISPRCasFinder
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CRT

30 spacers

cas2,cas1,cas9

The CRISPR arrays of CP029356_3

>merge|CP029356|3|666726-668743|PILER-CR,CRISPRCasFinder,CRT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAACGCTTGGTCAATTTGTATCCTGAGGTGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCCAAGAGACGCGCGGCATGCGTCGCATCCCCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACATCTTCGTCGGCGGCGACCGCTCAATGGGCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGGAAGTAGCCGACAACGTGATCCAGCATCTTATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGTCGCGAGGTCGAGGGCGAGGACGCCGCCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACACCGGCACCACCATCACGGCGCTGGGCACCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAATGTCGGCTCGGTCGGCCTGACCGTCGAGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCGACAAGCGGCACCAGATGGCGGTCGTCATATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACTCGGCCGCCAGCTTGACGCGGGCGTACTTGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAGGTCCGCGGTCGGCGAGACCGAGCCCGGGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAACTCTGATGAAGTATGGTGCGAGTCCTGTATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAGCATCGACGCGAAGCCCACCATCCCGGTGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACTACGGGCTACATCGACTTCCTGCGCCATGAATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCCATGCATGGCCCCAATGGAGCCACCGCCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAGTCAGCAACTCATGGCGGATTTCCGTGCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGCCTCCCGCCTCCGGGACACTCCGAAGAGAATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGAGGATGGCGTTCTCAAGCGTCGTGCGCCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCGCAGCAGACCGCTGGGCAACAGAGCGTCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGATGGTGCGGATATGGTCCTGCACATGCAGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGAGCTGCGGGTGTCGGAGGTCGCGCTGGTCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGGATGGACCCGCCGGTCGGCGTCTTCAACCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCGGGCAGAGAATAAGCGGATGACGGCGGACATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCCGCGCTGTCTTGACCCACTTCACGCCGTCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCCGCGCTGTCTTGACCCACTTCACGCCGTCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGACGTCGGCGGCGTCGACGCGCGACAGCTGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACAACCGGGTTCTCGTCCATGTCTACTGGAGCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGCAAACGTGCTGCTTGCGGGCCTTCACCACCATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACCTTCAGCAGGTCGTAGACGTTGACCCCGAAATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGCGTCAGGTCGCTGTCCGGGTGGACGCGCGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAACGGAATCAACATCTTCTTCAACGGCGGCGGGATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC

>CP029356|3|3|666726-668743|PILER-CR
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACGCTTGGTCAATTTGTATCCTGAGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCAAGAGACGCGCGGCATGCGTCGCATCCCC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ATCTTCGTCGGCGGCGACCGCTCAATGGGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAAGTAGCCGACAACGTGATCCAGCATCTT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GTCGCGAGGTCGAGGGCGAGGACGCCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ACCGGCACCACCATCACGGCGCTGGGCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AATGTCGGCTCGGTCGGCCTGACCGTCGAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGACAAGCGGCACCAGATGGCGGTCGTCAT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TCGGCCGCCAGCTTGACGCGGGCGTACTTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGGTCCGCGGTCGGCGAGACCGAGCCCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACTCTGATGAAGTATGGTGCGAGTCCTGT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGCATCGACGCGAAGCCCACCATCCCGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TACGGGCTACATCGACTTCCTGCGCCATGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCATGCATGGCCCCAATGGAGCCACCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGTCAGCAACTCATGGCGGATTTCCGTGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCCTCCCGCCTCCGGGACACTCCGAAGAGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGGATGGCGTTCTCAAGCGTCGTGCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGCAGCAGACCGCTGGGCAACAGAGCGTCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GATGGTGCGGATATGGTCCTGCACATGCAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGCTGCGGGTGTCGGAGGTCGCGCTGGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGATGGACCCGCCGGTCGGCGTCTTCAACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGGGCAGAGAATAAGCGGATGACGGCGGAC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GACGTCGGCGGCGTCGACGCGCGACAGCTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACCGGGTTCTCGTCCATGTCTACTGGAGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCAAACGTGCTGCTTGCGGGCCTTCACCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CTTCAGCAGGTCGTAGACGTTGACCCCGAA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCGTCAGGTCGCTGTCCGGGTGGACGCGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAATCAACATCTTCTTCAACGGCGGCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC

>CP029356|3|2|666726-668743|CRISPRCasFinder
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACGCTTGGTCAATTTGTATCCTGAGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCAAGAGACGCGCGGCATGCGTCGCATCCCC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ATCTTCGTCGGCGGCGACCGCTCAATGGGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAAGTAGCCGACAACGTGATCCAGCATCTT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GTCGCGAGGTCGAGGGCGAGGACGCCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ACCGGCACCACCATCACGGCGCTGGGCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AATGTCGGCTCGGTCGGCCTGACCGTCGAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGACAAGCGGCACCAGATGGCGGTCGTCAT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TCGGCCGCCAGCTTGACGCGGGCGTACTTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGGTCCGCGGTCGGCGAGACCGAGCCCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACTCTGATGAAGTATGGTGCGAGTCCTGT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGCATCGACGCGAAGCCCACCATCCCGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TACGGGCTACATCGACTTCCTGCGCCATGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCATGCATGGCCCCAATGGAGCCACCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGTCAGCAACTCATGGCGGATTTCCGTGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCCTCCCGCCTCCGGGACACTCCGAAGAGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGGATGGCGTTCTCAAGCGTCGTGCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGCAGCAGACCGCTGGGCAACAGAGCGTCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GATGGTGCGGATATGGTCCTGCACATGCAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGCTGCGGGTGTCGGAGGTCGCGCTGGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGATGGACCCGCCGGTCGGCGTCTTCAACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGGGCAGAGAATAAGCGGATGACGGCGGAC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GACGTCGGCGGCGTCGACGCGCGACAGCTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACCGGGTTCTCGTCCATGTCTACTGGAGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCAAACGTGCTGCTTGCGGGCCTTCACCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CTTCAGCAGGTCGTAGACGTTGACCCCGAA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCGTCAGGTCGCTGTCCGGGTGGACGCGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAATCAACATCTTCTTCAACGGCGGCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC

>CP029356|3|2|666726-668743|CRT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACGCTTGGTCAATTTGTATCCTGAGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCAAGAGACGCGCGGCATGCGTCGCATCCCC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ATCTTCGTCGGCGGCGACCGCTCAATGGGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAAGTAGCCGACAACGTGATCCAGCATCTT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GTCGCGAGGTCGAGGGCGAGGACGCCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	ACCGGCACCACCATCACGGCGCTGGGCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AATGTCGGCTCGGTCGGCCTGACCGTCGAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGACAAGCGGCACCAGATGGCGGTCGTCAT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TCGGCCGCCAGCTTGACGCGGGCGTACTTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGGTCCGCGGTCGGCGAGACCGAGCCCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACTCTGATGAAGTATGGTGCGAGTCCTGT
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGCATCGACGCGAAGCCCACCATCCCGGTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	TACGGGCTACATCGACTTCCTGCGCCATGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCATGCATGGCCCCAATGGAGCCACCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AGTCAGCAACTCATGGCGGATTTCCGTGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCCTCCCGCCTCCGGGACACTCCGAAGAGA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGGATGGCGTTCTCAAGCGTCGTGCGCCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGCAGCAGACCGCTGGGCAACAGAGCGTCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GATGGTGCGGATATGGTCCTGCACATGCAG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GAGCTGCGGGTGTCGGAGGTCGCGCTGGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGATGGACCCGCCGGTCGGCGTCTTCAACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CGGGCAGAGAATAAGCGGATGACGGCGGAC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CCGCGCTGTCTTGACCCACTTCACGCCGTC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GACGTCGGCGGCGTCGACGCGCGACAGCTG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	AACCGGGTTCTCGTCCATGTCTACTGGAGC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCAAACGTGCTGCTTGCGGGCCTTCACCACC
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	CTTCAGCAGGTCGTAGACGTTGACCCCGAA
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GCGTCAGGTCGCTGTCCGGGTGGACGCGCG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC	GGAATCAACATCTTCTTCAACGGCGGCGGG
ATTGTAGCCGATGGGAAACCGCGGTCCAGCCGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP029356.1\|AWK89096.1\|671091_671892_-\|class-II-aldolase/adducin-family-protein	unknown	unknown	gnl\|CDD\|235743
CP029356.1\|AWK89294.1\|673144_674131_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270276
CP029356.1\|AWK89097.1\|671972_673100_-\|alkanesulfonate-monooxygenase	unknown	unknown	gnl\|CDD\|238527
CP029356.1\|AWK89087.1\|640985_642623_-\|fumarate-hydratase	unknown	unknown	gnl\|CDD\|237955
CP029356.1\|AWK89100.1\|676000_676912_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237907
CP029356.1\|AWK89291.1\|640236_640923_-\|RNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
CP029356.1\|AWK89102.1\|677948_679553_-\|sulfurtransferase	unknown	unknown	gnl\|CDD\|238791
CP029356.1\|AWK89090.1\|655715_656111_-\|hypothetical-protein	unknown	unknown	unknown
CP029356.1\|AWK89088.1\|642839_647018_-\|peptide-synthetase	unknown	unknown	gnl\|CDD\|341253
CP029356.1\|AWK89094.1\|668824_670030_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
CP029356.1\|AWK89095.1\|670060_671128_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
CP029356.1\|AWK89292.1\|657786_658155_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366690
CP029356.1\|AWK89092.1\|662959_665353_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187774
CP029356.1\|AWK89093.1\|665349_666312_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
CP029356.1\|AWK89089.1\|653694_655704_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|372641
CP029356.1\|AWK89099.1\|675060_675873_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|183100
CP029356.1\|AWK89091.1\|656181_657362_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP029356.1\|AWK89101.1\|676941_677937_-\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270276
CP029356.1\|AWK89098.1\|674208_675054_-\|sulfonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
CP029356.1\|AWK89293.1\|666345_666651_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043

Protein	Function_ID	Function_description	E-value
CP029356.1\|AWK89096.1\|671091_671892_-\|class-II-aldolase/adducin-family-protein	gnl\|CDD\|235743	PRK06208, PRK06208, class II aldolase/adducin family protein.	1.27587e-156
CP029356.1\|AWK89097.1\|671972_673100_-\|alkanesulfonate-monooxygenase	gnl\|CDD\|238527	cd01094, Alkanesulfonate_monoxygenase, Alkanesulfonate monoxygenase is the monoxygenase of a two-component system that catalyzes the conversion of alkanesulfonates to the corresponding aldehyde and sulfite. Alkanesulfonate monoxygenase (SsuD) has an absolute requirement for reduced flavin mononucleotide (FMNH2), which is provided by the NADPH-dependent FMN oxidoreductase (SsuE).	8.04394e-86
CP029356.1\|AWK89087.1\|640985_642623_-\|fumarate-hydratase	gnl\|CDD\|237955	PRK15389, PRK15389, fumarate hydratase; Provisional.	0
CP029356.1\|AWK89100.1\|676000_676912_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|237907	PRK15092, PRK15092, DNA-binding transcriptional repressor LrhA; Provisional.	2.70203e-60
CP029356.1\|AWK89291.1\|640236_640923_-\|RNA-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.78885e-67
CP029356.1\|AWK89102.1\|677948_679553_-\|sulfurtransferase	gnl\|CDD\|238791	cd01533, 4RHOD_Repeat_2, Member of the Rhodanese Homology Domain superfamily, repeat 2. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue.	4.71834e-54
CP029356.1\|AWK89294.1\|673144_674131_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270276	cd13558, PBP2_SsuA_like_2, Putative substrate binding domain of sulfonate binding protein, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.89174e-88
CP029356.1\|AWK89088.1\|642839_647018_-\|peptide-synthetase	gnl\|CDD\|341253	cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.	0
CP029356.1\|AWK89094.1\|668824_670030_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	5.39885e-47
CP029356.1\|AWK89095.1\|670060_671128_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	2.86677e-25
CP029356.1\|AWK89292.1\|657786_658155_-\|hypothetical-protein	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	5.43953e-09
CP029356.1\|AWK89092.1\|662959_665353_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|187774	cd09643, Csn1, CRISPR/Cas system-associated protein Cas9. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Very large protein containing McrA/HNH-nuclease related domain and a RuvC-like nuclease domain; signature gene for type II.	3.43076e-50
CP029356.1\|AWK89093.1\|665349_666312_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	5.62101e-92
CP029356.1\|AWK89089.1\|653694_655704_+\|ATP-binding-protein	gnl\|CDD\|372641	pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.	4.97657e-11
CP029356.1\|AWK89099.1\|675060_675873_-\|ABC-transporter-permease	gnl\|CDD\|183100	PRK11365, ssuC, aliphatic sulfonate ABC transporter permease SsuC.	2.53299e-83
CP029356.1\|AWK89091.1\|656181_657362_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.33721e-70
CP029356.1\|AWK89101.1\|676941_677937_-\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270276	cd13558, PBP2_SsuA_like_2, Putative substrate binding domain of sulfonate binding protein, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.41619e-90
CP029356.1\|AWK89098.1\|674208_675054_-\|sulfonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.3815e-95
CP029356.1\|AWK89293.1\|666345_666651_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.28701e-22

>CP029356.1|AWK89293.1|666345_666651_+|CRISPR-associated-endonuclease-Cas2
MWMMVLFDLPVLTKRERKAATAFRKFLLDQGFEMSQFSVYLRHCVGKEQTEALTRRIEKAAPSTGKVHIVFITDKQYETIVCFDGRVRQPSRKNPEQYVLF
>CP029356.1|AWK89093.1|665349_666312_+|type-II-CRISPR-associated-endonuclease-Cas1
MTGRIVEIAEDGRHLSLSRGFLVVEGQGREIGRVPLDDIGAVVANAHGLTYSNNLLLALAERGAVVVLCGPNHMPTAFLWPVDGHHVQAQRMRAQLNVPVPQTKRLWQLLVRAKVRQQGAVLEARGAPAGAFETLARKVRSGDPDNIEAQAARRYWPLLFGDDFRRDTDAAGVNGLLNYGYAILRSTVARAVMGAGLHPTLGLFHHNRANPLCLVDDLMEPFRPFVDLAVARLADAGHDAVTPETKRFLALVPSLDLPTAEGTTPLSTVVMRAATSLAQAYENGEAALDLPAGEGTKAWAPMPLEWPAPPPAPSKVPQPA
>CP029356.1|AWK89092.1|662959_665353_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MAADRRAARYHSARRACQADKEGHWLQGHPQGAEARLRRRVLHESTRRPELATDETSAVLADKKRFGLRWARLTLAEQDEVVERLLSETDEGALIDWLVARWDLEPDAAARVADAPLPDFHLRVGRKALAALLPVLETESRDGRPIRYDEAVPVAFPGAHHSDRRPGERFDRLPYYAKALERHVAFGTGEPDDPEEKRLGRLTNPTVHIGLNQVRTVVNALIERYGPPYEIVVELARPLKQSQEARRRNEKEQAENQRKNEERKALLRSVNAPVNGRNLMKLRLWEEQGTGVNRRCPYTGETIGLELLLSDKVDIDHILPFSRTLDDSAANKVVCLTAANRDKRNLTPYERWHGDEVRWSRILGCVEDLPPNKRWRFSEGAMNRWDEEGGFLARQITDTQYLARLAREYLRHVCNPDRVRVSPGRLTALLRRRWGIDSILRDHNREGGDVPVDATFAKNRDNHLHHALDAAVIGCIDQGMVQKVAQAASRAEDLGLDRLMDDIDDPWDGFRDELAVRVRGVTVSHKPEHGTGGRLHEDTAYGPTTEAERAKGFNLVYRKPLDGLTEGEVKAIRAPELRKKVQERLDGCRAAGMDHKQAMLRVAAELSSHEGPWKGIRHVRILKKEASPIWLPDADGRIYKGLIAGDIHHVDIIARDDGRWIGRAVTLFDARRTALPDGRAAPCAPGESERFVMRLHKGDAVALTQDGRRRVMKVHILEPSQNRLRLAEHQEAGSLQKRHDDNDDLFRWLIVTYDGLRERGARRVTVSPMGEVNDPGFPRWATRDAISPRRRNKADAS
>CP029356.1|AWK89292.1|657786_658155_-|hypothetical-protein
MEVITGDVGRRTWSPEEKERILAEGAVPGAVVPEVARRHGLRPQQVFGWRREARAANRLQEEGLGVRAGGAGHHAAPSRTEGAPGHRGADRRCGGARAGRHGRRHRQGGAARGEGVAVRASR
>CP029356.1|AWK89091.1|656181_657362_+|IS3-family-transposase
MTKTRRSFTDDFKREAVALLEASGRPLEHVARELGLQASVLRNWRRVAQGHPPRPRSGSPAVSDTAMPAKPDEQTAEIARLRRELDRVRQERDILKKANQHLLGNTEMRFRFIEDHRDEFPTRLMCSVLEVSASGYYAWRGRPESQRAAANRQLLVEVRRVHGHHHGRYGSPRVHAALRAEGVAASRGRVARLMRRHGIRGAAARRFRPVTTDSRHGLPVAPDLLGQAFQVAEPNRVWLADITYLPTAEGWLYLAALLDLATRKIVGWAMRDHMRAELATSALVMAIQRQRPAVGLIQHSDRGSQYASRDYRDLLQAAGMRQSMSRKGCCYDNAPMESFFHTLKVELVHRTRFETRDQARREVFAYIETYYNRQRAHSAIGYITPEQAELRSA
>CP029356.1|AWK89090.1|655715_656111_-|hypothetical-protein
MTATTDTAAAVQEWLARRRDIDIARSLRRLFHESGAKPSGWRSRRDKAVVMADAELAAFLKSVAAAGPDGWREEIDRVRLRQVKAARKRGRKPEGVSAPALSLAAIVGLLPTWRAWGRMLIDAGKVPSMGN
>CP029356.1|AWK89089.1|653694_655704_+|ATP-binding-protein
MSMSGEQGTLFDERFLGRYAGTIMSDPTTALVELVANAWDAYATTVEIQWPDRESGAHFQITDNGKGMTPEQFEVRWRTLDYDRISYQGAFEDPPADLPAALPRPVYGRNGKGRHAAFLFSSPYRVRTWRDGVEAIYLVSQGKQNPIEVLLESRRDGIQGHGTEINGVHLLPCSFTAGDVRALLSTRFLTNPEFAVFVDGVRVGFSDVPSDCLQELNVDVPGYGQVKVLVIDSQRADRTTKQHGIAWWVNRRLVGQCGWRMSDQEKVLDGRTEEAKRYTFIVHADLLAPAVQADWGDFRPEHPVWLQTQEAVQNAIRNVILGITKEKRAKAKETVRRSHRNIVKDLPGISRERWNRLLDQVVDQCPSMSATQIDQVMGLLANLELAESQYSLLEKLHALKPDELDQWDAILERWTISTAKVALDEIEKRLKLIEEIRAKSEIPGTDEVHEIQPLFGQALWIFGPQFESIEFTSNRGMTTVIKQLFGGNQRGSLNRPDFVVVPDGSVGFYSRPSFDTEFNENGIDVLVIVELKSPGVPVGSDEKGQVWKYIRELMKKGYVTDRTSVYGYVLGDRIDSIDGGERKEGDRIFIRPMLYNTFVGQGEKRMLNLHRRLLDAPFMQAAMAEFLAKPEVEAMPAQMSLLNVPAVQEGGEVPAPLPTGNSPDEAVMA
>CP029356.1|AWK89088.1|642839_647018_-|peptide-synthetase
MQPSSAVRPGPQGPSRRQRAELQKEGLGSVTLLNARTPVQDEPRAPFLSQPSTAGTPSRPGVLLGVEDPSLLRDELLPEILRASVDRRPDRTAIQFDGRRISYAELDSRANRVAQGLRARGIGRGSFVGLWMARSLDLHVVLLGILKAGAAYIPFDADAPAERVATSLTDCGAPAILVDLVTGTRAAGLGDVQVLRIGDVLSTTDTAPDLRAEGMTPDDPAYAIYTSGSTGKPKGIVISHRNICHYLRAANTVYGLTDEDVVFQGASVAFDLSLEEIFVPYLVGATLWVASRQVLDEVDRLADVLNEAGITVLDTVPTLLAMLPKDVPSLRVVILGGEACPPAVASRWCRPGRRLFNSYGPTETTVVATIAEVRPDETVTIGRPIPNYSCYVVDESLQPVGPGVQGELLIGGPGVARGYLGRPELTAEKFIPNPFRADGLDPVLYRSGDAVSLDASGNLLFHGRIDDQVKIRGFRLELGEIEAKLTDLPGVAQATVVLRNDAGIDRLVAFLVPQAGVGIDRVELRTALMAQLPAYMVPAHFEVVPSLPRLTSGKADRKALQVAPLTCEGSGDEQEEPRTETEAALLTAAQRVFPGQIIPFDGDFFLDLGGHSLLAARFVSAVREVKPLDGLTLQDVYGARTLRAMAARLDGKAGRGGGGPAKRDLSFTPPPLLRRFLCGAAQAAALPFILALMTAQWLGVFVSYMLLSGEEASFLQEVVTLLGVYVVINIATLVIAVAAKWLIIGRTKPGRYPLWGVYYYRWWLVQRFISLLHLKWFQGSPLMRVFLRILGARVGDDALIGEFESGAVDLVSIGRGAAIGGKVKMANAEVVGNELIIGTIEIGDDAYIGTSCVIGHDAVVGKGTELADLTALPAGARTGEYELWDGSPARRTGMVDREALPEQATAGKLRKAMQTVIYAVAVLGLPPIGLIPIFPAFYLFDKLDGIIGSALGVNYLYYLPVIAWPTAMMLVAATVLLIAAVRWILLPRVKEGSYSVHSWFYVRKWVVALSTEVMLETLSSLYATVYMRAWYRLMGAKIGRDAEISTNLAGRYDLVEIGEKCFIADEVVLGDEDVRRGWMRLKKVKTEARVFVGNDAVVPPGALIPTGSLIGIKSKPPANAEIGAGDTWFGSPPIKLPVRQKFDNVAANWTFEPSRARRFGRAVFEAFSLSMPTMLFITFGTLAVELFAPAILDGRYGSFLLEFIAVSVAIPLAMVLAVVLTKWALMGRYTPTMKPMWSWWAMRTEAVAVLYWGLAGKVLLDHLRGTPMLPWMLRLFGTKFGKGVFMDSTDITEFDCVSVEDFSAVNALSALQTHLYEDRVMKVGRVAVGKGVTVGAGATVLYDTHVGDYARLGPLTLVMKGEEIPAHTEWVGAPAEPAMSMDHGDGTMKAAA
>CP029356.1|AWK89087.1|640985_642623_-|fumarate-hydratase
MPDDISSPARGATGLFPLAKDETPYRKLSSDHVSVVEFDGEEILKVEPEGLRLLAEAAFADINHLLRPGHLAQLRKILDDPEASANDRFVALDLLKNANIAAAGTLPMCQDTGTAIVMGKKGRRVWTKGADEQALSEGARDAYLKRNLRYSQLAPISMYEEKNTRNNLPAQVEIYAEGEDAYKFLFMAKGGGSANKTFLHQATPSVLAPDRLLKFLEDKIRYLGTAACPPYHLAIVIGGLSAEQNLKTVKLASARYLDGLPTQGGEDAHAFRDLEMEAEVHKLTQAMGIGAQFGGKYFCHDVRVIRLPRHGASMPIGIGVSCSADRQAVGKITKDGIFLEQLETDPAKYLPEITADQLSDEVVKIDLNKPMSEIRATLSQYPIRTRLSLTGPLIVARDLAHAKLRQRLDGGEGLPDYFKNHPIYYAGPAKTPEGYASGSFGPTTAGRMDSFVDQFQAAGGSMVMLAKGNRSPEVTAACQKHGGFYLGSIGGAAARLAQDCIKKVECIEYPELGMEAIWRIEVEDFPAFIIVDDKGNDFFKELKLA
>CP029356.1|AWK89291.1|640236_640923_-|RNA-pseudouridine-synthase
MTPEEIQARVLYRDALMLILDKPAGLPVHAGPGGGPNLERYFSALRFGLPKPPALAHRLDRDTSGCLILGRHPKALRKLGILFQDGKVDKTYWAVVAGSPPTDAGRMEWPLKKVSNRTGGWRIVTAEDGQAAVTDYVVRGRGNGTTWLELTPHTGRTHQIRVHCAALGCPLLGDPQYGGPDGQPLHLHSRAISLPLYPKREPVGATAPVPEHMQAALEACGYREEAGA
>CP029356.1|AWK89094.1|668824_670030_-|acyl-CoA-dehydrogenase
MPFDDPPFPAAPFGDASTATVVDEASIAALAAEFALRAAEHDAAASFPFENFERLQAAGLLALVDPPSAGGKGGGLRDALAVVNGIARGEPSTALVLVLHYVIHNQLWHGPAWPEALRDRIARTAATDGALINILRVEPELGTPHRGGLPATVARKVPGGWRISGTKIYSTGIPALSWLGVWARTDDAEPLVGTWVVPRGIGFAEQGIEVRQTWNHIGMRASGSHEVVFRDIFVPDDHAGELRPPAGWAAPDAAATAWMSTLFSGVYDGIARSARDWLVGFLHARRPTALGGASLATVPRLQEALGGIEALLLTNGVLLRSLSAAVDGGSAPSQSDSLLVKYTVTNNAIDAVARALEVTGNPGLSRDNPLERHHRDVLCARVHAPQNDMILTGAGRAALSR
>CP029356.1|AWK89095.1|670060_671128_-|ABC-transporter-substrate-binding-protein
MDRGGRTRPARLTLSLPISCKGPRPMTANPPLSLTRRGLIAAGAVTLAAPFVLRRRAVAAEPLRLSWNAGAVCFSAVPLAFQLDLFKKHGLEVELVNFTGSTDQLLEAIATGKADAGVGMALRWLKPLEQGFDVKISAGLHGGCMRLFGAKAAGVKTVLDLPGKVIGVSDMASPSKNFFSVVLTKFGLDPNKDVEWRQFPADLLGLAVEKGEIHAIADGDPLVWRHTKDPRMVEITNNVCGEFATRTCCLVGVRGSLLRDNRPAARALTAALIEAQHAAYADLRAAAAAYAPFAPKFPVEELEAMLRSHAHNVTPVGDELRHQLALYTDELKSVSVIKRSTDSQRFAGRITVDLA
>CP029356.1|AWK89096.1|671091_671892_-|class-II-aldolase/adducin-family-protein
MTHIQPRPIGSEGRKFWPPVDPVSYSSVEEERQHRKQRLAATFRLFGRYGFDQGLAGHVTARDPEHPDRFWINPLGQHFRTIRVSDLHLVDGDGTILQGDRAINQAGFTIHSAIHRARAEVVAAAHTHSTYGKAWSALGRLLNPLSQDAAAFYEDQVIFDPYSGVVLTEGEGERLVETLGDRKLAILKNHGLLTVGPTVEAAAWWFISADNAAHTQLLAEAAGQPQPIDHETALLTRSQVGTHQGGAYSFHPLWEWIVAAEPDLLD
>CP029356.1|AWK89097.1|671972_673100_-|alkanesulfonate-monooxygenase
MTTASAHPLRFVGFVGNHNSSEIIPRQGPVVDRDYIETVAKAHELGGFDSVLQAFHADAPDSLQVSQHITSVTDRLGVLIAHRPGFQAPTILARQLATLDQLSRGRVAINVITGAERSELARDGNTVDDKDDRYARTSEFLDIVRAEWTSDEPFDYRGRFYRVEKAFSQVKPYNPSGIPVWIAGASAAAVEVAGRHADTYAVWGETHDQVRELLARVRAAVAKAGRPQPAFSLSLRPILADTEDAAWARAEAIHEKAKALLDRTGFTRGDLPSNEGARRLLAIADAAADRGHRHDKRLWTAIAALTGAKGNSTSLVGTPDQVADALLDYYDLGVTTFLIRGFDPLPDAIAYGRELLPRVRQLVTERQRAQAVAAE
>CP029356.1|AWK89294.1|673144_674131_-|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein
MGRRNLLRSAAGACGALALGGLPTLSHAASGPTSETVLRIADYKAADGLVLEASGNARSGYRSQFAEFASGNLIVEAINAGSIDVGSSSEIPPAFGIAAGARLSIVAVIKDDVNWQVVLVPPGSPIRSIADLKGKRVGYVRATTTQYYLARMLGEAGLRFTDIQAISLTPSEGQAAFDQGALDAWAIYGYSVPFAVRKGARVLITSNGYLSGNYLYLASPDALGDPGKSAAIGDYLLRLRRAFAWRAANLERWAQVHSAAIGVPVETDLEILRKTSRQRDLAPITDADIASAQAVADTFHQLGVLPRRIDIAPAFDRRFADVLSRPLS
>CP029356.1|AWK89098.1|674208_675054_-|sulfonate-ABC-transporter-ATP-binding-protein
MSHALSRISASPPAVGKPVVGVRGLVRNFGNGNVLDGLSLDLQPGSFTALLGRSGCGKSTLLRTLAKLDPAPEGTVQVPDERAVVFQEPRLVPWMRVLRNVTLGLRHPDAEARGLAALAEVGLSHRARAWPLTLSGGEAQRAALARALVREPRLLLLDEPFAALDALTRMRMQGLVETLWRAHAPAVLLVTHDVDEALLLADRAVVMANGRIAADIPIPLARPRRHGDPGFIALRSRLLAELGVSEEHPAGREAHRADPRAGGAVPGGYGLPAGAAAAPDR
>CP029356.1|AWK89099.1|675060_675873_-|ABC-transporter-permease
MTAATATRPTGRRSRVLTLPAVLRRCAVPLALLVLWQASVGLGWISTRSIPSPGQILAAFWDLTVSGELAVHLLVSLGRVSAGLAIGVSAGTVCALIAGLSRRGEDALDALLQMLRTLPHLALVPLFILWFGIGEAPKIALVALGTAFPIYLNLFAGIRTVDAKVVEAVSTLGLTRWELIAQVILPGALPAFLTGLRYALGVAWLSLVVGEQINASSGIGYLAMTAREFLRTDVIIVALIVYAILGLLADLTVRLIERSALVWRPAFIKE
>CP029356.1|AWK89100.1|676000_676912_-|LysR-family-transcriptional-regulator
MAMRPTNLDMDVLRAMVIAMEHGGFARAAERLGRTQSAISLQMKKLEEQVGQPLFRKAGRTVALTDAGDLLLGYARRIVALNDEALSAARGRAMDGTVRVGFPQDLAERRLPAVLGAFHRAHPRVHVEAQVGRGRELRERVAQGALDLALAFGEIGGNPAGAASGNGVATLAHLPVVWVAHGGFRPDPESPLPLALLDAPCMFRQHGIERLDGDGCPWRITFTSPSLSGLWAAVEAGLGVTVRTPLGLPDTLTILGQRHGLPALGSVPLELHRAPSAAAPAVDRLHAILANSLPAVLNQTEAS
>CP029356.1|AWK89101.1|676941_677937_-|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein
MPSFSRSLPPLSRRGVLGLGAGAVAAGLSPLGIPAARAAIPAGTVLKVGDQKGGVQSVLEAAGLLADLPYRIEWSQFPAAAPLLEALNAGAIEVGYAGDAPTTFALAAGTSAKIIGAVRSNPQSTTILVPGASAIGSVADLKGKTIGTGRGSIGHYLVLAALKANGLKPDDVKIAFLLPSDAKSALAAGSIDAWSSWGIYVSQALLVDGARAVVTGTGLMSGLSYQSATLETITTKREALADLIRRTAAARLWALENSTAYADIWARAVGVDPAIARHTFGVERARPVAIDARVITDQQATADVWREFGIIQKRLDAAAIFDPGFNSVLPA
>CP029356.1|AWK89102.1|677948_679553_-|sulfurtransferase
MTAAAPLSTRHPADIRRAWIERDEVALLDAREEGPYSLAHPLFAVSVPLSRVELLAYDLLPRRDVPITVYDNGEGYAEPAARRLQTLGYGDVTLLEGGLAGWIAAGFEVYRDVNVPSKAFGEWVEHHRHTPSLPAGEVKALIDAKADLVILDARRFEEYRTMSIPGGISVPGAELVKRIHDIAPNPDTLVVVNCAGRTRSIIGTQSLVNAGIPNRVAALRNGTIGWTLAGLTLDSGRGERFPEVSAEGDARGRRAARAVADRAGVGRIDAATLDRFRSDERRTLHLFDVRTPDEYEAGHPAGFRHAAGGQLVQATDEFVAVRGARIVLADDPAGGGGPRADMTASWLAQLGWEVHVLEGDVPALGAESGPDRRRLPPAPEVGAEVISPHDLLPLLENGEAAVIDITRSPRYRAGHIPGAWFSTRARLAGTIARLPKGVRPVLTCGDGTLTRYAVADFPADRRPLLLEGGTKGWVAAGLPLSTDLNRLGPDPDDVYKRPYEGTDNSAAAMQGYIDWELELVEQLKRDGAHNFRVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029356_1	1.2\|343787\|42\|CP029356\|PILER-CR	343787-343828	42	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	343782-343823	0	1.0
CP029356_2	2.1\|517545\|38\|CP029356\|CRT	517545-517582	38	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	517545-517582	0	1.0
CP029356_2	2.2\|517620\|39\|CP029356\|CRT,PILER-CR,CRISPRCasFinder	517620-517658	39	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	517620-517658	0	1.0
CP029356_2	2.3\|517696\|37\|CP029356\|CRT,PILER-CR,CRISPRCasFinder	517696-517732	37	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	517696-517732	0	1.0
CP029356_2	2.4\|517770\|40\|CP029356\|CRT,PILER-CR,CRISPRCasFinder	517770-517809	40	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	517770-517809	0	1.0
CP029356_3	3.1\|666762\|29\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666762-666790	29	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	666762-666790	0	1.0
CP029356_3	3.2\|666827\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666827-666857	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	666827-666857	0	1.0
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	666894-666923	0	1.0
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	666960-666990	0	1.0
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667027-667056	0	1.0
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667093-667122	0	1.0
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667159-667188	0	1.0
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667225-667254	0	1.0
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667291-667320	0	1.0
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667357-667386	0	1.0
CP029356_3	3.11\|667423\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667423-667452	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667423-667452	0	1.0
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667489-667518	0	1.0
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667555-667584	0	1.0
CP029356_3	3.14\|667621\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667621-667650	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667621-667650	0	1.0
CP029356_3	3.15\|667687\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667687-667716	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667687-667716	0	1.0
CP029356_3	3.16\|667753\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667753-667782	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667753-667782	0	1.0
CP029356_3	3.17\|667819\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667819-667848	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667819-667848	0	1.0
CP029356_3	3.18\|667885\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667885-667914	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667885-667914	0	1.0
CP029356_3	3.19\|667951\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667951-667980	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	667951-667980	0	1.0
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668017-668046	0	1.0
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668083-668112	0	1.0
CP029356_3	3.22\|668149\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668149-668178	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668149-668178	0	1.0
CP029356_3	3.23\|668215\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668215-668244	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668215-668244	0	1.0
CP029356_3	3.23\|668215\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668215-668244	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668281-668310	0	1.0
CP029356_3	3.24\|668281\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668281-668310	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668215-668244	0	1.0
CP029356_3	3.24\|668281\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668281-668310	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668281-668310	0	1.0
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668347-668376	0	1.0
CP029356_3	3.26\|668413\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668413-668442	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668413-668442	0	1.0
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668479-668509	0	1.0
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668546-668575	0	1.0
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668612-668641	0	1.0
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	668678-668707	0	1.0
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	42628-42657	4	0.867
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_010848	Flavobacterium sp. KI723T1 plasmid pOAD2 DNA, complete sequence	28731-28760	4	0.867
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	550805-550834	4	0.867
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	695126-695155	4	0.867
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	237317-237346	5	0.833
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	819836-819865	5	0.833
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	123349-123378	5	0.833
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	169466-169495	5	0.833
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1573579-1573608	5	0.833
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	484825-484854	5	0.833
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP010857	Marinovum algicola DG 898 plasmid pMaD2, complete sequence	175576-175605	5	0.833
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MG018224	Stenotrophomonas phage DLP4, complete genome	25494-25523	5	0.833
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	203666-203695	5	0.833
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	404130-404159	5	0.833
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	375203-375232	5	0.833
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	628365-628394	5	0.833
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1184708-1184737	5	0.833
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	MN304817	Phage 68_12, complete genome	17320-17349	5	0.833
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP048637	Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence	23261-23290	5	0.833
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP007791	Corynebacterium marinum DSM 44953 plasmid pCmarinum2, complete sequence	15586-15615	5	0.833
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	464082-464111	5	0.833
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	491431-491460	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	760839-760868	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	393069-393098	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	266569-266598	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP053709	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence	348627-348656	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP051543	Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence	30105-30134	6	0.8
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	119374-119403	6	0.8
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP022424	Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence	117148-117177	6	0.8
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	238934-238963	6	0.8
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP053445	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence	16313-16342	6	0.8
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	301423-301452	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	AB767244	Edwardsiella phage MSW-3 DNA, complete genome	1351-1380	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	346753-346782	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_LT963412	Pseudomonas syringae isolate CFBP3840 plasmid PP3, complete sequence	72370-72399	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	10648-10677	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NC_049478	Arthrobacter phage Mufasa8, complete genome	32336-32365	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP026559	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence	150997-151026	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP019872	Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200A, complete sequence	52842-52871	6	0.8
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	LR743532	Xanthomonas phage Bosa genome assembly, chromosome: 1	53971-54000	6	0.8
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_LR134458	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 16, complete sequence	20634-20663	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	820216-820245	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	242475-242504	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	828552-828581	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	17542-17571	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1085617-1085646	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	610028-610057	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	489418-489447	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	584729-584758	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1281336-1281365	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	127468-127497	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	127468-127497	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1820329-1820358	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1843297-1843326	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1880268-1880297	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1902502-1902531	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	2046750-2046779	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1528135-1528164	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1810699-1810728	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	417934-417963	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	785957-785986	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1888575-1888604	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1598209-1598238	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1827651-1827680	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1827745-1827774	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1822522-1822551	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1891238-1891267	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1762047-1762076	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1823873-1823902	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1900054-1900083	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1891205-1891234	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1797527-1797556	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1875026-1875055	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1889948-1889977	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1902501-1902530	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1790960-1790989	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1797839-1797868	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1875026-1875055	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1890047-1890076	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1797527-1797556	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1791609-1791638	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1796730-1796759	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1875026-1875055	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1875026-1875055	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1875026-1875055	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1890043-1890072	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1951904-1951933	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1890032-1890061	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1790985-1791014	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1806152-1806181	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1786788-1786817	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1847895-1847924	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1877804-1877833	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1872341-1872370	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1890032-1890061	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1790985-1791014	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1797838-1797867	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1824947-1824976	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1891028-1891057	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1790985-1791014	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1790985-1791014	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1890043-1890072	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1875031-1875060	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1890054-1890083	6	0.8
CP029356_3	3.12\|667489\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667489-667518	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1889855-1889884	6	0.8
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	NZ_CP038625	Arsenophonus nasoniae strain FIN plasmid pArsFIN13, complete sequence	17429-17458	6	0.8
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	386584-386613	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	75101-75130	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_017311	Desulfovibrio vulgaris RCH1 plasmid pDEVAL01, complete sequence	23757-23786	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_005863	Desulfovibrio vulgaris str. Hildenborough plasmid pDV, complete sequence	29201-29230	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_008741	Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence	174568-174597	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	93900-93929	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP026539	Desulfovibrio carbinolicus strain DSM 3852 plasmid pDCAR1, complete sequence	111368-111397	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP009572	Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence	131826-131855	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	MT498067	Microbacterium phage Bullzi2019, complete genome	16357-16386	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	MH779512	Microbacterium phage Miaurora, complete genome	16246-16275	6	0.8
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	MT498047	Microbacterium phage TinyTruffula, complete genome	16264-16293	6	0.8
CP029356_3	3.26\|668413\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668413-668442	30	JX173487	Pseudomonas phage Phi-S1, complete genome	5334-5363	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	717820-717849	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	717832-717861	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	716261-716290	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	720508-720537	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	707391-707420	6	0.8
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	717832-717861	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	629893-629922	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	697427-697456	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	248602-248631	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1614025-1614054	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	821858-821887	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	594594-594623	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	629892-629921	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1039626-1039655	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	682755-682784	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1401403-1401432	6	0.8
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	966285-966314	6	0.8
CP029356_3	3.2\|666827\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666827-666857	31	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	148851-148881	7	0.774
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	412885-412915	7	0.774
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1420393-1420422	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_017771	Deinococcus gobiensis I-0 plasmid P3, complete sequence	44356-44385	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	155111-155140	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	6297-6326	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	136550-136579	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	85468-85497	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MH825699	Streptomyces phage Darolandstone, complete genome	9560-9589	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_047988	Microbacterium phage Metamorphoo, complete genome	33651-33680	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	351362-351391	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	294971-295000	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	278025-278054	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	282556-282585	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	235140-235169	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	965413-965442	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	LR606150	Rhizobium sp. Q54 genome assembly, plasmid: 7	44834-44863	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	230994-231023	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	4354-4383	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP007516	Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence	88289-88318	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MN908694	Microbacterium phage RubyRalph, complete genome	14080-14109	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP009803	Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence	141876-141905	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	75074-75103	7	0.767
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP053345	Herbiconiux sp. SALV-R1 plasmid unnamed1, complete sequence	112910-112939	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	440505-440534	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	195146-195175	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1501380-1501409	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP025539	Vibrio harveyi strain 345 plasmid p345-185, complete sequence	181525-181554	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP011135	Escherichia coli VR50 plasmid pVR50A, complete sequence	51618-51647	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	CP051693	Escherichia coli strain SCU-318 plasmid pSCU-318-1, complete sequence	72275-72304	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP023351	Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence	70921-70950	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	LT906556	Escherichia coli isolate E. coli RL465 genome assembly, plasmid: I	56990-57019	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	438032-438061	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP038299	Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence	28779-28808	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP034238	Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence	13768-13797	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP034238	Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence	260513-260542	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP034238	Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence	282717-282746	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_AP018811	Escherichia coli strain E2865 plasmid pE2865-3, complete sequence	12485-12514	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP037947	Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence	6083-6112	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NC_016983	Photobacterium damselae subsp. damselae plasmid pAQU1, complete sequence	147114-147143	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP027554	Escherichia coli strain 2013C-3513 plasmid unnamed1	12243-12272	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	KX957970	Vibrio parahaemolyticus plasmid pVPS43, complete sequence	72152-72181	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	KX957971	Vibrio parahaemolyticus plasmid pVPS62, complete sequence	76612-76641	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	KX957969	Vibrio alginolyticus plasmid pVAS114, complete sequence	72152-72181	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	AP019705	Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome	7608-7637	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP020057	Escherichia coli strain AR_0069 plasmid unitig_3, complete sequence	14852-14881	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NC_006994	Pasteurella multocida 381 plasmid pCCK381, complete sequence	9438-9467	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP044149	Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1	9015-9044	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP021733	Escherichia coli strain AR_0114 plasmid unitig_1, complete sequence	65781-65810	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_LT985265	Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence	85943-85972	7	0.767
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	MN908685	Microbacterium phage PauloDiaboli, complete genome	69855-69884	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP013632	Rhizobium sp. N324 plasmid pRspN324b, complete sequence	336389-336418	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NC_012854	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete sequence	156732-156761	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	136169-136198	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	283233-283262	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP016291	Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence	231157-231186	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	740261-740290	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	171340-171369	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP050095	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence	168113-168142	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP050100	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence	175128-175157	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	378379-378408	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	155972-156001	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP053443	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence	137917-137946	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	178577-178606	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP048284	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248b, complete sequence	176337-176366	7	0.767
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NC_011984	Agrobacterium vitis S4 plasmid pAtS4c, complete sequence	91431-91460	7	0.767
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	1398-1427	7	0.767
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	164822-164851	7	0.767
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1274165-1274194	7	0.767
CP029356_3	3.8\|667225\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667225-667254	30	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	5527-5556	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK967402	Mycobacterium phage NihilNomen, complete genome	13334-13363	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MH697583	Mycobacterium phage EricMillard, complete genome	13565-13594	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MH399772	Mycobacterium phage Constella, complete genome	12098-12127	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	JF937090	Mycobacterium virus BAKA, complete genome	12917-12946	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK524521	Mycobacterium phage Schatzie, complete genome	12584-12613	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK524516	Mycobacterium phage Bobby, complete genome	13228-13257	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NC_041844	Mycobacterium phage Optimus, complete genome	12918-12947	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK524527	Mycobacterium phage ThreeRngTarjay, complete genome	13409-13438	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK279849	Mycobacterium phage Duke13, complete genome	12845-12874	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK524529	Mycobacterium phage Phoebus, complete genome	13565-13594	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK524504	Mycobacterium phage Hughesyang, complete genome	13455-13484	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MK967379	Mycobacterium phage HokkenD, complete genome	12848-12877	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	458482-458511	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	851813-851842	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	16983-17012	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	AY576273	Bacteriophage Phi JL001, complete genome	13083-13112	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NC_006938	Phage phiJL001, complete genome	13083-13112	7	0.767
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1840290-1840319	7	0.767
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_LR723678	Arsenite-oxidising bacterium NT-25 plasmid 2	196400-196429	7	0.767
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	44573-44602	7	0.767
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP015042	Rhodovulum sp. P5 plasmid pRGUI03, complete sequence	27392-27421	7	0.767
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_FO082821	Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence	277621-277650	7	0.767
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	146327-146356	7	0.767
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	225090-225119	7	0.767
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	48380-48409	7	0.767
CP029356_3	3.15\|667687\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667687-667716	30	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	4000-4029	7	0.767
CP029356_3	3.17\|667819\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667819-667848	30	NC_020060	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899a, complete sequence	211487-211516	7	0.767
CP029356_3	3.19\|667951\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667951-667980	30	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	207435-207464	7	0.767
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	613321-613350	7	0.767
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	459498-459527	7	0.767
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	KM659097	Paracoccus yeei plasmid pLM20P5, complete sequence	24598-24627	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	825340-825369	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP037914	Sphingomonas sp. AAP5 plasmid p213, complete sequence	33053-33082	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_013860	Azospirillum sp. B510 plasmid pAB510f, complete sequence	34562-34591	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	240800-240829	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1673405-1673434	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	249416-249445	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1553541-1553570	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1572153-1572182	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	30892-30921	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1792334-1792363	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NC_004929	Ruegeria sp. PR1b plasmid pSD20, complete sequence	74324-74353	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	694578-694607	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	327369-327398	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1709474-1709503	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	473696-473725	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1691536-1691565	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1691536-1691565	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	383839-383868	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	402234-402263	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	387145-387174	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	197649-197678	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	447411-447440	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	538382-538411	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	39234-39263	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	389230-389259	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	997041-997070	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1382405-1382434	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	615362-615391	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	388405-388434	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	399877-399906	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	385172-385201	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	281280-281309	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	384261-384290	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_LN997849	Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence	96206-96235	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	379272-379301	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	385402-385431	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	388423-388452	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	400691-400720	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	385035-385064	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	401124-401153	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	381491-381520	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	400691-400720	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	385035-385064	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	400691-400720	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	381494-381523	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	400695-400724	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	385035-385064	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	385035-385064	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	385035-385064	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	121003-121032	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	381494-381523	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	399860-399889	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	399818-399847	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	392024-392053	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	391636-391665	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	383546-383575	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	381494-381523	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	400691-400720	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	401120-401149	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	381494-381523	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	381494-381523	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	385037-385066	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	401125-401154	7	0.767
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	1037234-1037264	7	0.774
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NC_030917	Gordonia phage OneUp, complete genome	66073-66103	7	0.774
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	35932-35961	7	0.767
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NZ_KU130294	Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence	22078-22107	7	0.767
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	MH464253	Shigella phage SFPH2, complete genome	12754-12783	7	0.767
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NZ_CP039919	Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626b, complete sequence	12469-12498	7	0.767
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	KU687351	Citrobacter phage SH5, complete genome	31350-31379	7	0.767
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	KU687350	Citrobacter phage SH4, complete genome	30792-30821	7	0.767
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	CP058906	Micromonospora phage pMLP1, complete sequence	38211-38240	7	0.767
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	647884-647913	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	592671-592700	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	GU943018	Uncultured phage MedDCM-OCT-S04-C136 genomic sequence	3827-3856	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	AP013718	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C22-MedDCM-OCT-S42-C114, * SEQUENCING IN PROGRESS *	22016-22045	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NC_025829	Shigella phage pSs-1, complete genome	70951-70980	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	KX452694	UNVERIFIED: Escherichia phage KPN1 genomic sequence	58590-58619	7	0.767
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	KX452698	UNVERIFIED: Shigella phage KPN5 genomic sequence	69946-69975	7	0.767
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP022541	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence	67392-67421	8	0.733
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP041755	Pseudomonas sp. KBS0707 plasmid unnamed1, complete sequence	118921-118950	8	0.733
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NC_007274	Pseudomonas savastanoi pv. phaseolicola 1448A plasmid large, complete sequence	119200-119229	8	0.733
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	637512-637541	8	0.733
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1146002-1146031	8	0.733
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	219763-219793	8	0.742
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	257412-257442	8	0.742
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	140124-140153	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	16730-16759	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	126637-126666	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MN304821	Phage 66_12, partial genome	22648-22677	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443392	Rhodococcus hoagii strain PAM1340 plasmid pVAPA1340, complete sequence	17052-17081	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443389	Rhodococcus hoagii strain PAM1357 plasmid pVAPA1357, complete sequence	37978-38007	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443403	Rhodococcus hoagii strain PAM2288 plasmid pVAPA2288, complete sequence	37965-37994	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443393	Rhodococcus hoagii strain PAM1637 plasmid pVAPA1637, complete sequence	37985-38014	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443402	Rhodococcus hoagii strain PAM2285 plasmid pVAPA2285, complete sequence	17027-17056	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443390	Rhodococcus hoagii strain PAM1422 plasmid pVAPA1422, complete sequence	10543-10572	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443395	Rhodococcus hoagii strain PAM2282 plasmid pVAPA2282, complete sequence	37968-37997	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443404	Rhodococcus hoagii strain PAM2287 plasmid pVAPA2287, complete sequence	36085-36114	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443405	Rhodococcus hoagii strain PAM2279 plasmid pVAPA2279, complete sequence	37983-38012	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443391	Rhodococcus hoagii strain PAM1600 plasmid pVAPA1600, complete sequence	10543-10572	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443394	Rhodococcus hoagii strain PAM1643 plasmid pVAPA1643, complete sequence	17027-17056	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443396	Rhodococcus hoagii strain PAM1271 plasmid pVAPA1271, complete sequence	10545-10574	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443406	Rhodococcus hoagii strain PAM1413 plasmid pVAPB1413, complete sequence	10472-10501	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443397	Rhodococcus hoagii strain PAM1475 plasmid pVAPB1475, complete sequence	10472-10501	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_KX443407	Rhodococcus hoagii strain PAM1533 plasmid PVAPB1533, complete sequence	10472-10501	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP027795	Rhodococcus hoagii strain DSSKP-R-001 plasmid plas2, complete sequence	68077-68106	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	LR606148	Rhizobium sp. Q54 genome assembly, plasmid: 5	339231-339260	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP041653	Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence	137234-137263	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_002576	Rhodococcus equi 103 plasmid p103, complete sequence	34931-34960	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1193250-1193279	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	985287-985316	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_011150	Rhodococcus equi plasmid pVAPB1593, complete sequence	10540-10569	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_011151	Rhodococcus equi plasmid pVAPA1037, complete sequence	10545-10574	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_004854	Rhodococcus equi ATCC33701 plasmid pREAT701, complete sequence	34932-34961	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	AP013361	Uncultured Mediterranean phage uvMED DNA, complete genome, group G10, isolate: uvMED-CGR-U-MedDCM-OCT-S34-C1	43877-43906	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MK494099	Mycobacterium phage Typha, complete genome	33789-33818	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	388736-388765	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MK977697	Microbacterium phage Etta, complete genome	24174-24203	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MN234181	Microbacterium phage Pocket, complete genome	24175-24204	8	0.733
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	MG962367	Microbacterium phage Gelo, complete genome	24174-24203	8	0.733
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP030354	Novosphingobium sp. P6W plasmid pP6W1, complete sequence	23606-23635	8	0.733
CP029356_3	3.6\|667093\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667093-667122	30	NZ_CP038639	Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence	94877-94906	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	296949-296978	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	29090-29119	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	94343-94372	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP016293	Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence	189516-189545	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	MK894437	Microbacterium phage MonChoix, complete genome	29342-29371	8	0.733
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	352436-352465	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	153171-153200	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	148131-148160	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1446401-1446430	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	MT711888	Pseudomonas phage Dolphis, complete genome	17618-17647	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1770347-1770376	8	0.733
CP029356_3	3.9\|667291\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667291-667320	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	685985-686014	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP022422	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-7, complete sequence	74707-74736	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP031193	Humibacter sp. BT305 plasmid unnamed1	104518-104547	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	83051-83080	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP049042	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_5, complete sequence	49057-49086	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP023738	Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence	108935-108964	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	622880-622909	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	81628-81657	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	88060-88089	8	0.733
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	KX557279	Gordonia phage Hedwig, complete genome	36992-37021	8	0.733
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	NC_010332	Collimonas fungivorans plasmid pTer331, complete sequence	21042-21071	8	0.733
CP029356_3	3.19\|667951\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667951-667980	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	65033-65062	8	0.733
CP029356_3	3.19\|667951\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667951-667980	30	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	1051443-1051472	8	0.733
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	MK737942	Microbacterium phage Sucha, complete genome	13601-13630	8	0.733
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	400711-400740	8	0.733
CP029356_3	3.20\|668017\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668017-668046	30	CP000618	Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence	152583-152612	8	0.733
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	661747-661776	8	0.733
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	564318-564347	8	0.733
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	516963-516992	8	0.733
CP029356_3	3.21\|668083\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668083-668112	30	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	302005-302034	8	0.733
CP029356_3	3.23\|668215\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668215-668244	30	NC_021909	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence	467569-467598	8	0.733
CP029356_3	3.24\|668281\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668281-668310	30	NC_021909	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence	467569-467598	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	408141-408170	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	150097-150126	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	205904-205933	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	MK737944	Microbacterium phage Warren, complete genome	10585-10614	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	MH153799	Microbacterium phage Appa, complete genome	10388-10417	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	300612-300641	8	0.733
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP011667	Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence	35156-35185	8	0.733
CP029356_3	3.26\|668413\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668413-668442	30	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	27723-27752	8	0.733
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NZ_CP019608	Tessaracoccus flavescens strain SST-39T plasmid unnamed, complete sequence	21324-21354	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	KY549659	Pectobacterium phage vB_PatP_CB4, complete genome	22042-22072	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	KY514264	Pectobacterium phage vB_PatP_CB1, complete genome	22211-22241	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	KY514265	Pectobacterium phage vB_PatP_CB3, complete genome	22256-22286	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NC_048704	Pectobacterium phage Nepra, complete genome	52384-52414	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	NZ_CP020701	Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence	8894-8924	8	0.742
CP029356_3	3.27\|668479\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668479-668509	31	KY290952	Aeromonas phage 32, complete genome	36960-36990	8	0.742
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NC_023558	Cronobacter phage Dev2 complete genome	30623-30652	8	0.733
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	239365-239394	8	0.733
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	216107-216136	8	0.733
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	CP052389	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1	84630-84659	8	0.733
CP029356_3	3.2\|666827\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666827-666857	31	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	537771-537801	9	0.71
CP029356_3	3.2\|666827\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666827-666857	31	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1098554-1098584	9	0.71
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NZ_CP041206	Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence	416869-416899	9	0.71
CP029356_3	3.4\|666960\|31\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666960-666990	31	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	423032-423062	9	0.71
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	185712-185741	9	0.7
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	AF440695	Virus PhiCh1, complete genome	41431-41460	9	0.7
CP029356_3	3.5\|667027\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667027-667056	30	NC_004084	Natrialba phage PhiCh1, complete genome	41431-41460	9	0.7
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	309505-309534	9	0.7
CP029356_3	3.7\|667159\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667159-667188	30	NC_019694	Oscillatoria acuminata PCC 6304 plasmid pOSCIL6304.02, complete sequence	9640-9669	9	0.7
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NZ_AP014708	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_4p, complete sequence	30738-30767	9	0.7
CP029356_3	3.10\|667357\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667357-667386	30	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	103826-103855	9	0.7
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	MF495477	Aeromonas salmonicida plasmid pS28-3, complete sequence	22114-22143	9	0.7
CP029356_3	3.13\|667555\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667555-667584	30	KJ850907	Uncultured bacterium plasmid pSFA231, complete sequence	20961-20990	9	0.7
CP029356_3	3.18\|667885\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	667885-667914	30	NC_015169	Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence	200636-200665	9	0.7
CP029356_3	3.22\|668149\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668149-668178	30	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	5206-5235	9	0.7
CP029356_3	3.22\|668149\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668149-668178	30	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	182712-182741	9	0.7
CP029356_3	3.25\|668347\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668347-668376	30	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	683423-683452	9	0.7
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	MN549360	Rhizobium phage RL38J1, complete genome	89532-89561	9	0.7
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	NZ_CP044066	Cupriavidus pauculus strain FDAARGOS_664 plasmid unnamed1, complete sequence	237850-237879	9	0.7
CP029356_3	3.28\|668546\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668546-668575	30	MN549361	Rhizobium phage RL2RES, complete genome	104057-104086	9	0.7
CP029356_3	3.29\|668612\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668612-668641	30	NC_009669	Ochrobactrum anthropi ATCC 49188 plasmid pOANT01, complete sequence	48947-48976	9	0.7
CP029356_3	3.30\|668678\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	668678-668707	30	NZ_CP042820	Octadecabacter sp. SW4 plasmid pow41, complete sequence	87568-87597	9	0.7
CP029356_1	1.1\|343696\|70\|CP029356\|PILER-CR	343696-343765	70	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	343696-343765	10	0.857
CP029356_3	3.3\|666894\|30\|CP029356\|PILER-CR,CRISPRCasFinder,CRT	666894-666923	30	NZ_LN890657	Candidatus Promineofilum breve strain Cfx-K plasmid III, complete sequence	40561-40590	10	0.667

1. spacer 1.2|343787|42|CP029356|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cggccgccggccatcctgcgactcgcggaccgcgagcggcgc	CRISPR spacer
cggccgccggccatcctgcgactcgcggaccgcgagcggcgc	Protospacer
******************************************

2. spacer 2.1|517545|38|CP029356|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ggcttgccgaacatgcgcaagtatggccagaccgcgca	CRISPR spacer
ggcttgccgaacatgcgcaagtatggccagaccgcgca	Protospacer
**************************************

3. spacer 2.2|517620|39|CP029356|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cagtttcacgtacaacaatctgctgatgcgccaatggca	CRISPR spacer
cagtttcacgtacaacaatctgctgatgcgccaatggca	Protospacer
***************************************

4. spacer 2.3|517696|37|CP029356|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tcgcgcgctggtacaccagccttgatgagaccggccg	CRISPR spacer
tcgcgcgctggtacaccagccttgatgagaccggccg	Protospacer
*************************************

5. spacer 2.4|517770|40|CP029356|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gggcgctgcgctatagtcatcgccacccagcttggcgcag	CRISPR spacer
gggcgctgcgctatagtcatcgccacccagcttggcgcag	Protospacer
****************************************

6. spacer 3.1|666762|29|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aacgcttggtcaatttgtatcctgaggtg	CRISPR spacer
aacgcttggtcaatttgtatcctgaggtg	Protospacer
*****************************

7. spacer 3.2|666827|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccaagagacgcgcggcatgcgtcgcatcccc	CRISPR spacer
ccaagagacgcgcggcatgcgtcgcatcccc	Protospacer
*******************************

8. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
atcttcgtcggcggcgaccgctcaatgggc	Protospacer
******************************

9. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
ggaagtagccgacaacgtgatccagcatctt	Protospacer
*******************************

10. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gtcgcgaggtcgagggcgaggacgccgccg	Protospacer
******************************

11. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
accggcaccaccatcacggcgctgggcacc	Protospacer
******************************

12. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
aatgtcggctcggtcggcctgaccgtcgag	Protospacer
******************************

13. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
cgacaagcggcaccagatggcggtcgtcat	Protospacer
******************************

14. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgacgcgggcgtacttg	Protospacer
******************************

15. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
aggtccgcggtcggcgagaccgagcccggg	Protospacer
******************************

16. spacer 3.11|667423|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aactctgatgaagtatggtgcgagtcctgt	CRISPR spacer
aactctgatgaagtatggtgcgagtcctgt	Protospacer
******************************

17. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
agcatcgacgcgaagcccaccatcccggtg	Protospacer
******************************

18. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
tacgggctacatcgacttcctgcgccatga	Protospacer
******************************

19. spacer 3.14|667621|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccatgcatggccccaatggagccaccgccg	CRISPR spacer
ccatgcatggccccaatggagccaccgccg	Protospacer
******************************

20. spacer 3.15|667687|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

agtcagcaactcatggcggatttccgtgcg	CRISPR spacer
agtcagcaactcatggcggatttccgtgcg	Protospacer
******************************

21. spacer 3.16|667753|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gcctcccgcctccgggacactccgaagaga	CRISPR spacer
gcctcccgcctccgggacactccgaagaga	Protospacer
******************************

22. spacer 3.17|667819|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gaggatggcgttctcaagcgtcgtgcgccg	CRISPR spacer
gaggatggcgttctcaagcgtcgtgcgccg	Protospacer
******************************

23. spacer 3.18|667885|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cgcagcagaccgctgggcaacagagcgtcg	CRISPR spacer
cgcagcagaccgctgggcaacagagcgtcg	Protospacer
******************************

24. spacer 3.19|667951|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gatggtgcggatatggtcctgcacatgcag	CRISPR spacer
gatggtgcggatatggtcctgcacatgcag	Protospacer
******************************

25. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
gagctgcgggtgtcggaggtcgcgctggtc	Protospacer
******************************

26. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
ggatggacccgccggtcggcgtcttcaacc	Protospacer
******************************

27. spacer 3.22|668149|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cgggcagagaataagcggatgacggcggac	CRISPR spacer
cgggcagagaataagcggatgacggcggac	Protospacer
******************************

28. spacer 3.23|668215|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
ccgcgctgtcttgacccacttcacgccgtc	Protospacer
******************************

29. spacer 3.23|668215|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
ccgcgctgtcttgacccacttcacgccgtc	Protospacer
******************************

30. spacer 3.24|668281|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
ccgcgctgtcttgacccacttcacgccgtc	Protospacer
******************************

31. spacer 3.24|668281|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
ccgcgctgtcttgacccacttcacgccgtc	Protospacer
******************************

32. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacgtcggcggcgtcgacgcgcgacagctg	Protospacer
******************************

33. spacer 3.26|668413|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aaccgggttctcgtccatgtctactggagc	CRISPR spacer
aaccgggttctcgtccatgtctactggagc	Protospacer
******************************

34. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gcaaacgtgctgcttgcgggccttcaccacc	Protospacer
*******************************

35. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
cttcagcaggtcgtagacgttgaccccgaa	Protospacer
******************************

36. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
gcgtcaggtcgctgtccgggtggacgcgcg	Protospacer
******************************

37. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggaatcaacatcttcttcaacggcggcggg	Protospacer
******************************

38. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 4, identity: 0.867

gtcgcgaggtcgagggcgaggacgccgccg--	CRISPR spacer
gtcgcgagggcgagggcgagg--gccgctgag	Protospacer
********* ***********  *****.*

39. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_010848 (Flavobacterium sp. KI723T1 plasmid pOAD2 DNA, complete sequence) position: , mismatch: 4, identity: 0.867

gacgtcggcggcgtcgacgcgcgaca-gctg	CRISPR spacer
gacgtcggcggcgtcgacgcgctgcgcgct-	Protospacer
********************** .*. ***

40. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 4, identity: 0.867

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
gacgtcggcggagtcgacgcccgac-gcggt	Protospacer
*********** ******** **** ** *

41. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.867

gacgtcggcggcgtcgacgcgcgaca-gctg	CRISPR spacer
gacgtcgtcggcgtcgacgcgccccacgct-	Protospacer
******* **************  ** ***

42. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
tgcgcgagatcgaggccgaggacgccgctg	Protospacer
  ******.****** ************.*

43. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.833

--gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ccgtcgc--ggtcgagggcgagggcgccgtgg	Protospacer
  *****  **************.*****. *

44. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.833

-gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gggtgcg-ggtcgatggcgaggacaccgccg	Protospacer
 * .*** ****** *********.******

45. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.833

-gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gggtgcg-ggtcgatggcgaggacaccgccg	Protospacer
 * .*** ****** *********.******

46. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.833

--gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ccgtcgc--ggtcgagggcgagggcgccgtgg	Protospacer
  *****  **************.*****. *

47. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 5, identity: 0.833

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
cacggcaccaccatcacggcgctgtccgcc	Protospacer
  **********************  *.**

48. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010857 (Marinovum algicola DG 898 plasmid pMaD2, complete sequence) position: , mismatch: 5, identity: 0.833

---accggcaccaccatcacggcgctgggcacc	CRISPR spacer
cagtccgg---caccatcacggtgctgggcacc	Protospacer
    ****   ***********.**********

49. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MG018224 (Stenotrophomonas phage DLP4, complete genome) position: , mismatch: 5, identity: 0.833

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttggcgcgggctcgctcg	Protospacer
***************.******* ..**.*

50. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 5, identity: 0.833

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgcctgcttgccgcgggcgacctcg	Protospacer
********* ***** ********  **.*

51. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 5, identity: 0.833

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gaggtcgcggtcggcgagaccgagcccggc	Protospacer
..* .************************

52. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

tacgggctacatcgacttcctgcgc-catga	CRISPR spacer
aacgggcttcatcggcttcctgcgctcacg-	Protospacer
 ******* *****.********** **.*

53. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.833

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
gcggtgcgggtgtcggaggtcgcggaggtg	Protospacer
* * ********************  ***

54. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.833

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
gcggtgcgggtgtcggaggtcgcggaggtg	Protospacer
* * ********************  ***

55. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN304817 (Phage 68_12, complete genome) position: , mismatch: 5, identity: 0.833

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
gggttgcgggtgtcggaggtcgcgaaggtg	Protospacer
*.*.********************  ***

56. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048637 (Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.833

gacgtcggcggcgtcgacgcgcgacagctg--	CRISPR spacer
cacgtcggcggcgacgacgcgcggc--ctgaa	Protospacer
 ************ *********.*  ***

57. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007791 (Corynebacterium marinum DSM 44953 plasmid pCmarinum2, complete sequence) position: , mismatch: 5, identity: 0.833

gacgtcggcggcgtcgacgcgcgacagctg--	CRISPR spacer
gacgtcgtcggcgtcgacgagcggc--ctgga	Protospacer
******* *********** ***.*  ***

58. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 5, identity: 0.833

gacgtcggcggcgtcgacgcg-cgacagctg	CRISPR spacer
gacgtcggcggcggcgacgcgacgatggcc-	Protospacer
************* ******* ***..**.

59. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

atcttcgtcggcggcgaccgctcaatgggc-	CRISPR spacer
atcttcgtcggcgtcgacggctc-gcggccg	Protospacer
************* **** **** ..** *

60. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.8

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcgccgaggtcgaggccgaggaggccgcgg	Protospacer
*.  *********** ****** ***** *

61. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ttcgcgcggtcgagggcgacgacgcccacc	Protospacer
 ***** ************ ******  *

62. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

-gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cgccg-gaggtcgagggcgaggccgccaacc	Protospacer
 *.** **************** ****. *

63. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053709 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gtggtcaggtcgcgggtgaggacgccgccc	Protospacer
** *. ****** ***.************

64. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051543 (Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence) position: , mismatch: 6, identity: 0.8

gtcgcg-aggtcgagggcgaggacgccgccg	CRISPR spacer
-ccgtgctggtcgagggcgacgacgacgccg	Protospacer
 .**.*  ************ **** *****

65. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 6, identity: 0.8

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gtgggatggtcgagggcgatgacgccgacg	Protospacer
** * . ************ ******* **

66. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022424 (Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence) position: , mismatch: 6, identity: 0.8

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
ggcagcaccaccaacccggcgctgggcaac	Protospacer
. *.********* * ************ *

67. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 6, identity: 0.8

-aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ccacgcc-tctcggtcggcctgactgtcgag	Protospacer
  *.*.*  ***************.******

68. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053445 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence) position: , mismatch: 6, identity: 0.8

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
gggcaagcggcgccagatggccgtcgccct	Protospacer
 *.********.********* ****.* *

69. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 6, identity: 0.8

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
ggtcaagcggcgcgagatggcggtcgagat	Protospacer
 * ********.* ************  **

70. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AB767244 (Edwardsiella phage MSW-3 DNA, complete genome) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg-	CRISPR spacer
tcggccgtcagcttgacgcgtgcg-gctgat	Protospacer
*******.************ *** .** .

71. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tggtcgtccagcttgacgggggcggacttg	Protospacer
* * *  *********** ***** *****

72. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT963412 (Pseudomonas syringae isolate CFBP3840 plasmid PP3, complete sequence) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg-	CRISPR spacer
atggccgccagctggacgcgggc-tattggt	Protospacer
 .*********** ********* **.* *

73. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg-	CRISPR spacer
tcgcccgccagcttgaagcgggc-tacacat	Protospacer
*** ************ ****** *** ..

74. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_049478 (Arthrobacter phage Mufasa8, complete genome) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgacagcttgacgcggaactcctcg	Protospacer
******* *************.  * **.*

75. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026559 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg-	CRISPR spacer
atggccgccagctggacgcgggc-tattggt	Protospacer
 .*********** ********* **.* *

76. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019872 (Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200A, complete sequence) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg-	CRISPR spacer
atggccgccagctggacgcgggc-tattggt	Protospacer
 .*********** ********* **.* *

77. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LR743532 (Xanthomonas phage Bosa genome assembly, chromosome: 1) position: , mismatch: 6, identity: 0.8

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcagccgccagcttggcgcgggcccgctcg	Protospacer
**.************.******* ..**.*

78. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134458 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 16, complete sequence) position: , mismatch: 6, identity: 0.8

aggtccgc-ggtcggcgagaccgagcccggg	CRISPR spacer
-gaccagctggtcggcgagaccgagctcggt	Protospacer
 *..* ** *****************.***

79. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

80. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

81. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

82. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

83. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

84. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

85. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

86. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

87. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

88. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

89. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

90. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

91. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

92. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

93. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

94. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

95. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

96. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

97. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

98. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

99. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

100. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

101. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

102. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

103. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

104. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

105. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

106. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

107. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

108. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

109. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

110. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

111. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

112. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

113. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

114. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

115. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

116. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

117. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

118. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

119. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

120. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

121. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

122. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

123. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

124. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

125. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

126. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

127. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

128. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

129. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

130. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

131. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

132. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

133. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

134. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

135. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

136. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

137. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

138. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

139. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

140. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

141. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

142. spacer 3.12|667489|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

agcatcgacgcgaagcccaccatcccggtg	CRISPR spacer
gccatcgacgcgaagctcgccatcccgaag	Protospacer
. **************.*.********. *

143. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP038625 (Arsenophonus nasoniae strain FIN plasmid pArsFIN13, complete sequence) position: , mismatch: 6, identity: 0.8

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
ttagggcaacatccacttcctgcgccatct	Protospacer
*  **** ***** **************

144. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
tgctcgacccgccggtcgtcgtcttcgacg	Protospacer
 * * ************* *******.**

145. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacggcggcggcgtcgacgcgcgcccacac	Protospacer
**** ****************** * .*

146. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017311 (Desulfovibrio vulgaris RCH1 plasmid pDEVAL01, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ggcgtcgtcggcgtcgaggcgcgacacgtc	Protospacer
*.***** ********* ********  *

147. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_005863 (Desulfovibrio vulgaris str. Hildenborough plasmid pDV, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ggcgtcgtcggcgtcgaggcgcgacacgtc	Protospacer
*.***** ********* ********  *

148. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_008741 (Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ggcgtcgtcggcgtcgaggcgcgacacgtc	Protospacer
*.***** ********* ********  *

149. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
gacgtcggcgacgtcgacgcg-gccttccgc	Protospacer
**********.********** * *  *.*

150. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026539 (Desulfovibrio carbinolicus strain DSM 3852 plasmid pDCAR1, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ggcgatgatggcgtcgtcgcgcgacagctg	Protospacer
*.** .*..******* *************

151. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009572 (Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
gacgtgggcggcgtctacgcgcg-caaccat	Protospacer
***** ********* ******* **.*..

152. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MT498067 (Microbacterium phage Bullzi2019, complete genome) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
tacgtcggcggcgtcaacgcgc-tcggccgc	Protospacer
 **************.******  *.**.*

153. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH779512 (Microbacterium phage Miaurora, complete genome) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
tacgtcggcggcgtcaacgcgc-tcggccgc	Protospacer
 **************.******  *.**.*

154. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MT498047 (Microbacterium phage TinyTruffula, complete genome) position: , mismatch: 6, identity: 0.8

gacgtcggcggcgtcgacgcgcgacagctg-	CRISPR spacer
tacgtcggcggcgtcaacgcgc-tcggccgc	Protospacer
 **************.******  *.**.*

155. spacer 3.26|668413|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to JX173487 (Pseudomonas phage Phi-S1, complete genome) position: , mismatch: 6, identity: 0.8

aaccgggttctcgtccatgtctactggagc	CRISPR spacer
atccgggttctcgtcgatgtctacaggctt	Protospacer
* ************* ******** **  .

156. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

157. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

158. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

159. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

160. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

161. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.8

----gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cttggc----ggtcgccgttcgggtggacgcgcg	Protospacer
    **    ******.**.**************

162. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

163. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

164. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

165. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

166. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

167. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

168. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

169. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

170. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

171. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

172. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.8

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
ggcttcaacaactacttcaacggcggcacg	Protospacer
**  ****** ** *************. *

173. spacer 3.2|666827|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 7, identity: 0.774

ccaagagacgcgcggcatgcgtcgcatcccc	CRISPR spacer
atatgagccgcgcggcaagcgtcgcatccat	Protospacer
 .* *** ********* *********** .

174. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.774

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
cgcagtagcccgcaacgtgatccagcgcctc	Protospacer
 * ******* .**************..**.

175. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ggcacgaggtcgagggcgaggaagcgctcc	Protospacer
* *.****************** **  .*

176. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_017771 (Deinococcus gobiensis I-0 plasmid P3, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ccgaagagggcgagggcgagcacgccgccg	Protospacer
 . . **** ********** *********

177. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gctacctcgtcgagggcgaggacgcccccg	Protospacer
*...*   ****************** ***

178. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg-	CRISPR spacer
accgcgagggtgagggcgaggacg-cacagc	Protospacer
..******* .************* *.* *

179. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcgttcaggtcgagggcgagcccgccgccg	Protospacer
*.  . **************  ********

180. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
agtgcgaggtcgtgggcgaggacggcgtgg	Protospacer
. .********* *********** **. *

181. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH825699 (Streptomyces phage Darolandstone, complete genome) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cgggcgaggtcgaggtcgaggtcgccgact	Protospacer
   ************ ***** ***** *

182. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_047988 (Microbacterium phage Metamorphoo, complete genome) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cccgcgaggtcgacggcgacgacgcctact	Protospacer
 .*********** ***** ******  *

183. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ccggcgaggtcgaaggcgaggtcgccgtcc	Protospacer
 . **********.******* *****.*

184. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
agtgcgaggtcgtgggcgaggacggcgtgg	Protospacer
. .********* *********** **. *

185. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
agtgcgaggtcgtgggcgaggacggcgtgg	Protospacer
. .********* *********** **. *

186. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gctacctcgtcgagggcgaggacgcccccg	Protospacer
*...*   ****************** ***

187. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
agtgcgaggtcgtgggcgaggacggcgtgg	Protospacer
. .********* *********** **. *

188. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ggtggctgttcgagggcgaggccgccgccg	Protospacer
* .*   * ************ ********

189. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LR606150 (Rhizobium sp. Q54 genome assembly, plasmid: 7) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ttggcaccttcgagggcgtggacgccgccg	Protospacer
 * **.   ********* ***********

190. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcgatgaggtcgagggcgaggtcaccgcgg	Protospacer
*. ..**************** *.**** *

191. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcgatgaggtcgagggcgaggtcaccgcgg	Protospacer
*. ..**************** *.**** *

192. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007516 (Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcgacccgttcgagggcgaggacgcccccg	Protospacer
*. .*  * ***************** ***

193. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN908694 (Microbacterium phage RubyRalph, complete genome) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
agggtgaaggcgagggcgaggacgccgcgg	Protospacer
.  *.**.* ****************** *

194. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009803 (Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cgggagcggtcgagggcgaggaggccgtcg	Protospacer
   * * *************** ****.**

195. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ggcgagaggtcgacggcgaggacgcgttcc	Protospacer
* ** ******** ***********  .*

196. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053345 (Herbiconiux sp. SALV-R1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

-gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
aggcac-aggtcgagggcgacgacgccgtga	Protospacer
 * *.* ************* *******. .

197. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
atcggcaccaccatcaccgcgctgctgccg	Protospacer
*.*************** ******    *

198. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gtcggcaccacgatcacggcgctgctgccc	Protospacer
..********* ************    **

199. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gtcggcaccacgatcacggcgctgctgccc	Protospacer
..********* ************    **

200. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025539 (Vibrio harveyi strain 345 plasmid p345-185, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

201. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011135 (Escherichia coli VR50 plasmid pVR50A, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

202. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP051693 (Escherichia coli strain SCU-318 plasmid pSCU-318-1, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

203. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023351 (Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

204. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LT906556 (Escherichia coli isolate E. coli RL465 genome assembly, plasmid: I) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

205. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
acgacggccaccatcacggcgacgggcacc	Protospacer
** .  .************** .*******

206. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP038299 (Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

207. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034238 (Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

208. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034238 (Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

209. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034238 (Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

210. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP018811 (Escherichia coli strain E2865 plasmid pE2865-3, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

211. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037947 (Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

212. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_016983 (Photobacterium damselae subsp. damselae plasmid pAQU1, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

213. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027554 (Escherichia coli strain 2013C-3513 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

214. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX957970 (Vibrio parahaemolyticus plasmid pVPS43, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

215. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX957971 (Vibrio parahaemolyticus plasmid pVPS62, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

216. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX957969 (Vibrio alginolyticus plasmid pVAS114, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

217. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AP019705 (Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

218. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020057 (Escherichia coli strain AR_0069 plasmid unitig_3, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

219. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_006994 (Pasteurella multocida 381 plasmid pCCK381, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

220. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044149 (Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

221. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021733 (Escherichia coli strain AR_0114 plasmid unitig_1, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

222. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT985265 (Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gacggcaccaccagaacggcgctggattcc	Protospacer
. ***********  **********.. **

223. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN908685 (Microbacterium phage PauloDiaboli, complete genome) position: , mismatch: 7, identity: 0.767

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
tccggcaccaccgtcacggcgcacaccgcc	Protospacer
 ***********.*********  . *.**

224. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013632 (Rhizobium sp. N324 plasmid pRspN324b, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ctggtcggcgcggccggcctgaccgtcgcc	Protospacer
   ****** ***.**************

225. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_012854 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

226. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

227. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

228. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016291 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

229. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

230. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

231. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050095 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

232. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050100 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

233. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

234. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025017 (Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

235. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053443 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

236. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

237. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048284 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248b, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gtcggcggctcgatcggcgtgaccgtcgtg	Protospacer
. .* *******.***** ********* *

238. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_011984 (Agrobacterium vitis S4 plasmid pAtS4c, complete sequence) position: , mismatch: 7, identity: 0.767

aatgtcggctcggtcggcctgaccgtcgag--	CRISPR spacer
tatgtcggctcggtcggcccga--gacaggct	Protospacer
 ******************.**  * *..*

239. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
acatcagcggcaccagatcgcggtcggctt	Protospacer
  *. ************* ******* * *

240. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
cggcgagcggcaccagatggcgggtgaagt	Protospacer
**.*.****************** .*  .*

241. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 7, identity: 0.767

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
aaatcaacggcaccatatggcggtcgtaat	Protospacer
 .*. *.******** *********** **

242. spacer 3.8|667225|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

cgacaagcggcaccagatggcggtcgtcat	CRISPR spacer
caccgggcggcaccagatggcggtagtaag	Protospacer
*. *..****************** ** *

243. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK967402 (Mycobacterium phage NihilNomen, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

244. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH697583 (Mycobacterium phage EricMillard, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

245. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH399772 (Mycobacterium phage Constella, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

246. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to JF937090 (Mycobacterium virus BAKA, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

247. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK524521 (Mycobacterium phage Schatzie, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

248. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK524516 (Mycobacterium phage Bobby, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

249. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_041844 (Mycobacterium phage Optimus, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

250. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK524527 (Mycobacterium phage ThreeRngTarjay, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

251. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK279849 (Mycobacterium phage Duke13, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

252. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK524529 (Mycobacterium phage Phoebus, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

253. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK524504 (Mycobacterium phage Hughesyang, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

254. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgccagcttgatgccggcgacgatc	Protospacer
****************.** ****    *

255. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
gccgccgccagctcgacgcgggcgacgtcg	Protospacer
 * **********.**********   *.*

256. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
aagatcaccagcttgacgccggcgtccttg	Protospacer
  *..*.************ ***** ****

257. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
gccgccgccagctcgacgcgggcgacgtcg	Protospacer
 * **********.**********   *.*

258. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AY576273 (Bacteriophage Phi JL001, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
ccctcgccctgcttgacgcggtcgtacttg	Protospacer
.*  *  ** *********** ********

259. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_006938 (Phage phiJL001, complete genome) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
ccctcgccctgcttgacgcggtcgtacttg	Protospacer
.*  *  ** *********** ********

260. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.767

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tccgccgccagcttggcgcgggccaccagg	Protospacer
** ************.*******   *  *

261. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR723678 (Arsenite-oxidising bacterium NT-25 plasmid 2) position: , mismatch: 7, identity: 0.767

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gggggtgcggtcggcgagaccgagcgcgcc	Protospacer
.**  .******************* **

262. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 7, identity: 0.767

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
tacttcgcggtcggcgagaccgagttcggt	Protospacer
 . *.*******************..***

263. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015042 (Rhodovulum sp. P5 plasmid pRGUI03, complete sequence) position: , mismatch: 7, identity: 0.767

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gggggtgcggtcggcgagaccgagcgcgcc	Protospacer
.**  .******************* **

264. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_FO082821 (Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gggggtgcggtcggcgagaccgagcgcgcc	Protospacer
.**  .******************* **

265. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
tggtccgcggtcgccgagaccggggtcaag	Protospacer
 ************ ********.* .*..*

266. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 7, identity: 0.767

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
cgcgggctacatcgacttccagcccggcga	Protospacer
..****************** ** * ..**

267. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.767

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
tcgtggctacatcgaccacctgcgccacgc	Protospacer
*   ************. *********.*

268. spacer 3.15|667687|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 7, identity: 0.767

agtcagcaactcatggcggatttccgtgcg	CRISPR spacer
cgtcagcaactcatggccgaattcgggttg	Protospacer
 **************** ** *** *  .*

269. spacer 3.17|667819|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_020060 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899a, complete sequence) position: , mismatch: 7, identity: 0.767

gaggatggcgttctcaagcgtcgtgcgccg	CRISPR spacer
gaggacggcgttcgcaagcgtcgtcttgcc	Protospacer
*****.******* ********** .  *

270. spacer 3.19|667951|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 7, identity: 0.767

gatggtgcggatatggtcctgcacatgcag	CRISPR spacer
cgggctgcggatatggacctgcatatgctg	Protospacer
 . * *********** ******.**** *

271. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.767

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
aggccaatccgccggtcggcgtcttcaccc	Protospacer
.*.. .*.******************* **

272. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.767

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
aggccaagccgccggtcggcgtcttcaccc	Protospacer
.*.. .* ******************* **

273. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KM659097 (Paracoccus yeei plasmid pLM20P5, complete sequence) position: , mismatch: 7, identity: 0.767

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
cgctcgatccgccggtcggcgtcttcggtc	Protospacer
 * * **.******************...*

274. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

-gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
cggca-cggcggcgccgacgcacgacagcac	Protospacer
 *.*. ********.******.*******

275. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037914 (Sphingomonas sp. AAP5 plasmid p213, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
cgtggccacgacgtcgacgcgcgacagctg	Protospacer
 ..* * .**.*******************

276. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_013860 (Azospirillum sp. B510 plasmid pAB510f, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
atggaaggcggcgacggcgcgcgacagctg	Protospacer
.  *  ******* **.*************

277. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

278. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

279. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

280. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

281. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg--acagctg	CRISPR spacer
ctcgacggcggcgtcgacgcgcgctgcggc--	Protospacer
  ** ******************  .*.**

282. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

283. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

284. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_004929 (Ruegeria sp. PR1b plasmid pSD20, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ccccccggcggcgtagacgcgcggcagcgg	Protospacer
  * .********* ********.**** *

285. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

286. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gcgatcggcggcttcggcgcgcgacagtag	Protospacer
*  .******** ***.**********. *

287. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

288. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

289. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

290. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

291. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

292. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

293. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

294. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacgtcgccggcgtcgacgcgatcgaggtc	Protospacer
******* *************    ** *

295. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

296. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

297. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

298. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

299. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

300. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

301. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

302. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

303. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

304. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

305. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

306. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

307. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

308. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN997849 (Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gccgtcggcggcggcgacgcgcgcccggca	Protospacer
* *********** ********* * * ..

309. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

310. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

311. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

312. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

313. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

314. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

315. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

316. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

317. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

318. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

319. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

320. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

321. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

322. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

323. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

324. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

325. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

326. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

327. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacgtcgccggcgtcgacgcgatcgaggtc	Protospacer
******* *************    ** *

328. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

329. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

330. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

331. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

332. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

333. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

334. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

335. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

336. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

337. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

338. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

339. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

340. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

341. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

342. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

343. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

344. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcggcggcgtcgacgcgcg-acagctg	CRISPR spacer
gacgtcggcgccgtcgacccgcgcgtggcc-	Protospacer
********** ******* **** ...**.

345. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 7, identity: 0.774

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
ttcaacgtgctgcatgcgggccttccgcatc	Protospacer
 . ********** ***********  **.*

346. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_030917 (Gordonia phage OneUp, complete genome) position: , mismatch: 7, identity: 0.774

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
acaccggtgttccttgcgggccttcaccatc	Protospacer
.**   ***.* *****************.*

347. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
gaccagcaggtcgtcgacgttgacgcccag	Protospacer
  .*********** ********* ** *.

348. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KU130294 (Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
gaccagcaggtcgtcgacgttgacgcccag	Protospacer
  .*********** ********* ** *.

349. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH464253 (Shigella phage SFPH2, complete genome) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
cttcagcaggtcgtagaccttcagttcgcc	Protospacer
****************** ** * ..**

350. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039919 (Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626b, complete sequence) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa---	CRISPR spacer
attcagcaggtcgtagtcgttg---ccgggcca	Protospacer
 *************** *****   ***..

351. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KU687351 (Citrobacter phage SH5, complete genome) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
cttcagcaggtcgtagaccttcagttcgcc	Protospacer
****************** ** * ..**

352. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KU687350 (Citrobacter phage SH4, complete genome) position: , mismatch: 7, identity: 0.767

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
cttcagcaggtcgtagaccttcagttcgcc	Protospacer
****************** ** * ..**

353. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP058906 (Micromonospora phage pMLP1, complete sequence) position: , mismatch: 7, identity: 0.767

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
ggtcgcggtcgctgtccgggtggacgagcc	Protospacer
*  .  ******************** **

354. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.767

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
ggatcaggtcgatgtccgggtggtcgagga	Protospacer
* .******** *********** ** * .

355. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
caggtgaacatcgtcttcaacggcggcgga	Protospacer
 ...* ****** ****************.

356. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to GU943018 (Uncultured phage MedDCM-OCT-S04-C136 genomic sequence) position: , mismatch: 7, identity: 0.767

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
agaatcaacatcttcttcaatggttacaag	Protospacer
.*******************.**. .*..*

357. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AP013718 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C22-MedDCM-OCT-S42-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
agaatcaacatcttcttcaatggttacaag	Protospacer
.*******************.**. .*..*

358. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_025829 (Shigella phage pSs-1, complete genome) position: , mismatch: 7, identity: 0.767

ggaatcaa--catcttcttcaacggcggcggg	CRISPR spacer
--aattcgttcagcttcttcaacggcggcggc	Protospacer
  ***. .  ** ******************

359. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX452694 (UNVERIFIED: Escherichia phage KPN1 genomic sequence) position: , mismatch: 7, identity: 0.767

ggaatcaa--catcttcttcaacggcggcggg	CRISPR spacer
--aattcgttcagcttcttcaacggcggcggc	Protospacer
  ***. .  ** ******************

360. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX452698 (UNVERIFIED: Shigella phage KPN5 genomic sequence) position: , mismatch: 7, identity: 0.767

ggaatcaa--catcttcttcaacggcggcggg	CRISPR spacer
--aattcgttcagcttcttcaacggcggcggc	Protospacer
  ***. .  ** ******************

361. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022541 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence) position: , mismatch: 8, identity: 0.733

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
atcttcgtcggccgcgaccgcgcctacaac	Protospacer
************ ******** *    ..*

362. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041755 (Pseudomonas sp. KBS0707 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
tagttcgtcggcggcgaccgcgcagcgcgg	Protospacer
   ****************** **..* *

363. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_007274 (Pseudomonas savastanoi pv. phaseolicola 1448A plasmid large, complete sequence) position: , mismatch: 8, identity: 0.733

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
tagttcgtcggcggcgaccgcgcagcgcgg	Protospacer
   ****************** **..* *

364. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
atcttcgtcggcgacgaccgcgacgagatc	Protospacer
*************.*******   . *. *

365. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
atcttcgtcggcgacgaccgcgacgagatc	Protospacer
*************.*******   . *. *

366. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 8, identity: 0.742

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
tcgagtagccggcaacgtggtccagcgccct	Protospacer
  .********.*******.******..*.*

367. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.742

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
gggcacggccgacaacaagatccagcatctg	Protospacer
**. ...*********. ************

368. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cctcgaaggtcgagggcgtggtcgccgccg	Protospacer
 ..  .************ ** ********

369. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gcatcgaggccgagggcgcggacgccgtgc	Protospacer
*.  *****.******** ********.

370. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
tcgacgagctcgagggcgaggacgccacgt	Protospacer
 . .**** *****************.*

371. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN304821 (Phage 66_12, partial genome) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
aggccgaggtcgagggcgagggcgcctact	Protospacer
.   *****************.****  *

372. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443392 (Rhodococcus hoagii strain PAM1340 plasmid pVAPA1340, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

373. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443389 (Rhodococcus hoagii strain PAM1357 plasmid pVAPA1357, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

374. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443403 (Rhodococcus hoagii strain PAM2288 plasmid pVAPA2288, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

375. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443393 (Rhodococcus hoagii strain PAM1637 plasmid pVAPA1637, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

376. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443402 (Rhodococcus hoagii strain PAM2285 plasmid pVAPA2285, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

377. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443390 (Rhodococcus hoagii strain PAM1422 plasmid pVAPA1422, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

378. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443395 (Rhodococcus hoagii strain PAM2282 plasmid pVAPA2282, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

379. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443404 (Rhodococcus hoagii strain PAM2287 plasmid pVAPA2287, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

380. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443405 (Rhodococcus hoagii strain PAM2279 plasmid pVAPA2279, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

381. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443391 (Rhodococcus hoagii strain PAM1600 plasmid pVAPA1600, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

382. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443394 (Rhodococcus hoagii strain PAM1643 plasmid pVAPA1643, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

383. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443396 (Rhodococcus hoagii strain PAM1271 plasmid pVAPA1271, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

384. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443406 (Rhodococcus hoagii strain PAM1413 plasmid pVAPB1413, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

385. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443397 (Rhodococcus hoagii strain PAM1475 plasmid pVAPB1475, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

386. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX443407 (Rhodococcus hoagii strain PAM1533 plasmid PVAPB1533, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

387. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027795 (Rhodococcus hoagii strain DSSKP-R-001 plasmid plas2, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

388. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to LR606148 (Rhizobium sp. Q54 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
ccgtcaaggtcgagggcgaggatgccgtcc	Protospacer
 .  *.****************.****.*

389. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041653 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
atcgccaggtcgagggcgaggaagaagatc	Protospacer
.**** **************** *  * .

390. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_002576 (Rhodococcus equi 103 plasmid p103, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

391. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
aggccgaagtcgaggacgaggacgccggca	Protospacer
.   ***.*******.*********** *.

392. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
aggccgaagtcgaggacgaggacgccggca	Protospacer
.   ***.*******.*********** *.

393. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_011150 (Rhodococcus equi plasmid pVAPB1593, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

394. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_011151 (Rhodococcus equi plasmid pVAPA1037, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

395. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_004854 (Rhodococcus equi ATCC33701 plasmid pREAT701, complete sequence) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
gccagcgcctcgagggcgaggacgccgtcg	Protospacer
*.*.  .  ******************.**

396. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AP013361 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G10, isolate: uvMED-CGR-U-MedDCM-OCT-S34-C1) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
actttgaggtcgagggccaggccgccgctg	Protospacer
... .************ *** ******.*

397. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK494099 (Mycobacterium phage Typha, complete genome) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
acgccccggtcgaggtcgaggacgcccccg	Protospacer
..  *  ******** ********** ***

398. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
aggtcgaggtcgcgggcgacgacgccgtag	Protospacer
.   ******** ****** *******. *

399. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK977697 (Microbacterium phage Etta, complete genome) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
acgacgaggacgaggacgaggacgccgagg	Protospacer
.. .***** *****.***********  *

400. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN234181 (Microbacterium phage Pocket, complete genome) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
acgacgaggacgaggacgaggacgccgagg	Protospacer
.. .***** *****.***********  *

401. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MG962367 (Microbacterium phage Gelo, complete genome) position: , mismatch: 8, identity: 0.733

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
acgacgaggacgaggacgaggacgccgagg	Protospacer
.. .***** *****.***********  *

402. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030354 (Novosphingobium sp. P6W plasmid pP6W1, complete sequence) position: , mismatch: 8, identity: 0.733

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
attacgtccaccatcacggcgccggccacc	Protospacer
*...   ***************.** ****

403. spacer 3.6|667093|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP038639 (Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

accggcaccaccatcacggcgctgggcacc	CRISPR spacer
gcttccaccaccatctcggcgctggacaga	Protospacer
.*.  ********** *********.**

404. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ctgctcggctccgtcagcctgaccgtcgcc	Protospacer
    ******* ***.************

405. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gaggtcggctccgtcggcctgaccgaaccc	Protospacer
.* ******** *************

406. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ctcgtcggcgcggccggcctgaccgttgcc	Protospacer
  .****** ***.************.*

407. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016293 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ctcgtcggcgcggccggcctgaccgttgcc	Protospacer
  .****** ***.************.*

408. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK894437 (Microbacterium phage MonChoix, complete genome) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
cgcgatggctcggtcgaccagaccgtcgaa	Protospacer
 ..* .**********.** *********.

409. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 8, identity: 0.733

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
ctcgtcggcgcggccggcctgaccgttgcc	Protospacer
  .****** ***.************.*

410. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
agcgccgccagcatgacgcgggcataggtt	Protospacer
   ********* **********.**  *

411. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
agcgccgccagcatgacgcgggcataggtt	Protospacer
   ********* **********.**  *

412. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgcctgctcgacgcgggcaaggccg	Protospacer
********* ***.*********. . ..*

413. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MT711888 (Pseudomonas phage Dolphis, complete genome) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
atggccgccagcctgatgcgggcgtggcgg	Protospacer
 .**********.***.********. . *

414. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgcctgctcgacgcgggcaaggccg	Protospacer
********* ***.*********. . ..*

415. spacer 3.9|667291|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

tcggccgccagcttgacgcgggcgtacttg	CRISPR spacer
tcggccgcctgctcgacgcgggcaaggccg	Protospacer
********* ***.*********. . ..*

416. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022422 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-7, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ggtggtgcggtcggcgagaccgagcgcgcc	Protospacer
.*   .******************* **

417. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031193 (Humibacter sp. BT305 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
actagcgaggtcggcgagaccgagccctcc	Protospacer
*    ** *******************

418. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ccggtcgcggtcagggagaccgagcccgcc	Protospacer
  * .*******.* *************

419. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049042 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_5, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ggcggcgcggtcggtgagaccgagcgcgcc	Protospacer
.*   *********.********** **

420. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023738 (Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
atcgtcgcgctcggcgagaccgagcgcgac	Protospacer
*   .**** *************** **.

421. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ccggtcgcggtcagggagaccgagcccgcc	Protospacer
  * .*******.* *************

422. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ccggtcgcggtcagggagaccgagcccgcc	Protospacer
  * .*******.* *************

423. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
ccggtcgcggtcagggagaccgagcccgcc	Protospacer
  * .*******.* *************

424. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KX557279 (Gordonia phage Hedwig, complete genome) position: , mismatch: 8, identity: 0.733

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
caggacgcggtcggcgagatcgagccacag	Protospacer
 .*  **************.******  .*

425. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_010332 (Collimonas fungivorans plasmid pTer331, complete sequence) position: , mismatch: 8, identity: 0.733

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
cggcaactacatcgacttcctgcgccgtgc	Protospacer
..  ..********************.**

426. spacer 3.19|667951|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.733

gatggtgcggatatggtcctgcacatgcag	CRISPR spacer
gcgctcgcggatctggtccggcacatgcac	Protospacer
*    .****** ****** *********

427. spacer 3.19|667951|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.733

gatggtgcggatatggtcctgcacatgcag	CRISPR spacer
gcgctcgcggatctggtccggcacatgcac	Protospacer
*    .****** ****** *********

428. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK737942 (Microbacterium phage Sucha, complete genome) position: , mismatch: 8, identity: 0.733

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
ttcacccgagtgtcggaggtcgcgccggtc	Protospacer
    . **.****************.****

429. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.733

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
gtgctgcgggcgtcggaggtcgccgggaag	Protospacer
* ********.************   *.

430. spacer 3.20|668017|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP000618 (Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence) position: , mismatch: 8, identity: 0.733

gagctgcgggtgtcggaggtcgcgctggtc	CRISPR spacer
atccagggggtgtcggtggtcgcgctggag	Protospacer
.  * * ********* ***********

431. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 8, identity: 0.733

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
aagccaagccgccggtcggcgtcttcaccc	Protospacer
.... .* ******************* **

432. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 8, identity: 0.733

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
aagccaagccgccggtcggcgtcttcaccc	Protospacer
.... .* ******************* **

433. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
agatggacccgctgatcggcgtctactcgg	Protospacer
.***********.*.********* *

434. spacer 3.21|668083|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 8, identity: 0.733

ggatggacccgccggtcggcgtcttcaacc	CRISPR spacer
aggccaaggcgccggtcggcgtcttcaccc	Protospacer
.*.. .*  ****************** **

435. spacer 3.23|668215|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_021909 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence) position: , mismatch: 8, identity: 0.733

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
gcgcgccgtcttgacccccttcacctttcc	Protospacer
 *****.********** ****** .. .*

436. spacer 3.24|668281|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_021909 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence) position: , mismatch: 8, identity: 0.733

ccgcgctgtcttgacccacttcacgccgtc	CRISPR spacer
gcgcgccgtcttgacccccttcacctttcc	Protospacer
 *****.********** ****** .. .*

437. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
aacctcggcggcgtcgacgcgccgctcgtc	Protospacer
.** ****************** .*   *

438. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gtccctggcggcgtcggcgcgcgacaggat	Protospacer
* * ..**********.**********

439. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacgtcggcggcgtcgccgcccgcgccccc	Protospacer
**************** *** **    *.

440. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MK737944 (Microbacterium phage Warren, complete genome) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacggcggcggcgtcgacgcgatctcgatc	Protospacer
**** ****************   . * *

441. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MH153799 (Microbacterium phage Appa, complete genome) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacggcggcggcgtcgacgcgatctcgatc	Protospacer
**** ****************   . * *

442. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
ctcgtcggcggcgtcgacgagcgcttcccg	Protospacer
  ***************** *** .  *.*

443. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011667 (Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence) position: , mismatch: 8, identity: 0.733

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
gacgtcggcggcgtcgccgcccgcgccccc	Protospacer
**************** *** **    *.

444. spacer 3.26|668413|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aaccgggttctcgtccatgtctactggagc	CRISPR spacer
acgcgggttctcgtccttgtctacccggat	Protospacer
*  ************* *******. *...

445. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019608 (Tessaracoccus flavescens strain SST-39T plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gacgcggtgctgcttgcgggccttcgcaaca	Protospacer
*  .  *******************.* **

446. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KY549659 (Pectobacterium phage vB_PatP_CB4, complete genome) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gtaaacgtgatggttgcgggccttcatattg	Protospacer
*.******* ** *************.  .

447. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KY514264 (Pectobacterium phage vB_PatP_CB1, complete genome) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gtaaacgtgatggttgcgggccttcatattg	Protospacer
*.******* ** *************.  .

448. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KY514265 (Pectobacterium phage vB_PatP_CB3, complete genome) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gtaaacgtgatggttgcgggccttcatattg	Protospacer
*.******* ** *************.  .

449. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_048704 (Pectobacterium phage Nepra, complete genome) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
gtaaacgtgatggttgcgggccttcatattg	Protospacer
*.******* ** *************.  .

450. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020701 (Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence) position: , mismatch: 8, identity: 0.742

-----gcaaacgtgctgcttgcgggccttcaccacc	CRISPR spacer
ctgctgc-----cgctgcttgcgggcctccacctcc	Protospacer
     **     .***************.**** **

451. spacer 3.27|668479|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KY290952 (Aeromonas phage 32, complete genome) position: , mismatch: 8, identity: 0.742

gcaaacgtgctgcttgcgggccttcaccacc-	CRISPR spacer
acaaacgagctgcttgccggcctt-gtcatgg	Protospacer
.****** ********* ****** ..**.

452. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_023558 (Cronobacter phage Dev2 complete genome) position: , mismatch: 8, identity: 0.733

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
cttcagcaggtcgtagaccttcagttctcc	Protospacer
****************** ** * ..*

453. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 8, identity: 0.733

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
cgatgcggtcggtgtccgggtagacgcgca	Protospacer
  .*  ***** *********.*******.

454. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
ggtacaggtcgctgtccgggttgaccatct	Protospacer
*   ***************** ***   *

455. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to CP052389 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1) position: , mismatch: 8, identity: 0.733

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
cacgtcaccttcttcttcaacggcggcgta	Protospacer
 . .*** * ****************** .

456. spacer 3.2|666827|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 9, identity: 0.71

ccaagagacgcgcggcatgcgtcgcatcccc	CRISPR spacer
ccaacagacacgcggcatgcgtcaggaaact	Protospacer
**** ****.*************. .   *.

457. spacer 3.2|666827|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.71

ccaagagacgcgcggcatgcgtcgcatcccc	CRISPR spacer
gattgtcacgcgcggcaagcctcgcatcccg	Protospacer
    *  ********** ** *********

458. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041206 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence) position: , mismatch: 9, identity: 0.71

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
aggcacggccgacaacaagatccagcatctc	Protospacer
.*. ...*********. ************.

459. spacer 3.4|666960|31|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 9, identity: 0.71

ggaagtagccgacaacgtgatccagcatctt	CRISPR spacer
cggcacggccgacaacaagatccagcatctg	Protospacer
 *. ...*********. ************

460. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
tcggcgaggtcgagggcgaggtcgacctgt	Protospacer
 . ****************** ** * .

461. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to AF440695 (Virus PhiCh1, complete genome) position: , mismatch: 9, identity: 0.7

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cgatcgaggtagagggcgaggaggccggga	Protospacer
    ****** *********** ****  .

462. spacer 3.5|667027|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_004084 (Natrialba phage PhiCh1, complete genome) position: , mismatch: 9, identity: 0.7

gtcgcgaggtcgagggcgaggacgccgccg	CRISPR spacer
cgatcgaggtagagggcgaggaggccggga	Protospacer
    ****** *********** ****  .

463. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.7

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gccctcggcccggtcggcctgaccgcgtgg	Protospacer
. . *****.***************.  .*

464. spacer 3.7|667159|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_019694 (Oscillatoria acuminata PCC 6304 plasmid pOSCIL6304.02, complete sequence) position: , mismatch: 9, identity: 0.7

aatgtcggctcggtcggcctgaccgtcgag	CRISPR spacer
gctgtcggctcggtcgccctgactaaggca	Protospacer
. ************** ******..  * .

465. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014708 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_4p, complete sequence) position: , mismatch: 9, identity: 0.7

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gcccgcgcggtcggcaagaccgcgcccgac	Protospacer
.  . **********.****** *****.

466. spacer 3.10|667357|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 9, identity: 0.7

aggtccgcggtcggcgagaccgagcccggg	CRISPR spacer
gttggcgcggtcggcgaggctgagcccgcc	Protospacer
.    *************.*.*******

467. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MF495477 (Aeromonas salmonicida plasmid pS28-3, complete sequence) position: , mismatch: 9, identity: 0.7

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
cggcaactacatcgaattcctgcgccgtgc	Protospacer
..  ..********* **********.**

468. spacer 3.13|667555|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to KJ850907 (Uncultured bacterium plasmid pSFA231, complete sequence) position: , mismatch: 9, identity: 0.7

tacgggctacatcgacttcctgcgccatga	CRISPR spacer
cggcaactacatcgaattcctgcgccgtgc	Protospacer
..  ..********* **********.**

469. spacer 3.18|667885|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_015169 (Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence) position: , mismatch: 9, identity: 0.7

cgcagcagaccgctgggcaacagagcgtcg	CRISPR spacer
taaagcagaccgctgggcaacaaagaagga	Protospacer
.. *******************.** .  .

470. spacer 3.22|668149|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 9, identity: 0.7

cgggcagagaataagcggatgacggcggac	CRISPR spacer
taaatcgagaagaagcggatgacggcgcaa	Protospacer
..... ***** *************** *

471. spacer 3.22|668149|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 9, identity: 0.7

cgggcagagaataagcggatgacggcggac	CRISPR spacer
taaatcgagaagaagcggatgacggcgcaa	Protospacer
..... ***** *************** *

472. spacer 3.25|668347|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 9, identity: 0.7

gacgtcggcggcgtcgacgcgcgacagctg	CRISPR spacer
cttgtcggcgccgtcgacgagcgacattga	Protospacer
  .******* ******** ****** . .

473. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN549360 (Rhizobium phage RL38J1, complete genome) position: , mismatch: 9, identity: 0.7

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
tttcatcaggtcgtagatgttgacgtaagt	Protospacer
.**** ***********.****** . ..

474. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044066 (Cupriavidus pauculus strain FDAARGOS_664 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
tgcaggcaggtcgtagacgctgacgccggc	Protospacer
. . .**************.**** ***.

475. spacer 3.28|668546|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to MN549361 (Rhizobium phage RL2RES, complete genome) position: , mismatch: 9, identity: 0.7

cttcagcaggtcgtagacgttgaccccgaa	CRISPR spacer
tttcatcaggtcgtagatgttgacgtacgt	Protospacer
.**** ***********.****** .  .

476. spacer 3.29|668612|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NC_009669 (Ochrobactrum anthropi ATCC 49188 plasmid pOANT01, complete sequence) position: , mismatch: 9, identity: 0.7

gcgtcaggtcgctgtccgggtggacgcgcg	CRISPR spacer
ccgtcaggtcgctgaccgggtgatcttcat	Protospacer
 ************* *******. * .

477. spacer 3.30|668678|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042820 (Octadecabacter sp. SW4 plasmid pow41, complete sequence) position: , mismatch: 9, identity: 0.7

ggaatcaacatcttcttcaacggcggcggg	CRISPR spacer
atctacaacatcttgttcatcggcggcgca	Protospacer
.    ********* **** ******** .

478. spacer 1.1|343696|70|CP029356|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 10, identity: 0.857

ggccggcaccggcgccgctgcggcaccggcggccaccctccaccagattacgaatcggcc	CRISPR spacer
ggccggcaccggcgccgctgcggcaccggcggccaccctccaccagattacgaatcggcc	Protospacer
************************************************************

479. spacer 3.3|666894|30|CP029356|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN890657 (Candidatus Promineofilum breve strain Cfx-K plasmid III, complete sequence) position: , mismatch: 10, identity: 0.667

atcttcgtcggcggcgaccgctcaatgggc	CRISPR spacer
cgcttcttcggcggcgaccgctcctaaaaa	Protospacer
  **** ****************   ...

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP029352

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

346148 : 380444

Synechococcus_phage(15.0%)

transposase,capsid,portal,integrase,terminase

attL 375979:375995|attR 384531:384547

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK85029.1\|346148_347384_-	hypothetical protein	A0A0S0MV10	Pseudomonas_phage	1.1e-17	27.4
AWK85030.1\|347461_347926_-	hypothetical protein	NA	NA	NA	NA
AWK85031.1\|347922_348558_-	hypothetical protein	NA	NA	NA	NA
AWK85032.1\|348561_348885_-	hypothetical protein	NA	NA	NA	NA
AWK85033.1\|348881_349451_-	hypothetical protein	B0VK37	Azospirillum_phage	3.6e-13	32.9
AWK85034.1\|349507_350929_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.0e-60	32.8
AWK85035.1\|351036_351465_-	hypothetical protein	NA	NA	NA	NA
AWK85036.1\|351526_352789_-\|capsid	phage major capsid protein	A0A192Y5T6	Salmonella_phage	1.9e-83	43.0
AWK85037.1\|352800_353637_-	peptidase	Q3HQS9	Burkholderia_phage	1.4e-69	57.9
AWK85813.1\|353614_354787_-\|portal	phage portal protein	Q3HQS8	Burkholderia_phage	2.5e-93	48.3
AWK85038.1\|354916_356707_-\|terminase	phage terminase small subunit P27 family	A0A0U2C138	Paracoccus_phage	2.1e-136	45.7
AWK85039.1\|356663_357131_-\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	2.0e-41	57.1
AWK85040.1\|357229_357562_-	HNH endonuclease	B0VK27	Azospirillum_phage	3.6e-29	55.5
AWK85041.1\|357561_357774_-	hypothetical protein	NA	NA	NA	NA
AWK85042.1\|357770_358106_-	hypothetical protein	NA	NA	NA	NA
AWK85043.1\|358423_358615_+	transcriptional regulator	NA	NA	NA	NA
AWK85044.1\|358834_359365_-	hypothetical protein	NA	NA	NA	NA
AWK85045.1\|359729_361820_-	hypothetical protein	A0A291LAR9	Bordetella_phage	1.1e-75	36.6
AWK85046.1\|361955_362153_+	hypothetical protein	NA	NA	NA	NA
AWK85047.1\|362516_362882_-	VRR-NUC domain-containing protein	A0A2I5ARE6	Synechococcus_phage	2.6e-20	50.9
AWK85814.1\|362878_363538_-	hypothetical protein	NA	NA	NA	NA
AWK85048.1\|363546_365103_-	helicase	G8EY40	Synechococcus_phage	2.6e-82	38.0
AWK85049.1\|365109_366129_-	site-specific DNA-methyltransferase	F4YCV3	Synechococcus_phage	7.3e-57	37.8
AWK85050.1\|366121_367546_-	helicase	F8TUW6	EBPR_podovirus	2.4e-106	48.1
AWK85051.1\|368303_368729_-	hypothetical protein	NA	NA	NA	NA
AWK85052.1\|368725_368938_-	hypothetical protein	NA	NA	NA	NA
AWK85053.1\|368966_369764_+	hypothetical protein	A0A141GF24	Brucella_phage	6.0e-22	42.9
AWK85054.1\|369825_370080_+	hypothetical protein	NA	NA	NA	NA
AWK85055.1\|370422_371049_-	hypothetical protein	S5WJ01	Leptospira_phage	5.6e-07	32.7
AWK85056.1\|371663_372380_-	nuclease	A0A0R6PHV6	Moraxella_phage	1.6e-10	36.2
AWK85057.1\|372621_372813_+	hypothetical protein	NA	NA	NA	NA
AWK85058.1\|373056_373365_+	hypothetical protein	NA	NA	NA	NA
AWK85059.1\|373361_373577_+	hypothetical protein	NA	NA	NA	NA
AWK85060.1\|373579_374737_+	exodeoxyribonuclease V	A0A291LA07	Bordetella_phage	2.8e-65	41.1
AWK85061.1\|374736_375147_+	hypothetical protein	NA	NA	NA	NA
AWK85062.1\|375155_376022_+	hypothetical protein	NA	NA	NA	NA
375979:375995	attL	NA	NA	NA	NA
AWK85063.1\|376052_377492_+	hypothetical protein	NA	NA	NA	NA
AWK85064.1\|377541_377961_+	hypothetical protein	NA	NA	NA	NA
AWK85065.1\|377967_379083_+	hypothetical protein	A0A0A8IL17	Aurantimonas_phage	9.9e-31	28.7
AWK85815.1\|379095_379536_+	hypothetical protein	NA	NA	NA	NA
AWK85066.1\|379280_380444_+\|integrase	integrase	A0A240F4W2	Ochrobactrum_phage	3.1e-43	32.5
384531:384547	attR	NA	NA	NA	NA

DBSCAN-SWA_2

770432 : 832933

Acinetobacter_phage(23.53%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK85360.1\|770432_771601_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.3e-53	40.7
AWK85361.1\|772099_772282_-	hypothetical protein	NA	NA	NA	NA
AWK85362.1\|772206_776805_-	hypothetical protein	NA	NA	NA	NA
AWK85363.1\|778018_778336_-	50S ribosomal protein L23	NA	NA	NA	NA
AWK85364.1\|778226_778961_+	hypothetical protein	NA	NA	NA	NA
AWK85365.1\|779209_779830_-	hypothetical protein	NA	NA	NA	NA
AWK85366.1\|780114_780510_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWK85367.1\|780506_781418_+\|transposase	IS3 family transposase	NA	NA	NA	NA
AWK85368.1\|781437_781632_-	hypothetical protein	NA	NA	NA	NA
AWK85369.1\|781670_782851_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.4e-53	40.7
AWK85370.1\|782939_784265_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.1e-84	42.8
AWK85371.1\|784384_785806_-	hypothetical protein	NA	NA	NA	NA
AWK85372.1\|785853_787125_+	hypothetical protein	NA	NA	NA	NA
AWK85373.1\|787403_787589_+	hypothetical protein	NA	NA	NA	NA
AWK85374.1\|788171_788834_+	acetyl-CoA--acetoacetyl-CoA transferase subunit alpha	NA	NA	NA	NA
AWK85375.1\|788826_789483_+	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AWK85376.1\|789570_790944_+	TIGR00366 family protein	NA	NA	NA	NA
AWK85377.1\|791035_792211_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
AWK85378.1\|792119_794027_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-05	54.4
AWK85379.1\|794084_794489_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
AWK85380.1\|794646_797727_-	multidrug efflux protein	S5VTK5	Leptospira_phage	1.4e-58	22.3
AWK85840.1\|797743_798982_-	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AWK85381.1\|799004_799739_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWK85382.1\|799956_801921_-	hypothetical protein	NA	NA	NA	NA
AWK85383.1\|802250_802913_-	DNA-binding protein	NA	NA	NA	NA
AWK85384.1\|803035_805540_-	histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	6.5e-06	22.7
AWK85385.1\|805511_806186_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.8e-26	32.9
AWK85386.1\|806237_807104_-	universal stress protein	NA	NA	NA	NA
AWK85387.1\|807117_807807_-	hypothetical protein	W8EBD0	Pseudomonas_phage	2.7e-15	34.6
AWK85388.1\|807849_809388_-	tripartite tricarboxylate transporter TctA	NA	NA	NA	NA
AWK85389.1\|809463_809946_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AWK85841.1\|810019_810976_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWK85390.1\|811179_812265_-	hypothetical protein	NA	NA	NA	NA
AWK85391.1\|812599_813043_+	hypothetical protein	NA	NA	NA	NA
AWK85392.1\|813170_813353_+	hemin uptake protein HemP	NA	NA	NA	NA
AWK85393.1\|813456_815649_+	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	A0A0P0I887	Acinetobacter_phage	5.1e-07	30.5
AWK85842.1\|815711_816773_+	hemin-degrading factor	NA	NA	NA	NA
AWK85394.1\|816772_817618_+	hemin ABC transporter substrate-binding protein	NA	NA	NA	NA
AWK85843.1\|817632_818670_+	iron ABC transporter	NA	NA	NA	NA
AWK85395.1\|818666_819443_+	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	2.6e-06	27.7
AWK85396.1\|819663_820764_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AWK85397.1\|820854_822003_+	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.9e-25	38.3
AWK85398.1\|821999_822932_+	putrescine ABC transporter permease PotH	Q6GZ02	Mycoplasma_phage	1.1e-11	28.5
AWK85399.1\|822928_823762_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AWK85400.1\|824189_825209_+	agmatine deiminase	O41120	Paramecium_bursaria_Chlorella_virus	3.2e-68	38.9
AWK85401.1\|825358_826990_+	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	7.4e-11	38.1
AWK85844.1\|827080_827350_+	hypothetical protein	NA	NA	NA	NA
AWK85402.1\|828399_829620_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.5e-43	44.4
AWK85403.1\|829993_831174_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.4e-53	40.7
AWK85845.1\|831670_832933_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	7.0e-41	32.5

DBSCAN-SWA_3

1071243 : 1081002

uncultured_Caudovirales_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWK85865.1\|1071243_1073613_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-07	76.7
AWK85578.1\|1074021_1074237_+	hypothetical protein	NA	NA	NA	NA
AWK85866.1\|1074265_1074424_-	DUF3309 domain-containing protein	NA	NA	NA	NA
AWK85579.1\|1074780_1075482_+	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AWK85580.1\|1075502_1076159_+	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AWK85581.1\|1076176_1076638_+	hypothetical protein	W8W1H2	Invertebrate_iridovirus	1.6e-27	40.6
AWK85582.1\|1076658_1077657_-	hypothetical protein	K4F9T9	Cronobacter_phage	5.5e-41	34.1
AWK85583.1\|1078025_1078301_+	DNA-binding protein HU	A4JWM7	Burkholderia_virus	2.3e-18	55.1
AWK85584.1\|1078330_1078741_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-25	49.2
AWK85585.1\|1078983_1079505_-	GNAT family N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	3.1e-19	39.2
AWK85586.1\|1080108_1081002_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	4.6e-31	33.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. CP029355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029355_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029355_1

31546-31757

Orphan

Consensus_repeat	Method
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	PILER-CR
CCCTTCCCCGCAGGCGCGGGGGTGAACC	CRISPRCasFinder
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	CRT

3 spacers

The CRISPR arrays of CP029355_1

>merge|CP029355|1|31546-31757|PILER-CR,CRISPRCasFinder,CRT
CCCTTCCCCGCAGGCGCGGGGGTGAACCGGTCAGCAGCTTGGCCGCCGCCGCAGACGCAGCCCCTTCCCCGCAGGCGCGGGGGTGAACCGTCGCCGAACTGCGCCGACAGCACGCCCTCGTCCCCTTCCCCGCAGGCGCGGGGGTGAACCGACCAGCAGGTTGATCGCCGAAGCGGTCACCGTCCCTTCCCCGTAGGCGCGGGGGTGAACCA

>CP029355|1|1|31546-31757|PILER-CR
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	GTCAGCAGCTTGGCCGCCGCCGCAGACGCAGC
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	TCGCCGAACTGCGCCGACAGCACGCCCTCGTC
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	ACCAGCAGGTTGATCGCCGAAGCGGTCACCGT
CCCTTCCCCGTAGGCGCGGGGGTGAACCA

>CP029355|1|1|31546-31756|CRISPRCasFinder
CCCTTCCCCGCAGGCGCGGGGGTGAACC	GGTCAGCAGCTTGGCCGCCGCCGCAGACGCAGC
CCCTTCCCCGCAGGCGCGGGGGTGAACC	GTCGCCGAACTGCGCCGACAGCACGCCCTCGTC
CCCTTCCCCGCAGGCGCGGGGGTGAACC	GACCAGCAGGTTGATCGCCGAAGCGGTCACCGT
CCCTTCCCCGTAGGCGCGGGGGTGAACC

>CP029355|1|1|31546-31757|CRT
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	GTCAGCAGCTTGGCCGCCGCCGCAGACGCAGC
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	TCGCCGAACTGCGCCGACAGCACGCCCTCGTC
CCCTTCCCCGCAGGCGCGGGGGTGAACCG	ACCAGCAGGTTGATCGCCGAAGCGGTCACCGT
CCCTTCCCCGTAGGCGCGGGGGTGAACCA

Protein	Signature genes	Signature genes Name	Protein_function
CP029355.1\|AWK88595.1\|40989_42771_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237539
CP029355.1\|AWK88587.1\|32230_32911_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349760
CP029355.1\|AWK88581.1\|23004_24255_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238182
CP029355.1\|AWK88594.1\|39100_40993_-\|conjugal-transfer-protein-TraG	unknown	unknown	gnl\|CDD\|237540
CP029355.1\|AWK88588.1\|32907_33228_+\|hypothetical-protein	unknown	unknown	unknown
CP029355.1\|AWK88583.1\|27801_28146_+\|Na+/H+-antiporter-subunit-C	unknown	unknown	gnl\|CDD\|236377
CP029355.1\|AWK88584.1\|28142_29768_+\|monovalent-cation/H+-antiporter-subunit-D	unknown	unknown	gnl\|CDD\|237166
CP029355.1\|AWK88592.1\|37932_38553_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381613
CP029355.1\|AWK88593.1\|38549_39104_-\|conjugative-transfer-signal-peptidase-TraF	unknown	unknown	gnl\|CDD\|131818
CP029355.1\|AWK88580.1\|22153_23008_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP029355.1\|AWK88582.1\|24847_27802_+\|monovalent-cation/H+-antiporter-subunit-A	unknown	unknown	gnl\|CDD\|237157
CP029355.1\|AWK88590.1\|33894_35160_+\|DNA-polymerase-V-subunit-UmuC	unknown	unknown	gnl\|CDD\|176454
CP029355.1\|AWK88634.1\|37718_37910_-\|hypothetical-protein	unknown	unknown	unknown
CP029355.1\|AWK88579.1\|20372_21986_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|226654
CP029355.1\|AWK88633.1\|30252_30531_+\|K+/H+-antiporter-subunit-F	unknown	unknown	gnl\|CDD\|180435
CP029355.1\|AWK88589.1\|33462_33891_+\|peptidase-S24	unknown	unknown	gnl\|CDD\|182350
CP029355.1\|AWK88632.1\|24309_24798_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224676
CP029355.1\|AWK88585.1\|29764_30253_+\|Na+/H+-antiporter-subunit-E	unknown	unknown	gnl\|CDD\|181598
CP029355.1\|AWK88591.1\|35452_37732_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226680
CP029355.1\|AWK88586.1\|30527_30872_+\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|183670

Protein	Function_ID	Function_description	E-value
CP029355.1\|AWK88595.1\|40989_42771_-\|hypothetical-protein	gnl\|CDD\|237539	PRK13878, PRK13878, conjugal transfer relaxase TraI; Provisional.	2.01125e-84
CP029355.1\|AWK88587.1\|32230_32911_+\|hypothetical-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.25086e-22
CP029355.1\|AWK88581.1\|23004_24255_+\|hypothetical-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	1.6147e-21
CP029355.1\|AWK88594.1\|39100_40993_-\|conjugal-transfer-protein-TraG	gnl\|CDD\|237540	PRK13880, PRK13880, conjugal transfer coupling protein TraG; Provisional.	0
CP029355.1\|AWK88593.1\|38549_39104_-\|conjugative-transfer-signal-peptidase-TraF	gnl\|CDD\|131818	TIGR02771, Conjugal_transfer_protein_TraF, conjugative transfer signal peptidase TraF. This protein is found in apparent operons encoding elements of conjugative transfer systems. This family is homologous to a broader family of signal (leader) peptidases such as lepB. This family is present in both Ti-type and I-type conjugative systems.	3.90047e-47
CP029355.1\|AWK88583.1\|27801_28146_+\|Na+/H+-antiporter-subunit-C	gnl\|CDD\|236377	PRK09094, PRK09094, putative monovalent cation/H+ antiporter subunit C; Reviewed.	1.30363e-66
CP029355.1\|AWK88584.1\|28142_29768_+\|monovalent-cation/H+-antiporter-subunit-D	gnl\|CDD\|237166	PRK12666, PRK12666, putative monovalent cation/H+ antiporter subunit D; Reviewed.	0
CP029355.1\|AWK88592.1\|37932_38553_-\|hypothetical-protein	gnl\|CDD\|381613	cd16892, LT_VirB1-like, VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	8.13344e-71
CP029355.1\|AWK88580.1\|22153_23008_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.08362e-21
CP029355.1\|AWK88582.1\|24847_27802_+\|monovalent-cation/H+-antiporter-subunit-A	gnl\|CDD\|237157	PRK12648, PRK12648, putative monovalent cation/H+ antiporter subunit A; Reviewed.	0
CP029355.1\|AWK88590.1\|33894_35160_+\|DNA-polymerase-V-subunit-UmuC	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	6.74547e-171
CP029355.1\|AWK88579.1\|20372_21986_-\|histidine-kinase	gnl\|CDD\|226654	COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms].	1.49964e-44
CP029355.1\|AWK88633.1\|30252_30531_+\|K+/H+-antiporter-subunit-F	gnl\|CDD\|180435	PRK06161, PRK06161, putative monovalent cation/H+ antiporter subunit F; Reviewed.	2.34001e-35
CP029355.1\|AWK88589.1\|33462_33891_+\|peptidase-S24	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	1.23913e-40
CP029355.1\|AWK88632.1\|24309_24798_+\|transcriptional-regulator	gnl\|CDD\|224676	COG1762, PtsN, Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type) [Carbohydrate transport and metabolism / Signal transduction mechanisms].	1.52454e-27
CP029355.1\|AWK88585.1\|29764_30253_+\|Na+/H+-antiporter-subunit-E	gnl\|CDD\|181598	PRK08965, PRK08965, putative monovalent cation/H+ antiporter subunit E; Reviewed.	1.87585e-56
CP029355.1\|AWK88591.1\|35452_37732_-\|hypothetical-protein	gnl\|CDD\|226680	COG4227, COG4227, Antirestriction protein [DNA replication, recombination, and repair].	4.86212e-93
CP029355.1\|AWK88586.1\|30527_30872_+\|cation:proton-antiporter	gnl\|CDD\|183670	PRK12671, PRK12671, putative monovalent cation/H+ antiporter subunit G; Reviewed.	3.59208e-51

>CP029355.1|AWK88586.1|30527_30872_+|cation:proton-antiporter
MTHLAELPSWAALLTALLLLLGAGLALIGSFGLLRFGSFYERIHAPTLGSTLGIGFVLIASMLFFSVLQSRPVLHEVLITALMVVTTPITLMLLARAALYRDRTEGNDDVPPSA
>CP029355.1|AWK88633.1|30252_30531_+|K+/H+-antiporter-subunit-F
MTDVLIWSIFLAQILMVLAMGCAVFRILRGPRAQDRVVGLDALYVNATMLLLVFGMRTTSTLYFEAALIIALLGFVSTAAIAKFLMRGEVIE
>CP029355.1|AWK88585.1|29764_30253_+|Na+/H+-antiporter-subunit-E
MTCWLPLPLLTATLLAVWLILNESVSPGALILGGVLSVGAVRVLLALEPPEGRFRRPLVALRLALVVLGDIVRSNIAVARIILNSGTRDRTSGFVRIPLDLRAPYGLATLACIITATPGTIWVEYDSARNTVLLHILDLVDEETWIETIKQRYEKRLIEVFE
>CP029355.1|AWK88584.1|28142_29768_+|monovalent-cation/H+-antiporter-subunit-D
MSGWMNHLTVAPIIIPLLAGTVMMLIDERRRTLKAVLGVASALVLLVLAVVLLLMADGAPSGSGAVRVYRLGNWPSLFGIVLVLDRLAALMLLLTAILGVAALVFSLARWQHAGAHFHSLFQFQLMGLNGAFLTGDLFNLFVFFEIMLAASYGLALHGSGLARVRAGLHYLVINLAASLLFLIGVSMIYGVAGTLNMAELATRIAVVAGEDRALLEAGAAILGIAFLIKAGMWPLGFWLPNTYATVSAASAAIISILSKVGVYAVLRLWLLMFGESGGASAGFGGLWLLAGGLLTIAFGSVAVLATQNMARLAGASVLVSSGTLLAAVGTGQVAVTGGALFYLTSSVLGIAGFFLLIELVERGRELGADVLAVTREAFGEDEEADEDDQIGVPIPATMAILGASFVACALLLAGLPPLSAFLAKFAMLAPLLSPGSAGVSATTWALLAAFILSGLATIVAMTRTGIDVFWASPAATVPRVRVVELAPVMLLLTLCVALSVQAGPVMRYMEATAQSLYVPHGYVTGVVPTPSWPSGTEGDRR
>CP029355.1|AWK88583.1|27801_28146_+|Na+/H+-antiporter-subunit-C
MELILALGIGVLTGSGVWLLLRPRTFQVIIGLSLLSYAVNLFIFSTGGLRTGAAPVLERGAVGHLATHADPVPQALVLTAIVISFATTALFLVVLLAARGLTGTDHVDGREKDR
>CP029355.1|AWK88582.1|24847_27802_+|monovalent-cation/H+-antiporter-subunit-A
MPDALLLLTLVGLPFLGATAAGLLPTHARNAAAWLAGGTALVGIALVWAAYPTVAAGGVLRHEVAWMPSLGLNLVLRMDGFAWLFAGMVSGVGALVILYARYYMAADDPVPRFFAFLLAFMGSMTGMVISGNLIQLAFFWELTSLFSFLLIGYWHHLAAARDGARMALTITATGGLCLFAGVLVLGHIVGSYDLDAVLAAGDRIRAHPLYLPALILILLGALTKSAQFPFHFWLPHAMAAPTPVSAYLHSATLVKAGVFLMARLWPVLAGTDAWFWIVGTAGIATLILGAYIAIFQHDLKGLLAYSTISHLGLITLLLGLNSELAMVAAIFHIINHATFKASLFMAAGIIDHETGTRDIRRLSGLNRFMPFTARLALVAAAAMAGVPLLNGFLSKEMFFAEALSAEGPLPLLLDVLPAAATVASAFSVAYSLRFIHGAFFGPDPVDLPLTPHEPPTWMRFPVEILVLACIIIGLLPAATVGPYLDMAAHAALGAATPDYSLAVWHGFNLPLLMSLIALAAGVSLYLLLQRHLRKGEEGAPLIGGLQGQRMFERTMVFLSWRLARTLEGLLGTRRLQPQLRLVVCVAVLAAGWTVTLRGLGPGNLTPAGIDPVLALIWAIGAACALGAAWQAKYHRLVALILLGGTGLVTCVTFVWFSAPDLALTQLLVEVVTTILLLLGLRWLPKRLDVPGARPPEVITTTRRLRDLGIAAAAGFGMAGLAFGVMTRFPPEILAEHFLERAYTEGGGTNVVNVILVDFRGFDTLGEITVLAAVALTAYALLRRFRPAPDSVDVPEQQRDQSAYDIARPERREGDTVADWLLIPSIIARLLFPVIALVAVYLLLRGHDLPGGGFAAGLTASIALILQYMLGGTQWVEARLRVLPLRWMGLGLLLATGTGLAAWAFGRPFLTTYFTYAELPLVGTVPMASALLFDIGVFALVVGATMLMLIALARQSVRGHRAVAPRPADEPAAVTAPAATAMGDD
>CP029355.1|AWK88632.1|24309_24798_+|transcriptional-regulator
MSIAELLSAPNVILDAEPTNKAALLDFLAAEAGQRLGLPKPEVLGALEAREKLGSTALGRGVALPHAEIRDAQAPLLLFARLRRAVNFEARDEEPVDLVFLVLWPAAARKGLLPAMSDICRALREPQTLRWLRAAETPEDVVRLVLQAVPPEAARDEAPRGE
>CP029355.1|AWK88581.1|23004_24255_+|hypothetical-protein
MRGRAMRSHAPGCPGRGLLLGSGLRIPGAVGEEMRPQPLGRSWFHPSLLPSRPPASAAGRNTGDDPMDMDREPWPPGRRRENTQSGDNVVPLRPESGTDALAPRPTARRAPEGVPGTAGQPSWSEGPPHRILLATDLSFRCERALERAASLSAQWQSELVVLHVLDTPTSSLPEANCRPSWPPVEPRSLAWKRLLADVGAVTKQATLLIQEGDPAEAIVHTVETEHCGLIVLGITRDAVLERIFLDRTTDRLLRRSRVPLLIVKERSWRPYRDIVVATDFSDASCEALEVAARLFPGQAPTVFHAYEAPFSGLAADPRACRRDYRDIAMQQCRAFLARVRRPAAWRPERVVVENGSPDLLLRNYVRDLDVDLVVLGMHRRNAILELIAGSIAKTIMDDVPCDVLVIQERSDVHART
>CP029355.1|AWK88580.1|22153_23008_+|universal-stress-protein
MTTLRRILLATDLEPKSDRAMERAVQLARQSGAELAALHVVHDGEGPYAHLPLHHIEAELHRHLVAVPGGDGVSTRAVAVRGAAVEPQVADYAGLWRPDLVVTGVHARDHLADLFLAPTIERIAVANETPVLIVRDKPLRPYARALVPVDFSERSRAAVEVACRLVIGGSLHLLHVLDLPSATRSPVGLHGVGESIHEFAEEFGALLKGVAFGDAAVTREVRIGPPVPEIVRTARHGRYDLVVMGSARHDGLMRALLGSVTQDVLAEMPCDVLMAGDPVGDHQQ
>CP029355.1|AWK88579.1|20372_21986_-|histidine-kinase
MPKDLRGRMVLVPAYLAAHLALDWVSFIHEVAPLNITPWNPPAGLMMGMLIVVGVRAVPLVWLGLMVADLMVRDLPVALWVTAVANGILAAGYGGAAWALRRRLGLDPRLSKLRDIVLLLVGAAVTPLAVGTGYIALHTLVGLFPWSGFAWALLRYWVGEVIGITVLTPVVLVALRGTAPHASWKGAAELAAYGLLIGVTLWLDFGPLASVQYEHFYLLFLPAVAVAVRHGLAGAALASAATQAGLIVAIQATGVETARTTHFQLLMLTLAVTALLLGAVVSERRRVEAAIRERQSDLARASRLTEAGEMAAALAHELNQPLSAAMSYARAARKIAKLEQASPRLSKILDKTVAQAERADRVIRSLRDFVRKGRSDPAPLSVGALVADCLALAAPLAGQHSVSIQAEVAPGLPAVSGDAVQLQQVILNLVRNAAEAMDAPDPRRRRIVVFAHPAAEAGFVAVGVRDSGPGLAGVVERNLFAPFVTTKATGMGLGLSIARSIVEGHGGTLTSERLPHGETVFRFTIPIHGAGADSDES
>CP029355.1|AWK88587.1|32230_32911_+|hypothetical-protein
MPVIALASVKGGVGKTSALLSLASDLALSGSSVSVLDADPNGHASRIGIKMAKRLNGSAFSATGGITEANILAAIKQARTEVDYVLVDLPGVSSKLTLLGLARSDLVIIPVQASEMDIHDALQTVENVKQAAEAADRTIAACFLLSRWPVTIESRAAKETRKRLSAKAPDVPVLQTPLMDRTALKEMTFNGAPPRLTDPDGNAAANVSSICQEVLVQLGANVERAA
>CP029355.1|AWK88588.1|32907_33228_+|hypothetical-protein
MSKKIPLPLDDDDDVLAQRIAETATQRGIPSLTPAPAAPSPASAGTRRPIKIEVSDPLFEALTVAAAKQKVTKRYLILSALRDAGYPVEDTDFQEDGRRLRGSRKS
>CP029355.1|AWK88589.1|33462_33891_+|peptidase-S24
MQWPLPVIARPCPVIQVEALVSAGFPSPAADYVEGRIDLTEVLVPHPSSTFTLRVVGHSMVRAGIHDGDFAIVDRSLVARHDDVVVAALDGELVCKRLLRRSGRVYLVAESDDPAYRPIEVTDRDSFEIWGVVTATIRMHRR
>CP029355.1|AWK88590.1|33894_35160_+|DNA-polymerase-V-subunit-UmuC
MARTLALVDCNNFYVSCERVFRPDLEGVPVGVLSNNDGCFVARSAELKALGVRMGQPLFEVRDLVRHHHVRVFSSNYALYGDMSARVTDCLRGFTPALEIYSIDESFLDLTGIGGDLSGYGAEIRQTVKRWTGIPVCVGIGPTKVLAKLSNHAAKKALLDDRGVCDLRDADAREHVLRAVPVEEVWGIGRRSAEKLSLLGVRTAADLRNLDPRLARQALTVVGERIVYELQGVACLSLDLVPPSRKTIAVTRSFGQPVTDWEPMREAVAAYATRAAEKLRAERLAAEALQVFMHTSPFRPGPTYSNAVTVELRPATDDTFALIAAAAAAARRIWRDGYAFSKAGVILPGLVPLERVQPDLLAAADRQRGTRLMKALDAINSTMGKDTLVPAATMGRAWRMRQEQRSPSYTTRLADVPVVQA
>CP029355.1|AWK88591.1|35452_37732_-|hypothetical-protein
MAANDFVQTVADTIIGQLKEGTAPWIKPWKPGERHLPYNPTTGNDYRGANTLWLMAVGQARGYGDPRWMTYNQAQDMGAQVRKGERGTRVQYWKWQGLEPVLGLDGKPVIGEDGQPRKEMVRYERPRVLSAVVFNAAQIDGLPAAEAKPALPEWQRHEQAERLLSAGDPKILHQAGNRAYYSPVRDHIVLPERAQFPTADGFYATALHEKGHWTGHSSRLDRDLSHPFGSAGYAREELRAEIASMVLGQQLEIGHDPGQHVAYIGSWIEALQEDPREIFRAAADAEKIVKHLNGLAQQLSQDQTQEQAQGRDRAATPPAQSQDEGVQVKMPVLIAETQAVAMQTADERVYLAVPYAEKDEAKALGARWDREQKAWYAPPGTDLAPLEKWRPGHTDLHVDAGRDPRAEFAAALREAGLRLDGPPEMDGQMRRVKVEGDKPGERSGAYVGYTDGHPAGYIKNHKTGVERNWKAPGRVQATTAVDRARLSAEAVQRRQARAQERELVQERAAEAAEARLAQAGPAPDDHPYLRAKEVPSYGLRQDREGNLLVPIRDMDGKVMSVQAITAEGRKSFQKDARTQGGHFLIGDAAASPSVLVAEGYATAATLHRETGLAVAVAFNAGNLGPVAEALRQRYPDKPLVIAGDNDHVNERQGKPNVGREKAEDAAARVGGTVLLPAFRLDDRGTDWNDLARSQGRAVLFEQVSAGLARGERQRMAGELAQARQAQVQGQERSQHQDEGRRLTQVEPETQRRKARSIGR
>CP029355.1|AWK88634.1|37718_37910_-|hypothetical-protein
MQQDAILSTSLSDLGTPGVVVEVDPDEAEALGAFEETALSETDAWESQADLGDELEGRGHGGE
>CP029355.1|AWK88592.1|37932_38553_-|hypothetical-protein
MIDIALILACAPDVAPQTVQEVIRVESRGNPLAININGATLARPAVDVADAVKLATSAMAAGYTVDLGLMQVNSANLPKLGYTVEQMFDPCLNLKAGAAILTANYGRAVERHGPGQDALKAALSAYNTGSFERGFRNGYVARYYGEGVTLAAGAASGDAAPPRQPRPQPAPETAPADPYHAETTAYRRTSNVQQPPSDRGAAPGGQ
>CP029355.1|AWK88593.1|38549_39104_-|conjugative-transfer-signal-peptidase-TraF
MSRATRGRRFALGVWCAAVLTSVATAAAGMAGWRINSTPSLPVGLWRVDAAGTVAPGVVVELCPPDSAPFRLARERGYVPAGSCPGGYQPLFKPIAAQAGDEVELTAEGVWVNGVLLANSRPLAADGAGRPMPVLPRGRYRVEAGTVWVVSSHHPASFDSRYFGALPLESIQGTARPILVQGAS
>CP029355.1|AWK88594.1|39100_40993_-|conjugal-transfer-protein-TraG
MTTAGPLIPTLQPRRKRSRARLFGPLLLAGTAVGLSSVCTQYVAQSLDYHPALGEPLAGVFYPPWAWFRWQMDWYWNAKEVFDKAYLGFLGGLGASILTYVLAVGFATRSGIRHEGVHGTAHWADKAAVQRSGLLPAADKPGAGVYVGGWTDPATGRLHYLRHNGPEHIAAIAPPRSGKGVGLVVPTLLSWPHSVVVHDMKGELWAMSAGWRKAQGHVVMKFDPAAAEGSVAFNPLAEIRFGTLYEVGDVQNVVTIMVDPQGTGQLDHWAASAHALLTGVILHLSYKEAKEGRAVTLPAVAQALSDPERPVMDLYVEMLENRHLWKAESGEHAAHPVVAAAARDMLNTEDEERASILSTARRFLSLYRDPLVEKNTGRSDFMVGDLMDHERPVSLYLVVRPADKDRLKPLMRLVINQIVRVLVRDELTFIDGREQALHKHRLLLLLDEFASFGKLEVFQEALSFITGYGIKAYVIVQDVAQLWNLYGKDESILSNCHVRVAYAPNKVETAEWLSKMTGTTTIIKEDISTSGSRFGAVLQSVTRSYHEVSRPLLTPDEVMRLKAPVKDEEGRISEPGDVLVFTAGHAPVYGTQSLYFRDPVFAERAKIPAPPTDRLRGLRPGAAPGKAFVL
>CP029355.1|AWK88595.1|40989_42771_-|hypothetical-protein
MAIREILATQERNKRAKGDKTYHLIVSFPEGEVPTREQLADIEDTLCAGIGYAEHQRISAAHTNTKHFHIHIAINRVHPRTLRCVEPFYDHKELFKLCRALEQKHGLQLHPMDGPALPGRPGDLEAHAGEASFLRWVKETAGVELVERAGKAASWGELHAALERHGLAIRPKGAGLVIVQESTGLAVKESSVDRSLSAQALTKRLGAYEPPPRAQTQGRSNGDSSQWGAAGDAARPGRGGYQRAPLHRHADSEVLYQQYQAQRETLVKARAAQRAALRQAQAEHAKELAAWYAARRAEIKRSPVLSAAERRHAYAMLAHQRRADAAARRQELARQRQEAAQQGLPTWQDFLMAEAGRGNEVAVAVLRSRSRRQRRMAETLLTAADADAARHIVYERLQPKAGKDGALVYRVEDGGVVSDEAAQVRVTAVTAGAAFLALSLADDRFRGQALVVEGTQAFRRQVAQLAAMKGLEVRFADPELERERARMAERMTHAEGSTTVAAFISRRNSMRDTVPSVDYTRLWAGSDAGPAVYHGRRRLQDGAEVVLLQRGGETLVKPVTPAQAAKASTWRVGQTVELDSRGRFLTPSRGRKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP017760	Cupriavidus necator strain NH9 plasmid pENH91, complete sequence	11254-11285	5	0.844
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	79428-79459	5	0.844
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_006830	Achromobacter xylosoxidans A8 plasmid pA81, complete sequence	88187-88218	5	0.844
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_014154	Thiomonas intermedia K12 plasmid pTINT01, complete sequence	16571-16602	6	0.812
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	227366-227397	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	25216-25247	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	46154-46185	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	177346-177377	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP011600	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence	137627-137658	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	204794-204825	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	134299-134330	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	168750-168781	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	11850-11881	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	171762-171793	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	45078-45109	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	150984-151015	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	150967-150998	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	21356-21387	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	26662-26693	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MT077884	Escherichia coli plasmid p33, complete sequence	99963-99994	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MT077886	Escherichia coli plasmid p39, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	94722-94753	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	45089-45120	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	46165-46196	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	163582-163613	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	101474-101505	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	69047-69078	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	33691-33722	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	31923-31954	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	31922-31953	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	31904-31935	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	31827-31858	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	31915-31946	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	31825-31856	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	31918-31949	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	31823-31854	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	31920-31951	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	31838-31869	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	31820-31851	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	31825-31856	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	31915-31946	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	128541-128572	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	96609-96640	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	14792-14823	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	20640-20671	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP035380	Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence	66675-66706	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	106364-106395	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	91362-91393	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	64635-64666	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	154349-154380	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	103450-103481	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP041374	Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence	26662-26693	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	211968-211999	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	241094-241125	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	50839-50870	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	137022-137053	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_AP018757	Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence	70555-70586	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	132670-132701	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	84021-84052	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	45077-45108	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042495	Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence	21330-21361	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	54234-54265	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	42655-42686	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	184072-184103	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_AP019666	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence	36412-36443	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	82695-82726	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	30226-30257	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	232014-232045	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	71737-71768	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	202023-202054	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	99924-99955	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	46412-46443	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	45091-45122	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	177504-177535	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	31824-31855	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	50028-50059	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	88705-88736	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	50483-50514	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	88705-88736	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	46409-46440	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	87587-87618	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP025983	Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence	100251-100282	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	249371-249402	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	180068-180099	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	238843-238874	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	101502-101533	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	26662-26693	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	45083-45114	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	316182-316213	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054622	Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence	207199-207230	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054751	Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence	26661-26692	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054781	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence	26659-26690	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	45089-45120	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	80933-80964	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	45085-45116	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	38139-38170	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054763	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence	26664-26695	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	118060-118091	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	140100-140131	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	175811-175842	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	99186-99217	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	163007-163038	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP039651	Azospirillum sp. TSA2s plasmid p1	182659-182690	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054745	Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence	26661-26692	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054727	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence	26661-26692	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054739	Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence	26662-26693	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054775	Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence	26661-26692	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054733	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence	26660-26691	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054721	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence	26661-26692	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054757	Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence	26660-26691	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054769	Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence	26662-26693	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP022533	Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence	836-867	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	171040-171071	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	274373-274404	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	51260-51291	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052317	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052259	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence	104687-104718	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054064	Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence	43079-43110	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	190964-190995	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	50084-50115	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	95631-95662	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	114303-114334	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP042489	Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence	98051-98082	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	CP052495	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence	45082-45113	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MK715436	Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence	179398-179429	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	228734-228765	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MN058044	Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence	139635-139666	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	72402-72433	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	104710-104741	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	46412-46443	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MF398271	Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence	45079-45110	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	100252-100283	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	152950-152981	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	71844-71875	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	92729-92760	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	99963-99994	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	66288-66319	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	100538-100569	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_MF788071	Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence	100416-100447	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MT090958	Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence	39439-39470	7	0.781
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040534	Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence	31824-31855	7	0.781
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	43103-43134	7	0.781
CP029355_1	1.4\|31574\|33\|CP029355\|CRISPRCasFinder	31574-31606	33	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	316182-316214	7	0.788
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	43102-43134	7	0.788
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MH509442	Mycobacterium phage Aminay, complete genome	24246-24277	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	136885-136916	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	201407-201438	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	132963-132994	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MT657339	Gordonia phage SpeedDemon, complete genome	33380-33411	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_031074	Gordonia phage Bantam, complete genome	31531-31562	8	0.75
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	MN304816	Phage 67_12, partial genome	40299-40330	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	MH593833	Siphoviridae sp. isolate ctbb6, complete genome	14638-14669	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	618106-618137	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1276334-1276365	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	197154-197185	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1121490-1121521	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1121436-1121467	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	610078-610109	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	817647-817678	8	0.75
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	KY945355	Mycobacterium phage Shandong1, complete genome	46651-46682	8	0.75
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_CP011667	Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence	161639-161670	8	0.75
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	77168-77199	8	0.75
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_KY000060	Agrobacterium tumefaciens strain CFBP2407 plasmid pTi_CFBP2407, complete sequence	134556-134587	8	0.75
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	MH593833	Siphoviridae sp. isolate ctbb6, complete genome	14638-14670	8	0.758
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1645005-1645036	9	0.719
CP029355_1	1.1\|31575\|32\|CP029355\|PILER-CR,CRT	31575-31606	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	430560-430591	9	0.719
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	583259-583290	9	0.719
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	179405-179436	9	0.719
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	276775-276806	9	0.719
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	185781-185812	9	0.719
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1403036-1403067	9	0.719
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	109136-109167	9	0.719
CP029355_1	1.3\|31697\|32\|CP029355\|PILER-CR,CRT	31697-31728	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	256186-256217	9	0.719
CP029355_1	1.4\|31574\|33\|CP029355\|CRISPRCasFinder	31574-31606	33	MH509442	Mycobacterium phage Aminay, complete genome	24246-24278	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	618106-618138	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1121490-1121522	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1121436-1121468	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	610078-610110	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	817647-817679	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	KY945355	Mycobacterium phage Shandong1, complete genome	46651-46683	9	0.727
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1276333-1276365	9	0.727
CP029355_1	1.6\|31696\|33\|CP029355\|CRISPRCasFinder	31696-31728	33	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	276775-276807	9	0.727
CP029355_1	1.6\|31696\|33\|CP029355\|CRISPRCasFinder	31696-31728	33	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	256186-256218	9	0.727
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	401493-401524	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	416986-417017	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	404298-404329	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	445075-445106	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	401466-401497	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	500113-500144	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	415887-415918	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	416986-417017	10	0.688
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	401466-401497	10	0.688
CP029355_1	1.5\|31635\|33\|CP029355\|CRISPRCasFinder	31635-31667	33	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	583259-583291	10	0.697
CP029355_1	1.2\|31636\|32\|CP029355\|PILER-CR,CRT	31636-31667	32	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	310803-310834	11	0.656

1. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP017760 (Cupriavidus necator strain NH9 plasmid pENH91, complete sequence) position: , mismatch: 5, identity: 0.844

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgacgcgg-	Protospacer
******.**.************ * *****.*

2. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 5, identity: 0.844

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcttggccgctgccgcccgacgcgg-	Protospacer
******.**********.**** * *****.*

3. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_006830 (Achromobacter xylosoxidans A8 plasmid pA81, complete sequence) position: , mismatch: 5, identity: 0.844

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgacgcgg-	Protospacer
******.**.************ * *****.*

4. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_014154 (Thiomonas intermedia K12 plasmid pTINT01, complete sequence) position: , mismatch: 6, identity: 0.812

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcttggccgccgccgcccgccacgg-	Protospacer
******.*************** * * *.*.*

5. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

6. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

7. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

8. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

9. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP011600 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

10. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

11. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

12. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

13. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

14. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

15. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

16. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

17. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

18. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

19. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

20. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

21. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

22. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

23. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

24. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

25. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

26. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

27. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

28. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

29. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

30. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

31. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

32. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

33. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

34. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

35. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

36. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

37. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

38. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

39. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

40. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

41. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

42. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

43. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

44. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

45. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

46. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

47. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

48. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

49. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

50. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP035380 (Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

51. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

52. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

53. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

54. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

55. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

56. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP041374 (Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

57. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

58. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

59. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

60. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

61. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

62. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_AP018757 (Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

63. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

64. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

65. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

66. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

67. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042495 (Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

68. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

69. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

70. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

71. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_AP019666 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

72. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

73. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

74. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

75. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

76. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

77. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

78. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

79. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

80. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

81. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

82. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

83. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

84. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

85. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

86. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

87. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

88. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

89. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

90. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP025983 (Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

91. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

92. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

93. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

94. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

95. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

96. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

97. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

98. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

99. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

100. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
gtcagcaggttggccgccaccgccaccccggc	Protospacer
******** *********.**** . * *.**

101. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054622 (Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
atcagcgccttggccgccgccgcaatctccgc	Protospacer
.*****. ****************. * * **

102. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054751 (Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

103. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054781 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

104. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

105. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

106. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

107. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

108. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

109. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054763 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

110. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

111. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

112. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

113. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

114. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

115. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP039651 (Azospirillum sp. TSA2s plasmid p1) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
atcagcgccttggccgccgccgcaatctccgc	Protospacer
.*****. ****************. * * **

116. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054745 (Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

117. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054727 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

118. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054739 (Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

119. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054775 (Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

120. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054733 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

121. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054721 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

122. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054757 (Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

123. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054769 (Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

124. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP022533 (Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

125. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

126. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

127. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

128. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052317 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

129. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052259 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

130. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054064 (Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

131. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

132. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

133. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

134. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

135. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP042489 (Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

136. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to CP052495 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

137. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MK715436 (Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

138. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

139. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MN058044 (Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

140. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

141. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

142. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

143. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MF398271 (Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

144. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

145. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

146. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

147. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

148. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

149. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

150. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

151. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_MF788071 (Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

152. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MT090958 (Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

153. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040534 (Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence) position: , mismatch: 7, identity: 0.781

gtcagcagcttggccgccgccg-cagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgg-	Protospacer
******.**.************ * * *.*.*

154. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.781

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgctgaactgcgacgacagcacgcggttgcc	Protospacer
 ***.******** ***********  *.*.*

155. spacer 1.4|31574|33|CP029355|CRISPRCasFinder matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
ggtcagcaggttggccgccaccgccaccccggc	Protospacer
********* *********.**** . * *.**

156. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.788

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
ggcgctgaactgcgacgacagcacgcggttgcc	Protospacer
* ***.******** ***********  *.*.*

157. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MH509442 (Mycobacterium phage Aminay, complete genome) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
accgacagcaaggccgccgccgcagacgcccc	Protospacer
..*..****  ******************  *

158. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
gtcagcggcctggccgccgccgcccgccacgc	Protospacer
******.**.*************  .*   **

159. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
gtcaccagcgtggccgccgccgcccaagaggt	Protospacer
**** **** *************  * * .*.

160. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
ttcagccgcttcgccgccgccgcaacggccgt	Protospacer
 ***** **** ************.  ** *.

161. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MT657339 (Gordonia phage SpeedDemon, complete genome) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc-	CRISPR spacer
gtcaccagcttggccgccgcggc-cttgttgct	Protospacer
**** *************** **   .*. **

162. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_031074 (Gordonia phage Bantam, complete genome) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc-	CRISPR spacer
gtcaccagcttggccgccgcggc-tttgttgct	Protospacer
**** *************** **   .*. **

163. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to MN304816 (Phage 67_12, partial genome) position: , mismatch: 8, identity: 0.75

gtcagcagcttggccgccgccgcagacgcagc---	CRISPR spacer
gtcagcaggttggtcgccgccgc---ctcgactag	Protospacer
******** ****.*********   * *..*

164. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to MH593833 (Siphoviridae sp. isolate ctbb6, complete genome) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
ccgccgagctgcgccgccagcacgccgagata	Protospacer
.******.******** *********   .*

165. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

166. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

167. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
ttgccggtctgcgccgacagcacgccggagag	Protospacer
*.****. ******************   *

168. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

169. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

170. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

171. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgaactgcgccgacgacacgcggccgcg	Protospacer
 *****************..*****  .**.

172. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to KY945355 (Mycobacterium phage Shandong1, complete genome) position: , mismatch: 8, identity: 0.75

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
acgccgaaccgcgccgacagctcgcggccgag	Protospacer
 ********.*********** ***  .**

173. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_CP011667 (Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence) position: , mismatch: 8, identity: 0.75

accagcag--gttgatcgccgaagcggtcaccgt	CRISPR spacer
--ctgcgactgttgatcgccgaggaggtcaccgg	Protospacer
  * **..  ************.* ********

174. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 8, identity: 0.75

accagcag--gttgatcgccgaagcggtcaccgt	CRISPR spacer
--ctgcgactgttgatcgccgaggaggtcaccgg	Protospacer
  * **..  ************.* ********

175. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_KY000060 (Agrobacterium tumefaciens strain CFBP2407 plasmid pTi_CFBP2407, complete sequence) position: , mismatch: 8, identity: 0.75

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
accgcatggctaatcgccgaagcggtcacccc	Protospacer
***.   **.*.****************** .

176. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to MH593833 (Siphoviridae sp. isolate ctbb6, complete genome) position: , mismatch: 8, identity: 0.758

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gccgccgagctgcgccgccagcacgccgagata	Protospacer
*.******.******** *********   .*

177. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
gcacccgtctgggccgcggccgcagacgcaga	Protospacer
*.   *. ** ****** *************

178. spacer 1.1|31575|32|CP029355|PILER-CR,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

gtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
gcacccgtctgggccgcggccgcagacgcaga	Protospacer
*.   *. ** ****** *************

179. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 9, identity: 0.719

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gtggtgaacggcgccgacagcacggcctccgt	Protospacer
 .* .**** ************** ****  .

180. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
tgcacgaactgcgccgccagcacgtcccgcgc	Protospacer
*   ************ *******.**.   *

181. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 9, identity: 0.719

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
acctgccggttgatcgccgaagccgcgatgtg	Protospacer
*** ** **************** *. *.

182. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 9, identity: 0.719

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
tcttgtcagttgatcgccggagcgatcaccgg	Protospacer
 *. *. .***********.****.******

183. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 9, identity: 0.719

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
ccccagttattgatcgccgaagctgtctccgt	Protospacer
 ** .   .************** *** ****

184. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 9, identity: 0.719

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
tcttgtcagttgatcgccggagcgatcaccgg	Protospacer
 *. *. .***********.****.******

185. spacer 1.3|31697|32|CP029355|PILER-CR,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 9, identity: 0.719

accagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
acctgccggttgatcgccgaagccgcgatgtg	Protospacer
*** ** **************** *. *.

186. spacer 1.4|31574|33|CP029355|CRISPRCasFinder matches to MH509442 (Mycobacterium phage Aminay, complete genome) position: , mismatch: 9, identity: 0.727

ggtcagcagcttggccgccgccgcagacgcagc	CRISPR spacer
caccgacagcaaggccgccgccgcagacgcccc	Protospacer
 ..*..****  ******************  *

187. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

188. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

189. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

190. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

191. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

192. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to KY945355 (Mycobacterium phage Shandong1, complete genome) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cacgccgaaccgcgccgacagctcgcggccgag	Protospacer
  ********.*********** ***  .**

193. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
cgcgccgaactgcgccgacgacacgcggccgcg	Protospacer
  *****************..*****  .**.

194. spacer 1.6|31696|33|CP029355|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 9, identity: 0.727

gaccagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
gacctgccggttgatcgccgaagccgcgatgtg	Protospacer
**** ** **************** *. *.

195. spacer 1.6|31696|33|CP029355|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 9, identity: 0.727

gaccagcaggttgatcgccgaagcggtcaccgt	CRISPR spacer
gacctgccggttgatcgccgaagccgcgatgtg	Protospacer
**** ** **************** *. *.

196. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

197. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

198. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

199. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

200. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgagcggtgt	Protospacer
 ******.* **************  *    .

201. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

202. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgagcggtgt	Protospacer
 ******.* **************  *    .

203. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgatcggtgt	Protospacer
 ******.* ************** .*    .

204. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.688

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
gcgccgagcggcgccgacagcacgagcggtgt	Protospacer
 ******.* **************  *    .

205. spacer 1.5|31635|33|CP029355|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 10, identity: 0.697

gtcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
tgtggtgaacggcgccgacagcacggcctccgt	Protospacer
  .* .**** ************** ****  .

206. spacer 1.2|31636|32|CP029355|PILER-CR,CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 11, identity: 0.656

tcgccgaactgcgccgacagcacgccctcgtc	CRISPR spacer
aaaccgaactgccccgacggcacgccgggcca	Protospacer
  .********* *****.*******    .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. CP029354

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029354_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029354_2

604576-604646

Orphan

Consensus_repeat	Method
CCTTCCAGCCGACCACCGGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP029354_2

>merge|CP029354|2|604576-604646|CRISPRCasFinder
CCTTCCAGCCGACCACCGGCACCTATGCGCCGCAGCGTGGCGGCGGCACCTTCCAGCCCACCACCGGCACC

>CP029354|2|1|604576-604646|CRISPRCasFinder
CCTTCCAGCCGACCACCGGCACC	TATGCGCCGCAGCGTGGCGGCGGCA
CCTTCCAGCCCACCACCGGCACC

Protein	Signature genes	Signature genes Name	Protein_function
CP029354.1\|AWK88509.1\|592393_593101_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182242
CP029354.1\|AWK88508.1\|590750_592277_-\|bifunctional-metallophosphatase/5'-nucleotidase	unknown	unknown	gnl\|CDD\|236505
CP029354.1\|AWK88515.1\|597371_599885_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|236643
CP029354.1\|AWK88513.1\|596134_596596_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197670
CP029354.1\|AWK88510.1\|593207_593801_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182242
CP029354.1\|AWK88516.1\|599918_600929_-\|fecR-protein	unknown	unknown	gnl\|CDD\|226235
CP029354.1\|AWK88517.1\|601212_602868_+\|cyclic-peptide-transporter	unknown	unknown	gnl\|CDD\|130262
CP029354.1\|AWK88514.1\|596683_597217_-\|RNA-polymerase-factor-sigma-70	unknown	unknown	gnl\|CDD\|180803
CP029354.1\|AWK88512.1\|595168_595600_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371165
CP029354.1\|AWK88511.1\|593965_595054_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367655

Protein	Function_ID	Function_description	E-value
CP029354.1\|AWK88509.1\|592393_593101_-\|hypothetical-protein	gnl\|CDD\|182242	PRK10101, csgB, curlin minor subunit CsgB; Provisional.	2.69235e-08
CP029354.1\|AWK88508.1\|590750_592277_-\|bifunctional-metallophosphatase/5'-nucleotidase	gnl\|CDD\|236505	PRK09419, PRK09419, multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.	1.98645e-46
CP029354.1\|AWK88515.1\|597371_599885_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|236643	PRK10044, PRK10044, ferrichrome outer membrane transporter; Provisional.	1.12526e-146
CP029354.1\|AWK88513.1\|596134_596596_+\|hypothetical-protein	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.34528e-11
CP029354.1\|AWK88510.1\|593207_593801_-\|hypothetical-protein	gnl\|CDD\|182242	PRK10101, csgB, curlin minor subunit CsgB; Provisional.	5.56598e-09
CP029354.1\|AWK88516.1\|599918_600929_-\|fecR-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	1.54548e-66
CP029354.1\|AWK88517.1\|601212_602868_+\|cyclic-peptide-transporter	gnl\|CDD\|130262	TIGR01194, ATP-binding_protein_SyrD, cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake. [Transport and binding proteins, Amino acids, peptides and amines, Transport and binding proteins, Other].	0
CP029354.1\|AWK88514.1\|596683_597217_-\|RNA-polymerase-factor-sigma-70	gnl\|CDD\|180803	PRK07037, PRK07037, extracytoplasmic-function sigma-70 factor; Validated.	5.0751e-66
CP029354.1\|AWK88512.1\|595168_595600_-\|hypothetical-protein	gnl\|CDD\|371165	pfam10614, CsgF, Type VIII secretion system (T8SS), CsgF protein. The extracellular nucleation-precipitation (ENP) pathway or Type VIII secretion system (T8SS) in Gram-negative (diderm) bacteria is responsible for the secretion and assembly of prepilins for fimbiae biogenesis, the prototypical curli. Besides the T2SS that can be involved in the assembly of prototypical Type 4 pilus, the T4SS that can be involved in the biogenesis of the prototypical pilus T, the T3SS involved in the assembly of the injectisome and the T7SS involved in the formation of the prototypical Type 1 pilus, the T8SS differs in that fibre-growth occurs extracellularly. The curli, also called thin aggregative fimbriae (Tafi), are the only fimbriae dependent on the T8SS. Tafi were first identified in Salmonella spp and the controlling operon termed agf; however subsequent isolation of the homologous operon in E coli led to its being called csg. In the absence of extracellular polysaccharides Tafi appear curled, although when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery.	5.06531e-29
CP029354.1\|AWK88511.1\|593965_595054_-\|hypothetical-protein	gnl\|CDD\|367655	pfam03783, CsgG, Curli production assembly/transport component CsgG. CsgG is an outer membrane-located lipoprotein that is highly resistant to protease digestion. During curli assembly, an adhesive surface fibre, CsgG is required to maintain the stability of CsgA and CsgB.	7.90798e-63

>CP029354.1|AWK88517.1|601212_602868_+|cyclic-peptide-transporter
MPTPSRTSLAALLRLLRPFWPLLAAATLLGVLGGLSVTGLLAAINHILRAGEGPGAGILLAFAGLCVLALAGSVLSDIATNRIGQKVVARLRKDLGDRILTAPIDQLEHYRSHRLIPVLTHDVDTISDFAFAFAPLAVSLSVTLGSLCYLAVLSWPMFLATAAAILIGSAVQYAARVRGIEGFQEARAYEDELQKHYRSLAEGAKELRINRPRRLRLQSEALRGTIDRICDIQIRSINLFVVAKGFGSTLFFIVIGVALGVEALWPSTDRGTLSGFILVLLYMKGPLEHLIGTLPIVSRAQVAFRRIAELAAEFASPEPHLLMKDGARPPATIDSLELRNARYVYPPAGPDAEPFALGPVSLRVGRGEILFIVGENGCGKTTLIKMLLGLYPPHEGQILLDGKPVTPETRDDYRQLFTTIFADYFLFDDLIQAGDGVPEDARPYLERLEIAHKVRVVDGVFSTTDLSTGQRKRLALLQAWTERRPVLVFDEWAADQDPTFRRIFYTELLPGLKAMGKTIIVISHDDRYFHVADHLLRLAAGRVAEDRQPAA
>CP029354.1|AWK88516.1|599918_600929_-|fecR-protein
MPPSHPPDDDRVAEQAADWCLRLQAADIGDADRAAFERWCREDPRHQAEFDAMREIWGLSAGLPPRATAVPAAAPAAPPAVPPAVTAQPAIVRARPRRRWAMAACIAAAVAACWPVGWSAGLLPGRVDVFLGGGRHRMVELPDGSRVDLNVRTTLFYAQFRDRRSVLMDHGEAFFAVAHDAGRPFTVFTAGHRIRVTGTVFNVWANDGELAVTLAEGSVTVTSAAAGGEPLRLTPGMQGRFARDSRFGSVARVDPLRVLSWREGKLVFDNITLAEAVPLLNPYLSQPLRLADRKVGAMRIGGVYDVADLDRVAASLPRVLPVTLVAKDGELLLSAR
>CP029354.1|AWK88515.1|597371_599885_+|TonB-dependent-siderophore-receptor
MTDRPATFRPATRGHRAGRTARARLAVGWLALGWPLLAWPLLAWPSSALPFPGDPAPAPSGPVQPAAQAVLLEIPALPLREALTSFGRQTGLQILYSPDLVPDRRSRALSGRMDPAAALSDLLSGTDLAFEMRDGMVTIGRLRESPGFLPGLTVEGRPPPAGPAAVPPDRGRGTGRSGRPAEDPPQGLSTVTREELDQRDVQDINGALAYSAGVRPIDYPGGQGAIDVFIRGFRQSSESVMIDGLRSGYNPYGLEYEPFGVERVEVLKGPSSAVYGAMPPGGAIALTSKRPTDGPLHRLQLQGGSHDRRQVTADLSDRIDADGSLRYRLTALSRRSGTQIDRTPDDRLYIAPALSWAAGERTEITLLASLLDFRKMGAEQSFPASGTVLDNPHGRLESSLFLGYPGLSSYRSRSLSAGYDLRHALTADWTLRQTLRYSHSRVGYLSNWAPSGLLEADRRYRFGLQDRPKTSATLLVDTALQGAATTGPLHHSLLAGIGHGRHRAHETRRNGTVANAIDVFDPVYGGPYAWDATPARDLTDRIRQTGLYAQDEIAFGGWRLTLGGRLDWSRTGTAGRLSDGPPVETTRFDRAFTKRIGLTYRFDGGLSPYAGHSTSFQPNGDSDVQGRPFLPSRGTQMEAGLRYRPEGFDGLFTLSLFRAVQRNLTAADPDNPGHSVQTGQIRSRGVELEARTALSDTADLTAAYGYAEARVTRDTAYPGGTDKTGKRVASVPRHAAAVWLRQHFREGPADGLTAGIGMRYVGATYNAANSVRVPSYMLVDVSLGYDLGRLSPQLDGVGLSLSATNLFDRRYFSPGFYENSVFFGNRRAVLATLSYGW
>CP029354.1|AWK88514.1|596683_597217_-|RNA-polymerase-factor-sigma-70
MRQAGPADSQTLSDIFTAQRRSLVGMAERITGCRHHAEDVVQDAFLKLLGADSTSAIRAKAGYLMMVVRNLAIDHYRRKGLESRLLAAEEEGQAVSTPEAASPESVNVNRQLLQTLESALADLPERTRYAFEMHRIHGHSQKDIAATLGVSPTLVNYMIRDALVHCRKAMRRIDPSS
>CP029354.1|AWK88513.1|596134_596596_+|hypothetical-protein
MLDGQKGCTMLGLPGRPSVPTAGPADPLAGSPDLTLVIAELCKAQEHLDRVQGVVITALVRCGVLDLTPRQLAILYLLSLQDQQPSKLSKVLFHRDKQIAHHVKQLLARGLVEEYRHSVDRRAKLLHLTPRGLELLRRLGIAEGAARTDGGAA
>CP029354.1|AWK88512.1|595168_595600_-|hypothetical-protein
MRKSAIILALGALGFAALVGPAAGPACAGELRYRPINPSFGGDPFNSSHLLGIANAINKFEDPKSSASATTLDATDSFANTIQASVLSRVASQIADQIYGEHAKTSGTAVVGGTTLQWAQVNGQIKLTLNNGKSTQIIELPAY
>CP029354.1|AWK88511.1|593965_595054_-|hypothetical-protein
MARATQPSGFAVVLALGALSLAGCASARPEMAFSEQPLNEQKTQSLDSLLTLPPPTRQLTVAVYAFTDQTGQNKPNDNFSEYSRAVTQGGNSVLINALKRTGDRSWFRVAERSSLAQLLQERQIIRQTRQAYGGDNLPPLPPLLYAGLLIDGGIIGYDSNTLTGGFGARFLGVGGDVKYRRDTVTVYIRAVSVQTGEVLKSVNASKTIYSAAIGGSAFRYIGFKDLLEIETGVTTNEPATLAVKQAVEKAVYNLVLDGVLDGYWSFQDTAKGEKILQRYLQDRDGFYNVAVVRDAQAGQPPMAPPMAPPVAVPPPAGQTPSASAPDEQKIAPLPQEQKQETGPVYVLPGDRARSPIPPATPR
>CP029354.1|AWK88510.1|593207_593801_-|hypothetical-protein
MKRILLSSIAALATLAAGAALADPVGTKPVPMNGGNAAYIDQIGALNSNSQTQYGRANLSDNWQKGDHNTAVAYQDGTMNRAFANQNGARNYANQVQDGVDNVARIDQSDAGNTAHQKQFGLANDATIVQSGFDGPFGWGVAPAGNFASQYQDGALNQAAVAQKGMLNTAYQTQMSSGNVATANQTGVSNYSTQFQR
>CP029354.1|AWK88509.1|592393_593101_-|hypothetical-protein
MTKPIRMAGGVAGAMAGLALLAPGLTAPSPAQAGGSPAYIDQMADRLPASAGTNWADVGQYGTSNRARQVQIGENSAAILQIGAGNLTDQYQSGSANRARAQQSGAGNVITLVQDGSGHDAAGRQDGYENRIRQIQYGIANRAIAVQDGSSNSAIQLQDGSDNLSAVAQTGRGNSARTAQYGTRNATTVEQSGGDGIEVVQRGANNSVESQQTILQNGVRITQTGAGAAIKVATR
>CP029354.1|AWK88508.1|590750_592277_-|bifunctional-metallophosphatase/5'-nucleotidase
MRNRRDTQPGGVMRRLARTGSSIAAVLVMIVASIASPAAATELSLVFTSTMADIEPVENEGGLVNLATFLRARRGEGPTLFLHGGASLAAGVLSSFDKGAHMIDLLNDLQPDMMAVTKRDLAFGTDELTLRGYEARFPLLSANAIDRRTGKVLEGLEPSLLIDTVVGRIGVVAVTSPELTVQYIVPDIQVLPPSDAAAVARSLRGKGAEFVVAVVDNTPEVIEELRREPAIDLLVQLAASGKDSLEVADGRGFGVHSNVKGTAFLMRLEREGAGRPVLARGEIVKLAGVPADPEMTTRVDVYRKRLSDLLDIKVGVTATPLDTRREAVRSGENAFASFIADTMRMVLGTDVALFNGGNIRGNRQYAPDTVLTRRDIQRELPFRDIITRTRLKGGALREALEVSAAGVETLKGGFLHVSNMEVVYDLKQPAGSRVVSVKVGGKPLDPEAEYSVGLPSYLAQGGDGYAMLKRSGPPSPAENAKLLWEIMAQRLGDLGTIAPRLDGRITMR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	217028-217052	3	0.88
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	25240-25264	3	0.88
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	27963-27987	3	0.88
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_HG917973	Mycobacterium marinum E11 plasmid pRAW, complete sequence	51167-51191	3	0.88
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_AP018497	Mycobacterium marinum strain ATCC 927 plasmid pMMRN, complete sequence	125600-125624	3	0.88
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	693366-693390	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP012965	Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence	105514-105538	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	1786-1810	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	31329-31353	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	16147-16171	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	1785-1809	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	718896-718920	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	693413-693437	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	43367-43391	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	349101-349125	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	556402-556426	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	693217-693241	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	693195-693219	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1219360-1219384	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1814433-1814457	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	370639-370663	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	89928-89952	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	111398-111422	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	358047-358071	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_LR594692	Variovorax sp. WDL1 plasmid 4	136607-136631	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	348045-348069	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2630320-2630344	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	388705-388729	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	345131-345155	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1495080-1495104	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	364593-364617	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	351377-351401	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	359552-359576	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	358047-358071	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	256430-256454	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	364593-364617	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	345131-345155	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1065756-1065780	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	344708-344732	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1480635-1480659	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	75212-75236	4	0.84
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	82722-82746	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	97047-97071	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	82659-82683	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	149119-149143	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	387225-387249	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_012855	Ralstonia pickettii 12D plasmid pRp12D01, complete sequence	344846-344870	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	9030-9054	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	119757-119781	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	30498-30522	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_010333	Caulobacter sp. K31 plasmid pCAUL02, complete sequence	3353-3377	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	825059-825083	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	108491-108515	5	0.8
CP029354_2	2.1\|604599\|25\|CP029354\|CRISPRCasFinder	604599-604623	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1084452-1084476	5	0.8

1. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 3, identity: 0.88

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgcggcagcgtagcggcggca	Protospacer
.****** *******.*********

2. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 3, identity: 0.88

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgcggcagcgtagcggcggca	Protospacer
.****** *******.*********

3. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 3, identity: 0.88

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgcggcagcgtagcggcggca	Protospacer
.****** *******.*********

4. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_HG917973 (Mycobacterium marinum E11 plasmid pRAW, complete sequence) position: , mismatch: 3, identity: 0.88

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tgtgcgccgcggcgaggcggcggca	Protospacer
*.********.*** **********

5. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_AP018497 (Mycobacterium marinum strain ATCC 927 plasmid pMMRN, complete sequence) position: , mismatch: 3, identity: 0.88

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tgtgcgccgcggcgaggcggcggca	Protospacer
*.********.*** **********

6. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

7. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP012965 (Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

8. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

9. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

10. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

11. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

12. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
cctgcgccgcagcgtgccggcggga	Protospacer
. ************** ****** *

13. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

14. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

15. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

16. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

17. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

18. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

19. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
cctgcgccgcagcgtgccggcggga	Protospacer
. ************** ****** *

20. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

21. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
cctgcgccgcagcgtgccggcggga	Protospacer
. ************** ****** *

22. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

23. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

24. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

25. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_LR594692 (Variovorax sp. WDL1 plasmid 4) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccacagcgcggcggcggcc	Protospacer
.*******.*****.*********

26. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

27. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcggcgtgccggcggcg	Protospacer
.*********.***** *******.

28. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

29. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

30. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

31. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

32. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

33. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

34. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

35. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gaggcgccgcagcgcggcggcggcc	Protospacer
 * ***********.*********

36. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

37. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

38. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
aatgcgtcgcagcgtggcggcgccg	Protospacer
 *****.*************** *.

39. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tggtcgccgctgcgtggcggcggca	Protospacer
*.  ****** **************

40. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgtgccgcagcgcggcggcggcg	Protospacer
.***.*********.*********.

41. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 4, identity: 0.84

tatgcgccgcagcgtggcggcggca	CRISPR spacer
catgcgccgcagcgtggtggcgccc	Protospacer
.****************.**** *

42. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

43. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

44. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

45. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

46. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
ggtgcgccgcggcgtggcggcggac	Protospacer
 .********.************

47. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_012855 (Ralstonia pickettii 12D plasmid pRp12D01, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
aatgcgccgcagcttggcggcgcgc	Protospacer
 ************ ********

48. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

49. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
actcagccgcagcgtggcggcggcc	Protospacer
  *  *******************

50. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

51. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_010333 (Caulobacter sp. K31 plasmid pCAUL02, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
cttgcgctgcagcgtggcggcggtg	Protospacer
. *****.***************..

52. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gtctcggcgcagcgtggcggcggca	Protospacer
  . ** ******************

53. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
gccgcgccgcggcgtggcggcggcc	Protospacer
  .*******.*************

54. spacer 2.1|604599|25|CP029354|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

tatgcgccgcagcgtggcggcggca	CRISPR spacer
tccctgccgcagcgtggcggcggcg	Protospacer
* . .*******************.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage