CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029350	Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence	0 crisprs	csa3	0	0	0	0
CP029349	Lactobacillus plantarum strain HAC01 chromosome, complete genome	1 crisprs	DinG,DEDDh,cas3,csa3,csn2,cas2,cas1,cas9,WYL,RT	1	13	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029349_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029349_4

1684960-1685655

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

10 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of CP029349_4

>merge|CP029349|4|1684960-1685655|CRT,PILER-CR,CRISPRCasFinder
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTGTCTTGTTCCTTGTTGTACTCCATACCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGGGAGTGATAGACGTTGAGCGACACTGTACGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGGACGCTCGCAAACAACGCTGCACTCAATAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAACTTGTTGGTGCCCCAGAAGAGTCATCAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAATCGGCGTGGTGAAGATTTCGCCGACGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACATCGACACGGTAAGACCGTTAACGGTGTTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGCCAATGAATGACTACGCTAAAGACGTTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACATCAATAACTGGGCGTCAGCATTAATTCGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAACTGAGGCAACCCCAGCAGGAGTCTGTTGGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>CP029349|4|2|1684960-1685655|CRT
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGGAGTGATAGACGTTGAGCGACACTGTAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGACGCTCGCAAACAACGCTGCACTCAATA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTTGTTGGTGCCCCAGAAGAGTCATCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCGACACGGTAAGACCGTTAACGGTGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCAATAACTGGGCGTCAGCATTAATTCGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTGAGGCAACCCCAGCAGGAGTCTGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>CP029349|4|1|1685026-1685655|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGGAGTGATAGACGTTGAGCGACACTGTAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGACGCTCGCAAACAACGCTGCACTCAATA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTTGTTGGTGCCCCAGAAGAGTCATCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCGACACGGTAAGACCGTTAACGGTGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCAATAACTGGGCGTCAGCATTAATTCGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTGAGGCAACCCCAGCAGGAGTCTGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>CP029349|4|3|1685026-1685655|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGGAGTGATAGACGTTGAGCGACACTGTAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGACGCTCGCAAACAACGCTGCACTCAATA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTTGTTGGTGCCCCAGAAGAGTCATCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCGACACGGTAAGACCGTTAACGGTGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ATCAATAACTGGGCGTCAGCATTAATTCGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AACTGAGGCAACCCCAGCAGGAGTCTGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP029349.1\|AWL16094.1\|1692908_1693616_-\|hypothetical-protein	unknown	unknown	unknown
CP029349.1\|AWL16093.1\|1692101_1692884_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP029349.1\|AWL16088.1\|1682156_1684895_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
CP029349.1\|AWL16082.1\|1678511_1678967_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
CP029349.1\|AWL16096.1\|1695330_1695801_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240033
CP029349.1\|AWL16087.1\|1681113_1681872_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
CP029349.1\|AWL16085.1\|1680208_1680811_+\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
CP029349.1\|AWL16081.1\|1678008_1678515_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
CP029349.1\|AWL16079.1\|1676219_1676585_-\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP029349.1\|AWL16098.1\|1697752_1698493_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
CP029349.1\|AWL16080.1\|1676609_1677842_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
CP029349.1\|AWL16092.1\|1687736_1691813_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
CP029349.1\|AWL16097.1\|1695916_1697509_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
CP029349.1\|AWL16091.1\|1686636_1687542_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
CP029349.1\|AWL16089.1\|1685679_1686357_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
CP029349.1\|AWL16083.1\|1679054_1679477_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
CP029349.1\|AWL16084.1\|1679622_1680096_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP029349.1\|AWL16090.1\|1686353_1686659_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
CP029349.1\|AWL16095.1\|1693733_1695098_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
CP029349.1\|AWL16086.1\|1680876_1681071_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200

Protein	Function_ID	Function_description	E-value
CP029349.1\|AWL16093.1\|1692101_1692884_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.18043e-25
CP029349.1\|AWL16088.1\|1682156_1684895_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP029349.1\|AWL16082.1\|1678511_1678967_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.50722e-25
CP029349.1\|AWL16096.1\|1695330_1695801_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
CP029349.1\|AWL16087.1\|1681113_1681872_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.05874e-91
CP029349.1\|AWL16085.1\|1680208_1680811_+\|NADPH-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.68426e-30
CP029349.1\|AWL16081.1\|1678008_1678515_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	2.71307e-18
CP029349.1\|AWL16079.1\|1676219_1676585_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	7.3086e-14
CP029349.1\|AWL16098.1\|1697752_1698493_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
CP029349.1\|AWL16080.1\|1676609_1677842_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
CP029349.1\|AWL16092.1\|1687736_1691813_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.66373e-128
CP029349.1\|AWL16097.1\|1695916_1697509_-\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.86772e-17
CP029349.1\|AWL16091.1\|1686636_1687542_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89
CP029349.1\|AWL16089.1\|1685679_1686357_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.34637e-80
CP029349.1\|AWL16083.1\|1679054_1679477_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
CP029349.1\|AWL16084.1\|1679622_1680096_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
CP029349.1\|AWL16090.1\|1686353_1686659_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
CP029349.1\|AWL16095.1\|1693733_1695098_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
CP029349.1\|AWL16086.1\|1680876_1681071_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17

>CP029349.1|AWL16088.1|1682156_1684895_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYTTDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>CP029349.1|AWL16087.1|1681113_1681872_-|purine-nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>CP029349.1|AWL16086.1|1680876_1681071_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>CP029349.1|AWL16085.1|1680208_1680811_+|NADPH-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPESPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>CP029349.1|AWL16084.1|1679622_1680096_-|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>CP029349.1|AWL16083.1|1679054_1679477_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>CP029349.1|AWL16082.1|1678511_1678967_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>CP029349.1|AWL16081.1|1678008_1678515_+|LytTR-family-transcriptional-regulator
MSSRIFTTISLSKSLFKGESTRHVQLTISETIHQVFVTIHGPQLTPAIKELQRNIEALTNQQFINVFQDRSLIKLPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>CP029349.1|AWL16080.1|1676609_1677842_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>CP029349.1|AWL16079.1|1676219_1676585_-|ArsR-family-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL
>CP029349.1|AWL16089.1|1685679_1686357_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGVHFPTELMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>CP029349.1|AWL16090.1|1686353_1686659_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>CP029349.1|AWL16091.1|1686636_1687542_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>CP029349.1|AWL16092.1|1687736_1691813_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>CP029349.1|AWL16093.1|1692101_1692884_-|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>CP029349.1|AWL16094.1|1692908_1693616_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDLTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>CP029349.1|AWL16095.1|1693733_1695098_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>CP029349.1|AWL16096.1|1695330_1695801_+|NUDIX-domain-containing-protein
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>CP029349.1|AWL16097.1|1695916_1697509_-|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVVISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>CP029349.1|AWL16098.1|1697752_1698493_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	CP029349.1	676628-676655	1	0.964

1. spacer 3.3|672662|28|CP029349|CRT matches to position: 676628-676655, mismatch: 1, identity: 0.964

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgaatcactgtcgctatccgaatcactg	Protospacer
******.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029349_4	4.4\|1685194\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685194-1685223	30	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	51476-51505	0	1.0
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157507-157534	1	0.964
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2662-2689	1	0.964
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154549-154576	1	0.964
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154819-154846	1	0.964
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16439-16472	1	0.971
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17117-17150	1	0.971
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151630-151657	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151684-151711	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153319-153346	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156403-156430	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157183-157210	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157345-157372	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155719-155746	2	0.929
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155785-155812	2	0.929
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152032-152059	2	0.929
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1336-1363	2	0.929
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15592-15619	2	0.929
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15718-15745	2	0.929
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3178-3205	2	0.929
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16061-16094	2	0.941
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16193-16226	2	0.941
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16325-16358	2	0.941
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17351-17384	2	0.941
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18665-18698	2	0.941
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19769-19802	2	0.941
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156331-156358	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156529-156556	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1552-1579	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3052-3079	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3178-3205	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1318-1345	2	0.929
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2092-2119	2	0.929
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156367-156394	2	0.929
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1336-1363	2	0.929
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1606-1633	2	0.929
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3538-3565	2	0.929
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2602-2629	2	0.929
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151870-151897	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153247-153274	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153625-153652	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153727-153754	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153847-153874	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153979-154006	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154105-154132	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154141-154168	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154513-154540	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154729-154756	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154927-154954	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155125-155152	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155359-155386	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155479-155506	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156019-156046	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156121-156148	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156259-156286	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156421-156448	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156439-156466	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156475-156502	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156493-156520	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156511-156538	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156529-156556	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156595-156622	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157165-157192	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157273-157300	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157633-157660	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1552-1579	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1606-1633	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1822-1849	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1858-1885	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1966-1993	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2776-2803	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3088-3115	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3178-3205	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3232-3259	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3286-3313	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3388-3415	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3538-3565	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3700-3727	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21025-21052	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9547-9574	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	994-1021	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1120-1147	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15628-15655	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151810-151837	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154087-154114	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154123-154150	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154495-154522	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16202	3	0.893
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16334	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3250-3277	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153943-153970	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154051-154078	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155911-155938	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157309-157336	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157597-157624	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15484-15511	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21097-21124	3	0.893
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9655-9682	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1552-1579	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3052-3079	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153073-153100	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156331-156358	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157309-157336	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157597-157624	3	0.893
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1156-1183	3	0.893
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16208	3	0.912
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16340	3	0.912
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151540-151567	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151576-151603	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151852-151879	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151888-151915	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151978-152005	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153019-153046	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153073-153100	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153145-153172	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153181-153208	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153337-153364	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153799-153826	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153943-153970	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154051-154078	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154315-154342	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154675-154702	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154747-154774	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154891-154918	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154945-154972	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155089-155116	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155143-155170	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155323-155350	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155377-155404	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155497-155524	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155857-155884	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155911-155938	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156073-156100	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156277-156304	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156349-156376	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156613-156640	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156667-156694	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156799-156826	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156967-156994	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157201-157228	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157309-157336	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157363-157390	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157435-157462	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157597-157624	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1030-1057	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1264-1291	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1624-1651	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1876-1903	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2176-2203	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2284-2311	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3106-3133	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3142-3169	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3478-3505	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3556-3583	3	0.893
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1156-1183	3	0.893
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16202	3	0.893
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16334	3	0.893
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152014-152041	3	0.893
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153589-153616	3	0.893
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155893-155920	3	0.893
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2920-2947	3	0.893
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3718-3745	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1762-1789	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1876-1903	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2092-2119	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2248-2275	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2416-2443	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3088-3115	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3160-3187	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3478-3505	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151756-151783	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151774-151801	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153145-153172	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154423-154450	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157579-157606	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151287-151314	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21025-21052	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15412-15439	3	0.893
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9547-9574	3	0.893
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15412-15439	4	0.857
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15502-15529	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16184	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16316	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16448	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16574	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17126	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17252	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18056	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18566	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-18998	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19538	4	0.857
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19778	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	55-82	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1228-1255	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1426-1453	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1570-1597	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1822-1849	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1966-1993	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2110-2137	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2644-2671	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2716-2743	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2866-2893	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2920-2947	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3178-3205	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3196-3223	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3304-3331	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3424-3451	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3460-3487	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3718-3745	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152014-152041	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153037-153064	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153265-153292	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153535-153562	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153589-153616	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153745-153772	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153997-154024	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154693-154720	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154711-154738	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154765-154792	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154909-154936	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155107-155134	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155161-155188	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155215-155242	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155341-155368	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155395-155422	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155893-155920	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156037-156064	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156193-156220	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156367-156394	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156385-156412	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156727-156754	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156877-156904	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157273-157300	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	19-46	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	958-985	4	0.857
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	994-1021	4	0.857
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156529-156556	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16184	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16316	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16448	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16574	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17126	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17252	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18056	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18566	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-18998	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19538	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19778	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16061-16088	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16193-16220	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16325-16352	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16439-16466	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17117-17144	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17351-17378	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18665-18692	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19769-19796	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154549-154576	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154819-154846	4	0.857
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155785-155812	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	19-46	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1012-1039	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1048-1075	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1066-1093	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1138-1165	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1246-1273	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1282-1309	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1480-1507	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1552-1579	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1840-1867	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1948-1975	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2056-2083	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2266-2293	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2380-2407	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2452-2479	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2662-2689	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2680-2707	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3016-3043	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3034-3061	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3352-3379	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3388-3415	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3616-3643	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3634-3661	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3700-3727	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151738-151765	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151792-151819	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151960-151987	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153019-153046	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153247-153274	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153625-153652	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153727-153754	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153979-154006	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154231-154258	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154249-154276	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154405-154432	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154513-154540	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154603-154630	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154639-154666	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154657-154684	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154837-154864	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154873-154900	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155035-155062	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155071-155098	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155269-155296	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155305-155332	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155479-155506	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155587-155614	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155623-155650	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155659-155686	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155803-155830	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156259-156286	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156313-156340	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156475-156502	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156493-156520	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156511-156538	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156529-156556	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156547-156574	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156565-156592	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157021-157048	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157129-157156	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157183-157210	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157507-157534	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157543-157570	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157561-157588	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157633-157660	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	976-1003	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1012-1039	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1102-1129	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1120-1147	4	0.857
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1138-1165	4	0.857
CP029349_3	3.24\|674222\|28\|CP029349\|CRT	674222-674249	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153055-153082	4	0.857
CP029349_4	4.6\|1685326\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685326-1685355	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	284024-284053	4	0.867
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3574-3601	5	0.821
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16457-16484	5	0.821
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17135-17162	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16760	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17447-17474	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17528	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17594	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17756	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18110	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18254	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18518	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18611-18638	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18761-18788	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18842	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19238	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19592	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19736	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19916	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19961-19988	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20102	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP020865	Paenibacillus sp. Cedars plasmid unnamed2, complete sequence	27006-27033	5	0.821
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP020864	Paenibacillus sp. Cedars plasmid unnamed1, complete sequence	222016-222043	5	0.821
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1156-1183	5	0.821
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2302-2329	5	0.821
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157726-157753	5	0.821
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1192-1219	5	0.821
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16766	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17534	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17600	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17762	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18116	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18260	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18524	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18848	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19244	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19598	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19742	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19922	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20108	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16583-16616	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16895-16928	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18065-18098	5	0.853
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19547-19580	5	0.853
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153217-153244	5	0.821
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153697-153724	5	0.821
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1192-1219	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16760	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17447-17474	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17528	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17594	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17756	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18110	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18254	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18518	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18611-18638	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18761-18788	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18842	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19238	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19592	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19736	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19916	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19961-19988	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20102	5	0.821
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP013569	Rhizobium phaseoli strain N771 plasmid pRphaN771a, complete sequence	26937-26964	5	0.821
CP029349_3	3.19\|673910\|28\|CP029349\|CRT	673910-673937	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151816-151843	5	0.821
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2626-2653	6	0.786
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1642-1669	6	0.786
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2302-2329	6	0.786
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887820-2887847	6	0.786
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	107433-107460	6	0.786
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155695-155722	6	0.786
CP029349_3	3.3\|672662\|28\|CP029349\|CRT	672662-672689	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19637-19664	6	0.786
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2140-2167	6	0.786
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1192-1219	6	0.786
CP029349_3	3.4\|672716\|28\|CP029349\|CRT	672716-672743	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3496-3523	6	0.786
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16190	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16322	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16454	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16835-16868	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17132	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17261-17294	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18572	6	0.824
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19784	6	0.824
CP029349_3	3.17\|673802\|28\|CP029349\|CRT	673802-673829	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153919-153946	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19637-19664	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16817-16844	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17279-17306	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17333-17360	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17651-17678	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18413-18440	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19133-19160	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19811-19838	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19859-19886	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20015-20042	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20099-20126	6	0.786
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151810-151837	6	0.786
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153919-153946	6	0.786
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156853-156880	6	0.786
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16457-16484	6	0.786
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17135-17162	6	0.786
CP029349_4	4.6\|1685326\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685326-1685355	30	AB981169	Ralstonia phage RSY1 DNA, complete genome	19536-19565	6	0.8
CP029349_4	4.6\|1685326\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685326-1685355	30	NC_049432	Ralstonia phage RsoM1USA, complete genome	13669-13698	6	0.8
CP029349_4	4.6\|1685326\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685326-1685355	30	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1133280-1133309	6	0.8
CP029349_3	3.2\|672608\|28\|CP029349\|CRT	672608-672635	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	625163-625190	7	0.75
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	NZ_CP013927	Alteromonas stellipolaris strain LMG 21861 plasmid pASTE61-200, complete sequence	139623-139650	7	0.75
CP029349_3	3.13\|673550\|28\|CP029349\|CRT	673550-673577	28	NC_019750	Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.03, complete sequence	21342-21369	7	0.75
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16580	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17258	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18062	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-19004	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19544	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18611-18644	7	0.794
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20057-20090	7	0.794
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18155-18182	7	0.75
CP029349_3	3.18\|673856\|28\|CP029349\|CRT	673856-673883	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18647-18674	7	0.75
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2734-2761	7	0.75
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2938-2965	7	0.75
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18509-18536	7	0.75
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	256624-256651	7	0.75
CP029349_3	3.23\|674168\|28\|CP029349\|CRT	674168-674195	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887820-2887847	7	0.75
CP029349_4	4.4\|1685194\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685194-1685223	30	NC_017507	Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence	134270-134299	7	0.767
CP029349_4	4.10\|1685590\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685590-1685619	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	477512-477541	7	0.767
CP029349_3	3.15\|673670\|34\|CP029349\|CRT	673670-673703	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19841-19874	8	0.765
CP029349_4	4.4\|1685194\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685194-1685223	30	KY296500	Xenohaliotis phage pCXc-HC2016, complete genome	22086-22115	8	0.733
CP029349_4	4.4\|1685194\|30\|CP029349\|CRT,PILER-CR,CRISPRCasFinder	1685194-1685223	30	KY296501	Xenohaliotis phage pCXc-HR2015, complete genome	22084-22113	8	0.733

1. spacer 4.4|1685194|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 0, identity: 1.0

ggacgctcgcaaacaacgctgcactcaata	CRISPR spacer
ggacgctcgcaaacaacgctgcactcaata	Protospacer
******************************

2. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggaatcggaatcactg	Protospacer
.***************************

3. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.964

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggaatcggaatcactg	Protospacer
.***************************

4. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgaatcgctgtcgctatccgaatcgctg	Protospacer
************************.***

5. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgaatcgctgtcgctatccgaatcgctg	Protospacer
************************.***

6. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgaatctgaatcactgtcgctatctgaatcgctg	Protospacer
 *********************************

7. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgaatctgaatcactgtcgctatctgaatcgctg	Protospacer
 *********************************

8. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
.**.************************

9. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
.**.************************

10. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
.**.************************

11. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
.**.************************

12. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtccgaatcggaatcactg	Protospacer
 *********** ***************

13. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
.**.************************

14. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
tgaatcgctgtcggagtcggagtcactg	Protospacer
***************.*****.******

15. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
agaatcgctgtcgctatccgaatcgctg	Protospacer
 ***********************.***

16. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgagtcgctgtcgctatccgaatcgctg	Protospacer
***.********************.***

17. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcggaatcggagtcgctg	Protospacer
.**************************.

18. spacer 3.4|672716|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.929

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
tgaatcactgtctgaatcggagtcgcta	Protospacer
***.******** ***************

19. spacer 3.4|672716|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.929

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
tgaatcactgtctgaatcggagtcgcta	Protospacer
***.******** ***************

20. spacer 3.13|673550|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcggaatcggagtcactg	Protospacer
****************** ********.

21. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

22. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

23. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

24. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

25. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

26. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
 **.******************************

27. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtccgaatccgagtcactg	Protospacer
 *********** ***************

28. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcactg	Protospacer
.*****.*********************

29. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatccgaatcactg	Protospacer
 ********************.******

30. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtccgaatccgagtcactg	Protospacer
 *********** ***************

31. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatcggagtcactg	Protospacer
 ***************** *********

32. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
agagtcgctgtcggaatccgagtcactg	Protospacer
***.**.*********************

33. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agaatcactgtcggaatccgagtcactg	CRISPR spacer
agaatcgctgtcagaatccgagtcactg	Protospacer
******.*****.***************

34. spacer 3.19|673910|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
cgagtcactgtccgaatcggagtcactg	Protospacer
*********.**************.***

35. spacer 3.19|673910|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
cgagtcactgtcggaatcggagtcgctg	Protospacer
*********.** ***************

36. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcactg	Protospacer
.**************************.

37. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcactg	Protospacer
.**************************.

38. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
tgagtcgctgtcagaatccgaatcactg	Protospacer
***.***********************.

39. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
.**.******** ***************

40. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 ***********.**.************

41. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggaatccgaatcgctg	Protospacer
.***************** *****.***

42. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 ***********.**.************

43. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **.******** ***************

44. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagaatcggagtcactg	Protospacer
.***********.********.******

45. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
.**************.********.***

46. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
.**************.********.***

47. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.***********.**.************

48. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
.**.******** ***************

49. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
.**.******** ***************

50. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
.**.******** ***************

51. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
.**.******** ***************

52. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 **.********.***************

53. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtccgaatcggagtcactg	Protospacer
 *********** ********.******

54. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **.******** ***************

55. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 **.********.***************

56. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
 *****.********.************

57. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
 *****.********.************

58. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***********.***********.***

59. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***********.***********.***

60. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***********.***********.***

61. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcactg	Protospacer
 ***************** **.******

62. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **.******** ***************

63. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtccgaatcggaatcgctg	Protospacer
 *********** ***********.***

64. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggaatcggagtcgctg	Protospacer
.********************.**.***

65. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***********.***********.***

66. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcactgtcggaatccgaatcactg	Protospacer
.*****.*********** *********

67. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagaatccgaatcactg	Protospacer
.***********.***** *********

68. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agaatcgctgtcggaatcggagtcgctg	Protospacer
 ********************.**.***

69. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
.**************.********.***

70. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
.*****.*****************.***

71. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggagtcggagtcactg	Protospacer
.**************.*****.******

72. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtccgaatccgaatcactg	Protospacer
 *********** ***** *********

73. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcactgtcggaatcggagtcactg	Protospacer
.*****.**************.******

74. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggaatcgctgtccgaatcggagtcactg	Protospacer
 *********** ********.******

75. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggagtcggaatcactg	Protospacer
.**.***********.************

76. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.***********.**.************

77. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagaatccgaatcactg	Protospacer
.***********.***** *********

78. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.***********.**.************

79. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 *********** **************.

80. spacer 3.2|672608|28|CP029349|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 *********** **************.

81. spacer 3.2|672608|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
.*****.*****************.***

82. spacer 3.2|672608|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.***********.**.************

83. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
tgagtcgctgtctgaatcggaatcacta	Protospacer
***.******** **************.

84. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgaatcgctgtcgctatccgaatcggag	Protospacer
************************.  *

85. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
ggaatcgctgtcactatccgaatcgctg	Protospacer
 ***********.***********.***

86. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
ggaatcgctgtcactatccgaatcgctg	Protospacer
 ***********.***********.***

87. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
ggaatcgctgtcactatccgaatcgctg	Protospacer
 ***********.***********.***

88. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcgctg	Protospacer
.*****************.*****.***

89. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcgctg	Protospacer
.*****************.*****.***

90. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtcggagtcgctg	Protospacer
 **************.***********.

91. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
 ***************** ********.

92. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
 ***************** ********.

93. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
 ***************** ********.

94. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
.**.***********************.

95. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
.**.***********************.

96. spacer 3.4|672716|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
tgaatcactgtctgaatcggagtcgctg	Protospacer
***.******** **************.

97. spacer 3.4|672716|28|CP029349|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
tgaatcactgtctgaatcggagtcgctg	Protospacer
***.******** **************.

98. spacer 3.4|672716|28|CP029349|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
tgaatcactgtctgaatcggagtcgctg	Protospacer
***.******** **************.

99. spacer 3.13|673550|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcggaatccgaatcactg	Protospacer
******************.**.*****.

100. spacer 3.13|673550|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtccgaatccgagtcactg	Protospacer
************ *****.********.

101. spacer 3.13|673550|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtccgaatcggagtcactg	Protospacer
************ ***** ********.

102. spacer 3.13|673550|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtccgaatccgagtcactg	Protospacer
************ *****.********.

103. spacer 3.13|673550|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
****************** *****.**.

104. spacer 3.13|673550|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
****************** *****.**.

105. spacer 3.13|673550|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcagaatcggagtcactg	Protospacer
************.***** ********.

106. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
*  *********.*********************

107. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
*  *********.*********************

108. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctg	Protospacer
.*****.*****************.***

109. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctg	Protospacer
.*****.*****************.***

110. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

111. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
.**************.*****.******

112. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

113. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtccgaatccgagtcactg	Protospacer
 *****.***** ***************

114. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtccgaatcggagtcactg	Protospacer
 *********** ***** *********

115. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcagaatccgagtcactg	Protospacer
 *****.*****.***************

116. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

117. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtccgaatccgagtcgctg	Protospacer
.*********** ***********.***

118. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgagtcactgtcggagtccgagtcactg	Protospacer
 **.***********.************

119. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
.**.********************.***

120. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
.**.********************.***

121. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgagtcgctgtcggaatccgagtcactg	Protospacer
 **.**.*********************

122. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

123. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgagtcgctg	Protospacer
.**************.********.***

124. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

125. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgagtcgctg	Protospacer
.**************.********.***

126. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

127. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgagtcgctg	Protospacer
.**************.********.***

128. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggaatccgagtcgctg	Protospacer
 *****.*****************.***

129. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgagtcgctg	Protospacer
.**************.********.***

130. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
.**************.*****.******

131. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctg	Protospacer
.*****.*****************.***

132. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggagtcactgtcggaatccgagtcgctg	Protospacer
.**.********************.***

133. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgagtcactgtcggagtccgagtcactg	Protospacer
 **.***********.************

134. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
.**************.*****.******

135. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgagtcactgtccgaatccgagtcactg	Protospacer
 **.******** ***************

136. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggagtccgagtcgctg	Protospacer
.**************.********.***

137. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcagaatccgagtcgctg	Protospacer
 ***********.***********.***

138. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctg	Protospacer
.*****.*****************.***

139. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctg	Protospacer
.*****.*****************.***

140. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcagaatccgagtcgctg	Protospacer
.***********.***********.***

141. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
 ***************** *****.***

142. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcagagtccgagtcactg	Protospacer
.***********.**.************

143. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggagtccgagtcgctg	Protospacer
 **************.********.***

144. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatcggagtcgctg	Protospacer
 ***************** *****.***

145. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
tgaatcactgtcagaatccgagtcgctg	Protospacer
 ***********.***********.***

146. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggagtccgagtcgctg	Protospacer
 **************.********.***

147. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatccgaatcgctg	Protospacer
 ********************.**.***

148. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcgctgtcagaatccgagtcactg	Protospacer
.*****.*****.***************

149. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgagtcgctgtcggaatccgagtcactg	Protospacer
 **.**.*********************

150. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcagaatccgagtcgctg	Protospacer
 ***********.***********.***

151. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggagtccgagtcgctg	Protospacer
 **************.********.***

152. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
ggaatcactgtcggaatccgaatcgctg	Protospacer
.********************.**.***

153. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcagaatccgagtcactg	Protospacer
 *****.*****.***************

154. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatccgaatcgctg	Protospacer
 ********************.**.***

155. spacer 3.17|673802|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcagaatcggagtcactg	Protospacer
 ***********.***** *********

156. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcgctg	Protospacer
 ***********************.**.

157. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcgctg	Protospacer
 ***********************.**.

158. spacer 3.19|673910|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
ggagtcactgtccgaatccgagtcgctg	Protospacer
 ********.******** *********

159. spacer 3.19|673910|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
ggagtcactgtccgaatcggagtcactg	Protospacer
 ********.**************.***

160. spacer 3.19|673910|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
ggagtcactgtccgaatcggagtcactg	Protospacer
 ********.**************.***

161. spacer 3.19|673910|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
agagtcgctgtccgaatcggagtcgctg	Protospacer
 *****.**.******************

162. spacer 3.19|673910|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
ggaatcactgtccgaatcggagtcgctg	Protospacer
 **.*****.******************

163. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcactg	Protospacer
.**************.***********.

164. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatccgagtcactg	Protospacer
 ********************.*****.

165. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agaatcgctgtcagaatccgagtcactg	Protospacer
 ********************.*****.

166. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatccgaatcgctg	Protospacer
 ***********************.**.

167. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcgctg	Protospacer
.***********************.**.

168. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtccgaatccgaatcactg	Protospacer
 *********** **************.

169. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcactg	Protospacer
.**************.***********.

170. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcactg	Protospacer
.********************.*****.

171. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcgctg	Protospacer
.***********************.**.

172. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcgctg	Protospacer
.***********************.**.

173. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcactg	Protospacer
.********************.*****.

174. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgaatcgctg	Protospacer
.***********************.**.

175. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcactg	Protospacer
.**************.***********.

176. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagaatccgaatcgcta	Protospacer
 **.********************.***

177. spacer 3.23|674168|28|CP029349|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 *********** ***** *********

178. spacer 3.23|674168|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agaatcgctgtctgaatctgaatcacta	Protospacer
 *********** *****.*********

179. spacer 3.23|674168|28|CP029349|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 *********** ***** *********

180. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
agaatcgctgtctgaatctgaatcacta	Protospacer
 *********** ***** ********.

181. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ggagtcgctgtctgaatcggaatcacta	Protospacer
 **.******** **************.

182. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

183. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

184. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

185. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

186. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

187. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

188. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

189. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

190. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

191. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

192. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
.*****************.******  *

193. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtcagaatcggagtcgctg	Protospacer
 *****.*****.**************.

194. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
.*****.********.***********.

195. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtcggagtcggagtcgctg	Protospacer
 *****.********.***********.

196. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggagtcggagtcgctg	Protospacer
.**.***********.***********.

197. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agaatcgctgtcggaatcggagtcgctg	Protospacer
 **.**.********************.

198. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
.**.*****************.*****.

199. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcagagtcggagtcgctg	Protospacer
.***********.**.***********.

200. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggaatccgaatcgctg	Protospacer
 ***************** **.*****.

201. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtcagaatcggagtcgctg	Protospacer
 *****.*****.**************.

202. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

203. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtccgaatcggagtcgctg	Protospacer
 *****.***** **************.

204. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcggagtcactg	Protospacer
.**.********************.**.

205. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggaatccgaatcgctg	Protospacer
 ***************** **.*****.

206. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggaatcactgtcagaatcggagtcgctg	Protospacer
 **.********.**************.

207. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtcagaatcggagtcgctg	Protospacer
 *****.*****.**************.

208. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcactgtcggaatccgaatcgctg	Protospacer
 ***************** **.*****.

209. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggaatcactgtccgaatcggagtcgctg	Protospacer
 **.******** **************.

210. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtccgaatccgagtcgctg	Protospacer
 *********** ***** ********.

211. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcagaatcggagtcactg	Protospacer
.***********.***********.**.

212. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggaatcactgtcagaatcggagtcgctg	Protospacer
 **.********.**************.

213. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
.*****.********.***********.

214. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtccgaatcggagtcactg	Protospacer
 *********** ***********.**.

215. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggaatcactgtcagaatcggagtcgctg	Protospacer
 **.********.**************.

216. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **************.*****.*****.

217. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

218. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

219. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

220. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

221. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

222. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

223. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

224. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

225. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatccgagtcgctg	Protospacer
.*****.*********** ********.

226. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtccgaatcggagtcactg	Protospacer
 *********** ***********.**.

227. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtccgagtcgctg	Protospacer
 **************.** ********.

228. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcagaatccgagtcgctg	Protospacer
 ***********.***** ********.

229. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtccgaatcggagtcactg	Protospacer
.*********** ***********.**.

230. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtccgagtcgctg	Protospacer
 **************.** ********.

231. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **************.*****.*****.

232. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **************.*****.*****.

233. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcgctgtcggaatcggagtcgctg	Protospacer
.**.**.********************.

234. spacer 3.4|672716|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
agagtcgctgtcagaatcggagtcgctg	Protospacer
 *****.*****.**************.

235. spacer 3.4|672716|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
.*****.********.***********.

236. spacer 3.4|672716|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
.**.*****************.*****.

237. spacer 3.13|673550|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
ggaatcgctgtcggaatccgagtcactg	Protospacer
 *****.***********.********.

238. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

239. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

240. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

241. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

242. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

243. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

244. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

245. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

246. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

247. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

248. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgaatcagag	Protospacer
 ************************  .

249. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

250. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

251. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

252. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

253. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

254. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

255. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

256. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcgctg	Protospacer
 *****.*****************.**.

257. spacer 3.18|673856|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
cgaatcgctgtcgctatccgaatcgctg	Protospacer
 *****************.*****.**.

258. spacer 3.18|673856|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
cgaatcgctgtcgctatccgaatcgctg	Protospacer
 *****************.*****.**.

259. spacer 3.18|673856|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
agaatcgctgtcgctatccgaatcgctg	Protospacer
.*****************.*****.**.

260. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagaatccgaatcgctg	Protospacer
 **.********************.**.

261. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagagtctgaatcactg	Protospacer
 **************.**.********.

262. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagagtccgaatcactg	Protospacer
.**.***********.***********.

263. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcactgtcagaatccgaatcgctg	Protospacer
.*****.*****************.**.

264. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgagtcactg	Protospacer
.**************.*****.*****.

265. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtccgaatccgaatcactg	Protospacer
 **.******** **************.

266. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagaatccgaatcgctg	Protospacer
.**.********************.**.

267. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtccgaatccgaatcactg	Protospacer
 **.******** **************.

268. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcactgtcggaatccgaatcactg	Protospacer
.*****.*****.**************.

269. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagaatccgaatcgctg	Protospacer
 **.********************.**.

270. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 **.***********.***********.

271. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagaatccgagtcactg	Protospacer
.**.*****************.*****.

272. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgagtccgaatcactg	Protospacer
.*********** **.***********.

273. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

274. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagcatccgaatcactg	Protospacer
 **.********** ************.

275. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcggaatcggaatcactg	Protospacer
.***********.***** ********.

276. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcactgtcagaatccgaatcgctg	Protospacer
 *****.*****************.**.

277. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagcatccgaatcgctg	Protospacer
.************* *********.**.

278. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgagtccgaatcactg	Protospacer
.*********** **.***********.

279. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtccgaatccgaatcactg	Protospacer
 **.******** **************.

280. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.**************.** ********.

281. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagaatccgaatcgctg	Protospacer
 **.********************.**.

282. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

283. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.**************.** ********.

284. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagaatccgaatcgctg	Protospacer
.**.********************.**.

285. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

286. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagaatccgaatcgctg	Protospacer
.**.********************.**.

287. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgagtcactg	Protospacer
.*********** ********.*****.

288. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 **************.** ********.

289. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcggaatccgaatcgctg	Protospacer
.***********.***********.**.

290. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 **************.** ********.

291. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatcggagtcactg	Protospacer
.***************** **.*****.

292. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

293. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

294. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagagtccgaatcgctg	Protospacer
 **************.********.**.

295. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.**************.** ********.

296. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

297. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgaatcgctg	Protospacer
.*********** ***********.**.

298. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgaatcgctg	Protospacer
.*********** ***********.**.

299. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

300. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgaatcgctg	Protospacer
.*********** ***********.**.

301. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

302. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgaatcgctg	Protospacer
.*********** ***********.**.

303. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

304. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtccgaatccgaatcgctg	Protospacer
.*********** ***********.**.

305. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 **.************** ********.

306. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

307. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

308. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

309. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctg	Protospacer
.********************.**.**.

310. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 **.************** ********.

311. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtccgagtccgaatcactg	Protospacer
 *********** **.***********.

312. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***************** *****.**.

313. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***************** *****.**.

314. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***************** *****.**.

315. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcggaatccgagtcactg	Protospacer
 ***********.********.*****.

316. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcactgtcagaatccgaatcactg	Protospacer
.**.**.********************.

317. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcactgtcagaatccgaatcgctg	Protospacer
.*****.*****************.**.

318. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

319. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

320. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtccgaatcggaatcactg	Protospacer
 *********** ***** ********.

321. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcggaatcggaatcactg	Protospacer
.***********.***** ********.

322. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgagtcgctgtcagaatccgaatcgctg	Protospacer
.**.********************.**.

323. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctg	Protospacer
.**************.********.**.

324. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagaatcggaatcgctg	Protospacer
 ***************** *****.**.

325. spacer 3.23|674168|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 **.***********.***********.

326. spacer 3.23|674168|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcgctgtcagagtccgaatcgctg	Protospacer
 **************.********.**.

327. spacer 3.23|674168|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
agagtcgctgtcagaatccgaatcgctg	Protospacer
 **.********************.**.

328. spacer 3.23|674168|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
.**************.** ********.

329. spacer 3.23|674168|28|CP029349|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggaatcactgtcagagtccgaatcactg	Protospacer
 *****.********.***********.

330. spacer 3.24|674222|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtcactatccgaatctgaatcacta	CRISPR spacer
ggagtcactgtccgaatccgaatcactg	Protospacer
 ********.********.********.

331. spacer 4.6|1685326|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.867

taatcggcg----tggtgaagatttcgccgacgt	CRISPR spacer
----cggcggtgttggtgaagatttcgccgacgt	Protospacer
    *****    *********************

332. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtccgaatcggagtcagag	Protospacer
.*********** ********.***  *

333. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   ********* ***** *********

334. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   ********* ***** *********

335. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

336. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
.**************.**.******  *

337. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

338. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

339. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

340. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

341. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

342. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

343. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
.**************.**.******  *

344. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
.**************.**.******  *

345. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

346. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

347. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

348. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

349. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

350. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
agagtcgctgtcgctatctgaatcagag	Protospacer
 **.**************.******  *

351. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
.*****.***********.******  *

352. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP020865 (Paenibacillus sp. Cedars plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgagtcgctgtcgctttccgaatgattt	Protospacer
***.*********** ******* *.*

353. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP020864 (Paenibacillus sp. Cedars plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgagtcgctgtcgctttccgaatgattt	Protospacer
***.*********** ******* *.*

354. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcggagtcggagtcggag	Protospacer
.**************.*********  .

355. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcgctgtcggaatcggagtcggag	Protospacer
.*****.******************  .

356. spacer 3.4|672716|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcggcatcagagtcagta	Protospacer
.************* ***.*****. **

357. spacer 3.13|673550|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgaatcactgtcggaatcagagtcggag	Protospacer
****************** *****.  .

358. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.**.**************************.  *

359. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

360. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

361. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.**.**************************.  *

362. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

363. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

364. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.**.**************************.  *

365. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

366. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.**.**************************.  *

367. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

368. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

369. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

370. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 **.**************************.  *

371. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcagagtcgctatctgaatcgcta	Protospacer
*  **********  ******************.

372. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcagagtcgctatctgaatcgcta	Protospacer
*  **********  ******************.

373. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcagagtcgctatctgaatcgcta	Protospacer
*  **********  ******************.

374. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcagagtcgctatctgaatcgcta	Protospacer
*  **********  ******************.

375. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggagtccgagtcagag	Protospacer
 *****.********.*********  *

376. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcgctgtcggagtccgagtcagag	Protospacer
 *****.********.*********  *

377. spacer 3.17|673802|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcggaatcagagtcggag	Protospacer
 ***************** *****.  *

378. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

379. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
 **************.*********  .

380. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

381. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

382. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

383. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

384. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

385. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

386. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
 **************.*********  .

387. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagag	Protospacer
 **************.*********  .

388. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

389. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

390. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

391. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

392. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

393. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
agagtcgctgtcgctatctgaatcagag	Protospacer
.**.*********************  .

394. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcactgtcgctatctgaatcagag	Protospacer
 *****.******************  .

395. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP013569 (Rhizobium phaseoli strain N771 plasmid pRphaN771a, complete sequence) position: , mismatch: 5, identity: 0.821

ggaatcgctgtcgctatctgaatcacta--	CRISPR spacer
cgattcgctgtcgctatctgaa--agtaag	Protospacer
 ** ******************  * **

396. spacer 3.19|673910|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

cgagtcactatccgaatcggagtcgctg	CRISPR spacer
gctgtcgctatccgaatcggagtcactg	Protospacer
   ***.*****************.***

397. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
actgtcgctgtcggagtcggagtcactg	Protospacer
   .***********.*****.******

398. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtccgaatcggagtccgag	Protospacer
.*********** ********.**   *

399. spacer 3.2|672608|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgagtcgctgtcggaatcggagtcggag	Protospacer
.**.*****************.**.  *

400. spacer 3.2|672608|28|CP029349|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
cgaatcgctgtcggagtccgaatcggag	Protospacer
.**************.** *****.  *

401. spacer 3.2|672608|28|CP029349|CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
ttgatcgctggcggaatcggcatcacgc	Protospacer
* .******* ********* *****

402. spacer 3.3|672662|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
cgagtcgctgtcgctatccgagtctgaa	Protospacer
***.*****************.**   .

403. spacer 3.3|672662|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgaatcgctgtcgctatccgaatcactg	CRISPR spacer
tgaatcgctgtcgctatctgagtctgag	Protospacer
.*****************.**.**   *

404. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcggagtcggagtcagag	Protospacer
.**************.********.  .

405. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgaatcactgtcggaatcagagtcggag	Protospacer
.**.**************.******  .

406. spacer 3.4|672716|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtcactgtcggaatcggagtcgcta	CRISPR spacer
cgagtcactgtcagagtcggagtcggag	Protospacer
.***********.**.*********  .

407. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  *********.*****************.  *

408. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  *********.*****************.  *

409. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  *********.*****************.  *

410. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcagagtcgctatctgaatcgcta	Protospacer
*  .*********  ******************.

411. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  *********.*****************.  *

412. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcagagtcgctatctgaatcgcta	Protospacer
*  .*********  ******************.

413. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
agagtctgaatcgctgtcgctatctgaatcagag	Protospacer
.**.********.*****************.  *

414. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  *********.*****************.  *

415. spacer 3.17|673802|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

agaatcactgtcggaatccgagtcactg	CRISPR spacer
cgaatcactgtcagaatccgaatcggag	Protospacer
 ***********.********.**.  *

416. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctatctgagtctgag	Protospacer
 ********************.**   .

417. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

418. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

419. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgagtcagag	Protospacer
 **************.*****.***  .

420. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

421. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

422. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

423. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

424. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctgtctgaatcagag	Protospacer
 ********.*****.*********  .

425. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgagtcagag	Protospacer
 **************.*****.***  .

426. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgagtctgaa	Protospacer
 **************.*****.**   *

427. spacer 3.18|673856|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
cgaatcgctgtcgctatccgaatcggag	Protospacer
 *****************.*****.  .

428. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcactgtcagaatccgaatcggag	Protospacer
.*****.*****************.  .

429. spacer 3.23|674168|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcagagtccgaatcggag	Protospacer
.**************.********.  .

430. spacer 3.23|674168|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   ********* *****.********.

431. spacer 3.23|674168|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   ********* *****.********.

432. spacer 4.6|1685326|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcgccgacgt	CRISPR spacer
cgatcggcgtggtgaggatgtcgccgatgg	Protospacer
..*************.*** *******.*

433. spacer 4.6|1685326|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcgccgacgt	CRISPR spacer
caatcggcgtggtgaggatgtcgcccatgg	Protospacer
.**************.*** ***** *.*

434. spacer 4.6|1685326|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcg-ccgacgt	CRISPR spacer
ctatcggcgtggtgaatatttcgactgacc-	Protospacer
. ************** ****** *.***

435. spacer 3.2|672608|28|CP029349|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcggaatcggaatcactg	CRISPR spacer
gctgctgctgtcgaaatcggaatcactg	Protospacer
   ...*******.**************

436. spacer 3.13|673550|28|CP029349|CRT matches to NZ_CP013927 (Alteromonas stellipolaris strain LMG 21861 plasmid pASTE61-200, complete sequence) position: , mismatch: 7, identity: 0.75

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
cgcatcactgtcggaatctgaaaggttt	Protospacer
** ******************.  ..*

437. spacer 3.13|673550|28|CP029349|CRT matches to NC_019750 (Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.03, complete sequence) position: , mismatch: 7, identity: 0.75

cgaatcactgtcggaatctgagtcacta	CRISPR spacer
ggaatcactgtaggaatctgagattcat	Protospacer
 ********** ********** . *

438. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .********.*****************.  *

439. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .********.*****************.  *

440. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .********.*****************.  *

441. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .********.*****************.  *

442. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .********.*****************.  *

443. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctgtctgaatcagag	Protospacer
*  *********.********.********.  *

444. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctatctgaatcagagtcgctatctgaatcagag	Protospacer
*  **********  ***************.  *

445. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctatcgctatctgagtctgag	Protospacer
 ********.***********.**   .

446. spacer 3.18|673856|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

ggaatcgctgtcgctatctgaatcacta	CRISPR spacer
tgaatcgctgtcgctgtctgagtctgag	Protospacer
 **************.*****.**   .

447. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagaatccgagtcggag	Protospacer
 **.*****************.**.  .

448. spacer 3.23|674168|28|CP029349|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
ggagtcgctgtcagaatccgagtcggag	Protospacer
 **.*****************.**.  .

449. spacer 3.23|674168|28|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
gctgtcgctgtcagagtctgaatcactg	Protospacer
   .***********.**.********.

450. spacer 3.23|674168|28|CP029349|CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
gccgtcgctggcagaatccgactcactg	Protospacer
   .****** ********** *****.

451. spacer 3.23|674168|28|CP029349|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.75

tgaatcgctgtcagaatccgaatcacta	CRISPR spacer
cgaatcgctgtcggagtccgaatcggag	Protospacer
.***********.**.********.  .

452. spacer 4.4|1685194|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NC_017507 (Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence) position: , mismatch: 7, identity: 0.767

ggacgctcgcaaacaacgctgcactcaata	CRISPR spacer
agagtctcgcaaacaacgttgcactcaggt	Protospacer
.**  *************.********.

453. spacer 4.10|1685590|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aactgaggcaaccccagcaggagtctgttg	CRISPR spacer
ggccggggcaaccccggcaggagtgtgttt	Protospacer
..*.*.*********.******** ****

454. spacer 3.15|673670|34|CP029349|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggaatctgaatcactgtcgctatctgaatcgctg	CRISPR spacer
gctgtctgaatcagagtcgctatctgaatcagag	Protospacer
*  .*********  ***************.  *

455. spacer 4.4|1685194|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to KY296500 (Xenohaliotis phage pCXc-HC2016, complete genome) position: , mismatch: 8, identity: 0.733

ggacgctcgcaaacaacgctgcactcaata	CRISPR spacer
ctgtgatctcaaacaacgctgcaatcaatg	Protospacer
  ..* ** ************** *****.

456. spacer 4.4|1685194|30|CP029349|CRT,PILER-CR,CRISPRCasFinder matches to KY296501 (Xenohaliotis phage pCXc-HR2015, complete genome) position: , mismatch: 8, identity: 0.733

ggacgctcgcaaacaacgctgcactcaata	CRISPR spacer
ctgtgatctcaaacaacgctgcaatcaatg	Protospacer
  ..* ** ************** *****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

801 : 56751

Lactobacillus_phage(80.65%)

terminase,head,tail,protease,holin,tRNA,portal,transposase,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWL14597.1\|801_996_+	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	4.5e-16	71.4
AWL17456.1\|1150_1804_+	DNA (cytosine-5-)-methyltransferase	A0A1I9KKE7	Lactobacillus_phage	9.4e-82	75.0
AWL14598.1\|1821_2220_+	hypothetical protein	A0A1I9KKE7	Lactobacillus_phage	1.5e-34	60.6
AWL14599.1\|2661_3087_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	7.2e-67	87.2
AWL14600.1\|4305_5061_+	hypothetical protein	NA	NA	NA	NA
AWL14601.1\|5143_5323_+	hypothetical protein	E9LUP6	Lactobacillus_phage	3.6e-12	66.1
AWL14602.1\|6021_6483_+\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	3.2e-44	57.5
AWL14603.1\|8365_8560_+	DUF1056 domain-containing protein	E9LUQ0	Lactobacillus_phage	3.8e-23	89.1
AWL14604.1\|8562_9759_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.2e-206	90.2
AWL14605.1\|9736_10495_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	5.5e-126	94.0
AWL14606.1\|10494_11727_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.0e-209	91.9
AWL14607.1\|11799_12138_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
AWL14608.1\|12121_12484_+\|head,tail	head-tail adaptor protein	E9LUQ5	Lactobacillus_phage	5.2e-66	100.0
AWL14609.1\|12473_12914_+\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	5.0e-79	99.3
AWL14610.1\|12910_13294_+	hypothetical protein	E9LUQ7	Lactobacillus_phage	9.4e-66	98.4
AWL14611.1\|13294_13933_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.1e-116	99.5
AWL14612.1\|14134_14518_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	7.4e-63	97.6
AWL14613.1\|14514_14706_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
AWL14614.1\|14718_19887_+\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	98.0
AWL14615.1\|19958_21731_+\|tail	phage tail protein	E9LUR2	Lactobacillus_phage	0.0e+00	97.3
AWL14616.1\|21794_24164_+	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	96.1
AWL14617.1\|24180_26946_+\|tail	phage tail protein	A0A2P0ZL34	Lactobacillus_phage	1.8e-195	50.4
AWL14618.1\|26938_27193_+	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
AWL14619.1\|27341_28226_+	hypothetical protein	E9LUR7	Lactobacillus_phage	1.7e-139	99.7
AWL14620.1\|28241_29414_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.1e-216	100.0
AWL14621.1\|29413_29677_+\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
AWL14622.1\|29689_30220_+\|holin	holin	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
AWL14623.1\|31460_32672_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AWL14624.1\|33150_34893_+	nitrate ABC transporter permease	NA	NA	NA	NA
AWL14625.1\|34911_35703_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
AWL14626.1\|35683_36868_+	LytR family transcriptional regulator	NA	NA	NA	NA
AWL14627.1\|37019_37592_+\|transposase	transposase	NA	NA	NA	NA
AWL14628.1\|38343_39285_-	glycosyltransferase	V9QJB1	Oenococcus_phage	2.4e-78	49.0
AWL14629.1\|39730_40123_-	hypothetical protein	NA	NA	NA	NA
AWL14630.1\|40286_40679_+	hypothetical protein	NA	NA	NA	NA
AWL14631.1\|40714_41884_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
AWL14632.1\|41933_42563_-	hypothetical protein	NA	NA	NA	NA
AWL14633.1\|42957_43098_+	hypothetical protein	NA	NA	NA	NA
AWL14634.1\|43187_43820_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
AWL14635.1\|43971_44211_+	DUF896 family protein	NA	NA	NA	NA
AWL14636.1\|44308_44545_+	hypothetical protein	NA	NA	NA	NA
AWL14637.1\|44601_45237_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AWL14638.1\|45348_46107_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AWL14639.1\|46090_46396_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
AWL14640.1\|46480_47479_+	lactate dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
AWL14641.1\|47767_48490_-	HAD family hydrolase	NA	NA	NA	NA
AWL14642.1\|48714_49518_+	30S ribosomal protein S2	NA	NA	NA	NA
AWL14643.1\|49620_50499_+	elongation factor Ts	NA	NA	NA	NA
AWL14644.1\|50699_51422_+	UMP kinase	NA	NA	NA	NA
AWL14645.1\|51423_51987_+	ribosome-recycling factor	NA	NA	NA	NA
AWL14646.1\|52106_52886_+	ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
AWL14647.1\|52901_53687_+	CDP-archaeol synthase	NA	NA	NA	NA
AWL14648.1\|53724_55002_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AWL14649.1\|55041_56751_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_2

567858 : 580636

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWL15125.1\|567858_568803_-	glycosyltransferase	V5USA4	Oenococcus_phage	2.0e-72	45.5
AWL15126.1\|568827_569493_-	PAP2 family protein	NA	NA	NA	NA
AWL15127.1\|570202_570895_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.3e-35	37.6
AWL15128.1\|570878_572255_+	sensor histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
AWL15129.1\|572412_572550_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AWL15130.1\|572645_573086_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
AWL15131.1\|573156_573717_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
AWL15132.1\|573804_576243_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
AWL15133.1\|576245_576860_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
AWL15134.1\|576912_577242_+	hypothetical protein	NA	NA	NA	NA
AWL15135.1\|577202_578150_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
AWL15136.1\|578335_579307_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
AWL15137.1\|579397_580636_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7

DBSCAN-SWA_3

1227319 : 1235943

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWL15686.1\|1227319_1228315_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
AWL15687.1\|1228453_1229239_-	acyl-ACP thioesterase	NA	NA	NA	NA
AWL15688.1\|1229242_1230139_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
AWL15689.1\|1230237_1230585_-	initiation-control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
AWL15690.1\|1230609_1231629_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
AWL15691.1\|1231645_1231975_-	hypothetical protein	NA	NA	NA	NA
AWL15692.1\|1231971_1232637_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
AWL15693.1\|1233034_1233286_-	DUF2508 domain-containing protein	NA	NA	NA	NA
AWL15694.1\|1233300_1233900_-	recombination protein RecR	NA	NA	NA	NA
AWL15695.1\|1233915_1234224_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AWL15696.1\|1234245_1235943_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_4

1369431 : 1423209

uncultured_Mediterranean_phage(22.22%)

protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWL15809.1\|1369431_1370703_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
AWL15810.1\|1371169_1372783_-	CTP synthetase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
AWL15811.1\|1372955_1373564_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
AWL15812.1\|1373608_1374049_-	DUF1934 domain-containing protein	NA	NA	NA	NA
AWL15813.1\|1374411_1375344_+	lipoate--protein ligase family protein	NA	NA	NA	NA
AWL15814.1\|1375358_1376711_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
AWL15815.1\|1376730_1377540_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AWL15816.1\|1377709_1378696_-	hypothetical protein	NA	NA	NA	NA
AWL15817.1\|1378778_1379801_-	YdcF family protein	NA	NA	NA	NA
AWL15818.1\|1380089_1381070_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
AWL15819.1\|1381435_1382260_-	serine hydrolase	NA	NA	NA	NA
AWL15820.1\|1382495_1383878_-	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase	A0A2K9L140	Tupanvirus	7.4e-28	33.2
AWL15821.1\|1383946_1384783_-	pur operon repressor	NA	NA	NA	NA
AWL15822.1\|1385138_1385942_-	metal ABC transporter permease	NA	NA	NA	NA
AWL15823.1\|1385928_1386627_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
AWL15824.1\|1386895_1387840_-	alpha/beta hydrolase	NA	NA	NA	NA
AWL15825.1\|1387885_1388068_+	hypothetical protein	NA	NA	NA	NA
AWL15826.1\|1388149_1389016_-	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
AWL15827.1\|1389148_1389400_-	hypothetical protein	NA	NA	NA	NA
AWL15828.1\|1389504_1390395_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
AWL15829.1\|1390391_1390955_-	ribonuclease M5	NA	NA	NA	NA
AWL15830.1\|1390941_1391718_-	TatD family deoxyribonuclease	NA	NA	NA	NA
AWL15831.1\|1391840_1392773_-	MFS transporter	NA	NA	NA	NA
AWL15832.1\|1393005_1395057_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
AWL15833.1\|1395378_1395768_-	NUDIX domain-containing protein	NA	NA	NA	NA
AWL15834.1\|1396362_1397205_-	DUF72 domain-containing protein	NA	NA	NA	NA
AWL15835.1\|1397204_1397909_-	NAD-dependent protein deacetylase	NA	NA	NA	NA
AWL15836.1\|1397930_1398890_-	IpaB/EvcA family protein	NA	NA	NA	NA
AWL15837.1\|1398882_1400157_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
AWL15838.1\|1400202_1401120_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
AWL15839.1\|1401561_1402575_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
AWL15840.1\|1402687_1403434_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWL15841.1\|1403583_1404480_-	ROK family protein	NA	NA	NA	NA
AWL15842.1\|1404560_1405997_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-30	25.5
AWL17481.1\|1406014_1407370_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWL15843.1\|1407592_1408015_-	DUF3284 domain-containing protein	NA	NA	NA	NA
AWL15844.1\|1408004_1408193_-	hypothetical protein	NA	NA	NA	NA
AWL15845.1\|1408199_1409561_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AWL15846.1\|1409633_1410344_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWL15847.1\|1410749_1411766_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AWL15848.1\|1412204_1412981_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
AWL15849.1\|1413239_1415549_+	ATP-dependent DNA helicase	NA	NA	NA	NA
AWL15850.1\|1415643_1415847_-	hypothetical protein	NA	NA	NA	NA
AWL15851.1\|1415984_1416671_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWL15852.1\|1416764_1417445_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWL15853.1\|1417531_1418200_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWL15854.1\|1418267_1418957_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWL15855.1\|1419046_1420423_-	HlyD family secretion protein	NA	NA	NA	NA
AWL15856.1\|1420439_1422590_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
AWL15857.1\|1422855_1423026_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
AWL15858.1\|1423050_1423209_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

DBSCAN-SWA_5

2631010 : 2639524

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWL16916.1\|2631010_2631496_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
AWL16917.1\|2631479_2632610_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AWL16918.1\|2632612_2633344_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
AWL16919.1\|2633345_2633600_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AWL16920.1\|2633599_2634280_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AWL16921.1\|2634272_2636492_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
AWL16922.1\|2636476_2637931_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-50	34.0
AWL16923.1\|2637927_2638953_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
AWL16924.1\|2638945_2639524_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_6

2833453 : 2883522

Lactobacillus_phage(36.36%)

terminase,head,tail,portal,integrase,capsid

attL 2833282:2833296|attR 2886464:2886478

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2833282:2833296	attL	NA	NA	NA	NA
AWL17099.1\|2833453_2834611_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	5.0e-54	34.8
2833282:2833296	attL	NA	NA	NA	NA
AWL17100.1\|2834661_2835312_-	XRE family transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	3.6e-09	46.5
AWL17101.1\|2835489_2835672_+	DNA-binding protein	NA	NA	NA	NA
AWL17102.1\|2835714_2835822_+	hypothetical protein	NA	NA	NA	NA
AWL17103.1\|2835942_2836173_+	hypothetical protein	NA	NA	NA	NA
AWL17104.1\|2836186_2836987_+	DNA replication protein	NA	NA	NA	NA
AWL17105.1\|2838526_2839006_+	hypothetical protein	NA	NA	NA	NA
AWL17106.1\|2839021_2839213_+	hypothetical protein	NA	NA	NA	NA
AWL17107.1\|2839199_2839538_+\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	1.3e-07	34.7
AWL17108.1\|2839530_2839920_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	44.7
AWL17109.1\|2840930_2841404_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
2839966:2839980	attR	NA	NA	NA	NA
AWL17110.1\|2841400_2843104_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.2e-122	41.1
2839966:2839980	attR	NA	NA	NA	NA
AWL17111.1\|2843057_2843258_+	hypothetical protein	NA	NA	NA	NA
AWL17112.1\|2843258_2844359_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.4e-48	34.0
AWL17113.1\|2844355_2845900_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	8.2e-44	25.6
AWL17114.1\|2845988_2846258_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
AWL17115.1\|2846408_2846786_+	hypothetical protein	NA	NA	NA	NA
AWL17116.1\|2846864_2847338_+	DUF4065 domain-containing protein	NA	NA	NA	NA
AWL17117.1\|2847343_2847925_+	hypothetical protein	NA	NA	NA	NA
AWL17118.1\|2848338_2848545_+	hypothetical protein	NA	NA	NA	NA
AWL17119.1\|2848895_2850017_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	2.0e-47	33.0
AWL17120.1\|2850282_2851902_-	hypothetical protein	A0A1S5SA14	Streptococcus_phage	3.1e-94	47.9
AWL17121.1\|2852500_2852689_-	hypothetical protein	E9LUS5	Lactobacillus_phage	2.1e-26	100.0
AWL17508.1\|2852846_2853299_-	hypothetical protein	A0A173G9H4	Propionibacterium_phage	5.2e-07	60.0
AWL17122.1\|2853754_2854177_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	7.8e-13	35.1
AWL17123.1\|2854191_2854710_-	XRE family transcriptional regulator	S6C481	Thermus_phage	1.6e-15	34.1
AWL17124.1\|2854851_2855106_+	XRE family transcriptional regulator	A0A2H4JFN1	uncultured_Caudovirales_phage	1.5e-06	41.3
AWL17125.1\|2855262_2855544_-	hypothetical protein	NA	NA	NA	NA
AWL17126.1\|2855602_2855785_+	hypothetical protein	NA	NA	NA	NA
AWL17127.1\|2855781_2856180_-	DUF2513 domain-containing protein	A0A1P8L6H1	Staphylococcus_phage	5.1e-14	38.4
AWL17128.1\|2856179_2856410_-	XRE family transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
AWL17129.1\|2856551_2856758_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWL17130.1\|2856757_2857054_+	hypothetical protein	NA	NA	NA	NA
AWL17131.1\|2857260_2857566_+	DUF771 domain-containing protein	NA	NA	NA	NA
AWL17132.1\|2857633_2858146_+	transcriptional regulator	D6PST4	Lactobacillus_phage	1.8e-27	43.5
AWL17133.1\|2858395_2858683_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	1.3e-22	48.9
AWL17134.1\|2858750_2858879_+	hypothetical protein	NA	NA	NA	NA
AWL17135.1\|2859011_2859398_+	hypothetical protein	NA	NA	NA	NA
AWL17136.1\|2859394_2860294_+	recombinase RecT	E9LUM3	Lactobacillus_phage	1.0e-62	47.7
AWL17137.1\|2860205_2861078_+	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	1.8e-72	47.6
AWL17138.1\|2861158_2861947_+	DNA replication protein DnaD	NA	NA	NA	NA
AWL17139.1\|2861927_2862770_+	ATP-binding protein	O03914	Lactobacillus_phage	2.9e-152	96.1
AWL17509.1\|2862926_2863649_+	oxidoreductase	Q8SDM9	Staphylococcus_phage	4.2e-51	45.6
AWL17140.1\|2863653_2864172_+	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	68.4
AWL17141.1\|2864168_2864549_+	hypothetical protein	NA	NA	NA	NA
AWL17142.1\|2864760_2865222_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	3.1e-39	56.3
AWL17143.1\|2865631_2866651_+	hypothetical protein	NA	NA	NA	NA
AWL17144.1\|2866668_2867172_+	hypothetical protein	NA	NA	NA	NA
AWL17145.1\|2867250_2867430_+	hypothetical protein	NA	NA	NA	NA
AWL17146.1\|2867398_2867671_+	hypothetical protein	A0A2D2W301	Escherichia_phage	4.0e-18	50.6
AWL17147.1\|2867894_2868215_+	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	1.8e-17	45.6
AWL17148.1\|2868272_2868788_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.8e-65	88.8
AWL17149.1\|2868780_2870094_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	8.6e-127	54.3
AWL17150.1\|2870108_2871845_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	7.0e-76	34.4
AWL17151.1\|2871844_2872756_+\|head	phage head morphogenesis protein	NA	NA	NA	NA
AWL17152.1\|2872866_2873526_+	DUF4355 domain-containing protein	NA	NA	NA	NA
AWL17153.1\|2873539_2873911_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.5e-07	33.6
AWL17154.1\|2873926_2875036_+\|capsid	minor capsid protein E	A0A2H4J022	uncultured_Caudovirales_phage	1.8e-61	40.1
AWL17155.1\|2875053_2875422_+	hypothetical protein	NA	NA	NA	NA
AWL17156.1\|2875418_2875751_+	hypothetical protein	NA	NA	NA	NA
AWL17157.1\|2875751_2876243_+	hypothetical protein	NA	NA	NA	NA
AWL17158.1\|2876245_2876641_+	hypothetical protein	NA	NA	NA	NA
AWL17159.1\|2876689_2877343_+	hypothetical protein	NA	NA	NA	NA
AWL17160.1\|2877371_2877890_+	hypothetical protein	NA	NA	NA	NA
AWL17161.1\|2877964_2878222_+	hypothetical protein	NA	NA	NA	NA
AWL17510.1\|2878446_2882235_+	tape measure protein	A0A0A7DMV4	Lactobacillus_phage	3.3e-38	57.2
AWL17162.1\|2882259_2882538_-	hypothetical protein	NA	NA	NA	NA
AWL17163.1\|2882610_2883522_+\|tail	phage tail family protein	Q9T1A6	Listeria_phage	1.6e-18	30.3
2886464:2886478	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3187833 : 3196994

Lactobacillus_phage(77.78%)

integrase

attL 3186646:3186659|attR 3192426:3192439

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3186646:3186659	attL	NA	NA	NA	NA
AWL17441.1\|3187833_3188997_-\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
AWL17442.1\|3189543_3189852_+	hypothetical protein	NA	NA	NA	NA
AWL17443.1\|3190044_3190407_-	hypothetical protein	E9LUS2	Lactobacillus_phage	1.7e-56	91.7
AWL17444.1\|3190563_3190752_-	hypothetical protein	E9LUS5	Lactobacillus_phage	2.1e-26	100.0
AWL17445.1\|3191036_3191912_-	hypothetical protein	NA	NA	NA	NA
AWL17446.1\|3192041_3192725_-	helix-turn-helix domain-containing protein	D7RWL5	Brochothrix_phage	6.2e-52	44.6
3192426:3192439	attR	NA	NA	NA	NA
AWL17447.1\|3192884_3193133_+	transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
AWL17448.1\|3193139_3193856_+	phage regulatory protein	D2IYT0	Enterococcus_phage	5.1e-65	59.9
AWL17449.1\|3193867_3194077_+	hypothetical protein	NA	NA	NA	NA
AWL17450.1\|3194192_3194519_-	RNA polymerase III	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
AWL17451.1\|3194576_3194837_+	hypothetical protein	NA	NA	NA	NA
AWL17452.1\|3194979_3195234_+	hypothetical protein	NA	NA	NA	NA
AWL17453.1\|3195236_3195437_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
AWL17454.1\|3195890_3196148_+	hypothetical protein	NA	NA	NA	NA
AWL17455.1\|3196250_3196994_+	replisome organizer	E9LUM6	Lactobacillus_phage	2.7e-40	57.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage