CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029465	Bacillus subtilis subsp. inaquosorum strain KCTC 13429 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,WYL,DinG,RT	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029465_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029465_2

3255600-3255707

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP029465_2

>merge|CP029465|2|3255600-3255707|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP029465|2|2|3255600-3255707|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP029465.1\|AWM18199.1\|3253099_3254983_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP029465.1\|AWM18191.1\|3240638_3241457_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958
CP029465.1\|AWM18203.1\|3265443_3265968_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP029465.1\|AWM18194.1\|3244042_3245458_-\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
CP029465.1\|AWM18190.1\|3239087_3240548_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
CP029465.1\|AWM18208.1\|3270942_3271488_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP029465.1\|AWM18192.1\|3241491_3242316_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
CP029465.1\|AWM18193.1\|3242303_3244046_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|224087
CP029465.1\|AWM18201.1\|3263349_3263871_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP029465.1\|AWM18206.1\|3268520_3269993_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP029465.1\|AWM18195.1\|3245749_3246469_+\|yteA-family-sporulation-protein	unknown	unknown	gnl\|CDD\|274340
CP029465.1\|AWM18205.1\|3266629_3267208_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP029465.1\|AWM18200.1\|3262730_3263309_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP029465.1\|AWM18196.1\|3246576_3247044_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226007
CP029465.1\|AWM18197.1\|3250906_3251938_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP029465.1\|AWM18198.1\|3251960_3253103_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP029465.1\|AWM19337.1\|3267295_3268504_-\|NAD-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
CP029465.1\|AWM18207.1\|3270191_3270734_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP029465.1\|AWM18204.1\|3266135_3266624_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP029465.1\|AWM18202.1\|3263895_3265425_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177

Protein	Function_ID	Function_description	E-value
CP029465.1\|AWM18199.1\|3253099_3254983_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP029465.1\|AWM18191.1\|3240638_3241457_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0
CP029465.1\|AWM18203.1\|3265443_3265968_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000136749
CP029465.1\|AWM18194.1\|3244042_3245458_-\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	1.00923e-166
CP029465.1\|AWM18190.1\|3239087_3240548_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
CP029465.1\|AWM18208.1\|3270942_3271488_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	1.21455e-46
CP029465.1\|AWM18192.1\|3241491_3242316_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	1.41439e-122
CP029465.1\|AWM18193.1\|3242303_3244046_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|224087	COG1165, MenD, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism].	0
CP029465.1\|AWM18201.1\|3263349_3263871_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.53352e-10
CP029465.1\|AWM18206.1\|3268520_3269993_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP029465.1\|AWM18195.1\|3245749_3246469_+\|yteA-family-sporulation-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	2.7197e-68
CP029465.1\|AWM18205.1\|3266629_3267208_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	5.47913e-07
CP029465.1\|AWM18200.1\|3262730_3263309_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	4.92956e-71
CP029465.1\|AWM18196.1\|3246576_3247044_+\|hypothetical-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.23062e-39
CP029465.1\|AWM18197.1\|3250906_3251938_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP029465.1\|AWM18198.1\|3251960_3253103_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP029465.1\|AWM19337.1\|3267295_3268504_-\|NAD-dependent-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	6.19062e-176
CP029465.1\|AWM18207.1\|3270191_3270734_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.81608e-70
CP029465.1\|AWM18204.1\|3266135_3266624_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	1.4559e-17
CP029465.1\|AWM18202.1\|3263895_3265425_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	3.07593e-121

>CP029465.1|AWM18199.1|3253099_3254983_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGQSGYEFCVWAPHASEVRVAGDFNSWSGEQHVMHRVNDNGIWTLFIPGLGEKERYKYEIVTHSGEIRLKADPYAIYSEVRPHTASLTYDLGEYSWKDQLWQKKQKAKTVYEKPVFIYELHLGSWKKHSDGRHYSYQELSQSLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQENIGVILDWVPGHFCKDAHGLYMFDGEPLYEYQEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMVAEDSTEWPQVTGAIEEGGLGFHFKWNMGWMNDVLTYMETPPEERRNCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTAHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYENDHRAQSFEWIDVHNNEQSIFSFIRYGKRHGEALVIICNFTPAVYHQYDVGVPFLTQYIEVLNSDSETYGGSGQINKKPLAAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP029465.1|AWM18198.1|3251960_3253103_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKHMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDFHIEKKADVTISVIEVGWEEASRFGIMKTNADGMITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDRNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEESELKLFERKWKIYSVNPNQPPQFISSDAQVHDSLVNEGCVVYGNVSHSVLFQGVTVGKHSTVKSSVIMPDVTIGEHVVIENAIVPKGLVLPDGAVIRSEKDIQEVLLVSEEFVEKELI
>CP029465.1|AWM18197.1|3250906_3251938_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHQEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTALLKDLIYGHSEKGYKTIQEAVEKESSSLTICPYEYSGYAAIIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIVMQKTQIGEECLLEQVISDKDVKIGNATEAAGTAEQPLVLRKGLVQGELMNS
>CP029465.1|AWM18196.1|3246576_3247044_+|hypothetical-protein
MKKIIGVIAVFVITYALFSAADYLFPIDQEWYNSLKKPDWTPPGSAIGIIWAILFALISLSAAIVYAAFSFKDAKSFWIMLLLNYVLNQAFSYFQFTQKNLLAASIDCLLVAITTLILMIAAKKYSRAASYLLLPYFLWSAFATFLSFTIYSMNL
>CP029465.1|AWM18195.1|3245749_3246469_+|yteA-family-sporulation-protein
MLTKDQLQHLKNELEQTKKDILNRFKDNDHFQLNSAFPYDSWGELSAYDNHPGDQATELYEREKDIALDLHEREHLRDIEHSLKAIENGTYGICEVSGKEIPYERLEALPTATTLAEYSSQDVVSKDRPIEEETPFGQFEFDDDEEIRAPYDSEDSYQDVEKYGNSSTPQDMENPPLSYDDMTMNAEENIGNTESYENFIATDITGKEITVYQSRAHERYEEELDEEGIMTTFGDLHAD
>CP029465.1|AWM18194.1|3244042_3245458_-|isochorismate-synthase
MVTTVQRTFRKEVLHALHKAKEVNHAVLISYSRQIESLDPLSFFNYGAKKYTGNRFFWSDPESELTIVGLGKEAVFQTNQKNSERYREVFEQWERFKKTAFHIYEEEKLQHSAVGPVLFGGFSFDPCEERGTQWDHFSEGDFFVPALMLTMTAEGPFLTVNRWVSEEEDAEAVLEGLKAFAVEFMVPVLEQGDQAAIAASQELDKDNWLKAIETATSQIKEKQYDKVVLARELLLTFDGPVQIEPMLKTLLNDQQTSYVFAIEQEGQTFVGASPERLIKRDGSTVMSSCLAGSIKRGADEEEDRRIGLELLNDEKNLLEHDIVVGMIHNAFISSCSEVEKPDGPALYKTKSVQHLYTPIVGQLRESASLFDLIEKLHPTPALGGAPQKKAVEVIREIEPMSRGWYAAPIGWIDSQDNGEFAVAIRSGLIEGSTARLFAGCGIVEDSDPQSEYEETQIKLKPMISALGGERR
>CP029465.1|AWM18193.1|3242303_3244046_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MTANPITHYIGSFMDEFALSGITDAVVCPGSRSTPLAILAAAHPDISVHVQIDERSAGFFALGLAKAKQRPVLLICTSGTAAANFYPAVIEAHYSRVPIIVLTADRPHELREVGAPQAINQHFLFGNFVKFFTDSALPEESPHMLRYIRTLASRAAGEAQKRPMGPVHVNVPLREPLMPDLSAEPFGRMRTGRHVSVKTGIQSVDRESLADVAVMLTEAEKGMIVCGELHSDTDKENIIALSKALQYPILADPLSNLRNGVHDKSTVIDAYDSFLKDDELKAKLRPDVVIRFGPMPVSKPVFLWLKDDPAIQQIVIDEDGGWRDPTQASAHMIHCNASAFAEAIIDDLADITRSSEWMEKWQFVNGRFREHLQTISSEDVSFEGNLYRILQHLVPENSSLFVGNSMPIRDVDTFFEKQERYFRIYSNRGANGIDGVVSSAMGVCEGTKAPVTLVIGDLSFYHDLNGLLAAKKLGIPLTVILVNNDGGGIFSFLPQASEKAHFEDLFGTPTGLDFKHAAALYGGTYSCPASWDEFRAAYAPQADKPGLHLIEIKTDRQSRVQLHRDMLNEAVREVKKQWEL
>CP029465.1|AWM18192.1|3241491_3242316_-|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MGTVNLTVSDGVRYAVTDERPNASEAIVCLHGFTGSKQSWNFLDGMLPDSRLIKIDCLGHGETDAPLNGKRYSTSRQVSDLAEIFDQLKLHKVKLIGYSMGGRLVYSFAMTYPERVSALVLESTTPGLKTLEERRERIMRDRKLADFILRNGIKAFVQYWEGIPLFSSQQRLAEDIRHRIRLGRLRNNKIGLANSLTGSGTGSQPSWWSRVDEIEVPVLLICGEWDEKFCAINQEVHKKLPSSRIEIVPNAGHTVHVEQPRFFGKIVSEFLTSI
>CP029465.1|AWM18191.1|3240638_3241457_-|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MAAEWKTKRTYDEILYETYNGIAKITINRPEVHNAFTPKTVAEMIDAFADARDDQNVGVIVLAGAGDKAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGRDSFKEKRKPDFGQFPRFP
>CP029465.1|AWM18190.1|3239087_3240548_-|o-succinylbenzoate--CoA-ligase
MLTEQPNWLMQRAQLTPERIALIYGDQTVTFADLFAASKQMAAQLAAHSVRKGDTAAILLQNRTEMVYAVHACFLLGVKVVLLNTKLSTHERLFQLEDSGARFLLTDSSFDKQDYEHTLQTIDVDELAQVDAKEITIEAYMQLDETATLMYTSGTTGKPKGVQQSFGNHYFSAVSSALNLGITEQDRWLIALPLFHISGLSALFKSVIYGMTVVLHQRFSVSDVLDSITRHQVTMISAVQTMLASLLEETSRCPETIRCILLGGGPAPLPLLEECREKGFPVFQSYGMTETCSQIVTLSPEFSMEKLGSAGKPLFSCEIKIERDGQACEPFEHGEIMVKGPNVMKSYFNRESANEASFQNGWLKTGDLGYLDSDGFLYVLDRRSDLIISGGENIYPAEVESVLLSHPAVAEAGVSGAEDKKWGKVPHAYLVLHKPVSAEELTAYCKERLAKYKIPAKFFILDSLPRNASNKLLRNQLKDARKGELL
>CP029465.1|AWM18200.1|3262730_3263309_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLRMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYLIAFAAIGLSGFFASSVRKASVSKTKGKLLVSVVSAVFIGSFLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKTDRA
>CP029465.1|AWM18201.1|3263349_3263871_-|GNAT-family-N-acetyltransferase
MVILREAKVEDIKDIAKVHVDSWGTTYRGIVPADYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSIFGFASFGPIRSEQKGYDGELYAIYLLEEHQRQGAGRALLAKGAEFLLHHGFSSMFVWVMEKNPSITFYQSYSPEREAEDSFEIAGERLKEIGFGWPDLPALKTVLNR
>CP029465.1|AWM18202.1|3263895_3265425_-|flotillin-family-protein
MTMPIIIVIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKEDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEYRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMIENFSGKGNVKQSINELTNEIKEAKTVQKPE
>CP029465.1|AWM18203.1|3265443_3265968_-|hypothetical-protein
MELLGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPLLNPTLVLAFFTCFSAGGYIGELTLPLSSLLLAFLSCILSIILVTLLHIFVLVPLSSAEESLAYKEADLKGRVGKVITAVPVDGFGEVVIEGIGGTISKSAVSFENQQISYGTTVLVVDVNNGVLSVTPHEPI
>CP029465.1|AWM18204.1|3266135_3266624_+|DinB-family-protein
MSIFNEARLETWNEVKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMAAQKMLKERVKEAPVKEVEEKPLETAQDRNNKRKAPSHLEPEHDFISGSQMKRELDVVREQLTAAIASLKEEDLKRVLPHPVFQELTVRQWIDFIGHHEKRHLSQIKEIKEKVERV
>CP029465.1|AWM18205.1|3266629_3267208_-|MOSC-domain-containing-protein
MWKRMTARTEGLYIADTESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSKGTEIFNRRQISIVSIEECDQIALKMGVPSILPEWLGANVAVSGIHDFTSLKEGSRLIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLAPAFVRHALGIRGIVCIVERPGAVYAGDEIEVHSYQRKVKRKAERV
>CP029465.1|AWM19337.1|3267295_3268504_-|NAD-dependent-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAVKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHISMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIRRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSNMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP029465.1|AWM18206.1|3268520_3269993_-|betaine-aldehyde-dehydrogenase
MSQTLYIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWPSLSGLERGNIVLKIAELIRRDLDELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPEGVANLVLGPGATVGDELAANKDVDLISFTGGIETGKKIMQAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIQEGAKLETGGKRPEDPALQNGFFYEPTIFSNCKSGMRIVQEEVFGPVLTVETFSSEEEVIALANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKMGLEEYTEVKHVYRNTKPAAVNWFNS
>CP029465.1|AWM18207.1|3270191_3270734_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFATIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQEVLSKEGLSEDIKNEALQLYEQLESSKAYYDWLKRLAESVQSGEIFKFIPIETK
>CP029465.1|AWM18208.1|3270942_3271488_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESKSTSAHTESTMRTQSSASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTMNGNALRTTQILNNGKTVRIPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP029465_2	2.1\|3255624\|60\|CP029465\|CRISPRCasFinder	3255624-3255683	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3255624|60|CP029465|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

527583 : 537905

Staphylococcus_phage(25.0%)

integrase

attL 518937:518950|attR 544330:544343

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
518937:518950	attL	NA	NA	NA	NA
AWM15829.1\|527583_528882_+	arsenical efflux pump membrane protein ArsB	A0A2H4PQU3	Staphylococcus_phage	6.7e-164	69.7
AWM15830.1\|528902_529322_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.8e-47	66.4
AWM15831.1\|529528_530086_-	resolvase	K7PGS7	Enterobacteria_phage	1.3e-15	31.6
AWM15832.1\|530303_531770_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	6.9e-149	58.4
AWM15833.1\|531787_532207_+	universal stress protein	NA	NA	NA	NA
AWM15834.1\|532631_533738_-\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	7.5e-39	34.2
AWM15835.1\|533750_534263_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AWM15836.1\|534259_534643_-	transcriptional regulator	A0A0B5CYL9	Listeria_phage	1.2e-12	36.9
AWM15837.1\|534916_535111_+	excisionase	NA	NA	NA	NA
AWM15838.1\|535107_535368_+	hypothetical protein	NA	NA	NA	NA
AWM15839.1\|535420_535681_+	hypothetical protein	NA	NA	NA	NA
AWM15840.1\|536046_536427_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	1.4e-05	36.1
AWM15841.1\|536462_537905_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	7.3e-119	50.6
544330:544343	attR	NA	NA	NA	NA

DBSCAN-SWA_2

717767 : 727668

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM15994.1\|717767_719063_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.2e-18	25.4
AWM15995.1\|719137_719863_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.6e-45	44.1
AWM15996.1\|719855_720110_+	phosphoribosylformylglycinamidine synthase, purS protein	M4QPE7	Synechococcus_phage	4.7e-05	32.1
AWM15997.1\|720106_720790_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AWM15998.1\|720773_723002_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
AWM15999.1\|722977_724408_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AWM16000.1\|724508_725549_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	6.3e-64	41.1
AWM16001.1\|725545_726133_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
AWM16002.1\|726129_727668_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.1e-77	52.6

DBSCAN-SWA_3

1340357 : 1408264

Bacillus_phage(34.29%)

coat,tail,tRNA,terminase,holin,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM16525.1\|1340357_1340840_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AWM16526.1\|1340870_1341065_-	DUF4177 domain-containing protein	NA	NA	NA	NA
AWM16527.1\|1341372_1341702_-	DUF4306 domain-containing protein	NA	NA	NA	NA
AWM19247.1\|1342068_1342263_+	hypothetical protein	NA	NA	NA	NA
AWM19248.1\|1342286_1343276_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
AWM16528.1\|1343398_1343635_-\|coat	spore coat protein	NA	NA	NA	NA
AWM16529.1\|1343889_1345290_+	DUF4163 domain-containing protein	NA	NA	NA	NA
AWM16530.1\|1345339_1345813_-	DUF2690 domain-containing protein	NA	NA	NA	NA
AWM16531.1\|1345941_1346109_-	putative motility protein	NA	NA	NA	NA
AWM16532.1\|1346235_1347135_+	hypothetical protein	NA	NA	NA	NA
AWM19249.1\|1347143_1347542_-	DUF2809 domain-containing protein	NA	NA	NA	NA
AWM16533.1\|1347643_1348219_-	DUF4309 domain-containing protein	NA	NA	NA	NA
AWM16534.1\|1348365_1351323_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
AWM16535.1\|1351315_1351876_+	DUF1641 domain-containing protein	NA	NA	NA	NA
AWM16536.1\|1352167_1352755_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	4.7e-08	30.1
AWM16537.1\|1353498_1353777_-	hypothetical protein	NA	NA	NA	NA
AWM16538.1\|1355381_1356560_+	UDP-glucosyltransferase	B0LUM8	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	1.2e-07	28.6
AWM16539.1\|1356602_1356788_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	8.9e-22	79.3
AWM16540.1\|1356961_1357774_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
AWM16541.1\|1357818_1358571_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AWM16542.1\|1358570_1359323_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-17	32.5
AWM16543.1\|1359442_1360417_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
AWM16544.1\|1360548_1361046_+	cupin domain-containing protein	NA	NA	NA	NA
AWM16545.1\|1361436_1361859_+	DUF1641 domain-containing protein	NA	NA	NA	NA
AWM16546.1\|1361898_1363077_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AWM16547.1\|1363276_1364698_+	glucuronate isomerase	NA	NA	NA	NA
AWM16548.1\|1364780_1366160_+	MFS transporter	NA	NA	NA	NA
AWM16549.1\|1366264_1367278_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
AWM16550.1\|1367283_1368303_+	alcohol dehydrogenase	NA	NA	NA	NA
AWM16551.1\|1368327_1369407_+	mannonate dehydratase	NA	NA	NA	NA
AWM16552.1\|1369403_1370240_+	KR domain-containing protein	M1NMS3	Moumouvirus	6.1e-09	30.4
AWM16553.1\|1370287_1371556_+	MFS transporter	NA	NA	NA	NA
AWM19250.1\|1372721_1374164_+	tagaturonate reductase	NA	NA	NA	NA
AWM16554.1\|1374160_1375654_+	altronate dehydratase	NA	NA	NA	NA
AWM16555.1\|1375691_1376456_-	anion permease	NA	NA	NA	NA
AWM16556.1\|1376679_1377144_-	hypothetical protein	NA	NA	NA	NA
AWM16557.1\|1377379_1378516_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.1
AWM16558.1\|1378505_1378640_+	phosphatase RapA inhibitor	NA	NA	NA	NA
AWM16559.1\|1378668_1378923_-	hypothetical protein	NA	NA	NA	NA
AWM16560.1\|1379045_1379999_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	5.6e-67	73.5
AWM16561.1\|1380035_1380413_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	6.1e-17	43.4
AWM16562.1\|1380518_1381121_+	hypothetical protein	A0A0Y0AJU6	Bacillus_phage	2.7e-43	48.3
AWM16563.1\|1381194_1382031_+	manganese catalase	NA	NA	NA	NA
AWM16564.1\|1382075_1382672_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.8e-40	52.3
AWM16565.1\|1382836_1383175_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	3.8e-18	44.4
AWM16566.1\|1383352_1383532_+	hypothetical protein	NA	NA	NA	NA
AWM16567.1\|1383518_1384355_+\|portal	phage portal protein	S6BFM4	Thermus_phage	4.3e-23	50.5
AWM16568.1\|1384254_1385055_+	ATP-binding protein	A6XMI1	Bacillus_virus	7.0e-63	53.0
AWM16569.1\|1385054_1385222_+	hypothetical protein	NA	NA	NA	NA
AWM16570.1\|1385306_1385654_+\|portal	phage portal protein	NA	NA	NA	NA
AWM16571.1\|1385650_1385857_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	55.6
AWM16572.1\|1385971_1386481_+	Fis family transcriptional regulator	A0A1L2JY33	Aeribacillus_phage	1.6e-20	36.8
AWM16573.1\|1386598_1387396_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	4.0e-58	49.4
AWM16574.1\|1387392_1388694_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.5e-155	60.9
AWM19251.1\|1388697_1390185_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.8e-139	55.3
AWM16575.1\|1390204_1391032_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.3e-53	57.7
AWM16576.1\|1391057_1391993_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AWM16577.1\|1392014_1392398_+	DUF3199 domain-containing protein	A0A1B1P7D6	Bacillus_phage	7.1e-13	41.5
AWM16578.1\|1392394_1392751_+	DUF3599 domain-containing protein	NA	NA	NA	NA
AWM16579.1\|1392747_1393233_+	HK97 gp10 family phage protein	NA	NA	NA	NA
AWM16580.1\|1393246_1393687_+\|portal	phage portal protein	NA	NA	NA	NA
AWM16581.1\|1393690_1393909_+	hypothetical protein	NA	NA	NA	NA
AWM16582.1\|1393905_1395306_+\|tail	phage tail sheath protein	A0A0A7RTT5	Clostridium_phage	8.5e-80	39.7
AWM16583.1\|1395307_1395751_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
AWM16584.1\|1395841_1396288_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
AWM16585.1\|1396317_1396467_+	hypothetical protein	NA	NA	NA	NA
AWM16586.1\|1400341_1401001_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.8e-25	34.0
AWM16587.1\|1401016_1401994_+\|portal	phage portal protein	H7BV96	unidentified_phage	1.0e-39	32.6
AWM16588.1\|1401993_1402260_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	6.4e-05	37.5
AWM16589.1\|1402318_1402744_+	DUF2634 domain-containing protein	A0A0A8WFW6	Clostridium_phage	9.6e-11	34.7
AWM16590.1\|1402736_1403783_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.8e-74	44.9
AWM16591.1\|1403766_1404345_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	1.1e-14	33.8
AWM16592.1\|1404341_1404614_+	hypothetical protein	NA	NA	NA	NA
AWM16593.1\|1404616_1406107_+	hypothetical protein	M4ZRP1	Bacillus_phage	9.5e-21	59.4
AWM16594.1\|1406119_1406560_+	hypothetical protein	NA	NA	NA	NA
AWM16595.1\|1406549_1406741_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	4.3e-19	66.1
AWM19252.1\|1406812_1407082_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.3e-26	69.3
AWM16596.1\|1407094_1407358_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	3.6e-24	64.4
AWM16597.1\|1407370_1408264_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	2.9e-81	67.9

DBSCAN-SWA_4

1988221 : 1995009

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM17040.1\|1988221_1988614_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	3.8e-30	59.1
AWM17041.1\|1988573_1990676_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	87.0
AWM17042.1\|1990693_1991683_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	6.7e-156	84.1
AWM17043.1\|1991730_1992351_+	hypothetical protein	A0A127AYS1	Bacillus_phage	7.1e-47	48.4
AWM17044.1\|1992413_1993181_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.0e-51	49.1
AWM17045.1\|1994040_1995009_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.0e-52	40.5

DBSCAN-SWA_5

2254679 : 2261763

Bacillus_phage(100.0%)

integrase

attL 2251243:2251257|attR 2258089:2258103

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2251243:2251257	attL	NA	NA	NA	NA
AWM17211.1\|2254679_2255816_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	9.4e-45	34.9
AWM17212.1\|2257336_2257729_-	hypothetical protein	NA	NA	NA	NA
AWM17213.1\|2258017_2258245_+	transcriptional regulator	NA	NA	NA	NA
2258089:2258103	attR	NA	NA	NA	NA
AWM17214.1\|2258474_2258660_+	hypothetical protein	O64196	Bacillus_phage	5.6e-08	54.7
AWM17215.1\|2258898_2259180_-	hypothetical protein	A0A1P8CWV8	Bacillus_phage	2.8e-19	65.0
AWM17216.1\|2259409_2259754_-	hypothetical protein	NA	NA	NA	NA
AWM17217.1\|2259803_2260460_-	hypothetical protein	NA	NA	NA	NA
AWM19286.1\|2260570_2260882_-	hypothetical protein	NA	NA	NA	NA
AWM17218.1\|2260900_2261032_-	hypothetical protein	A0A1P8CWV9	Bacillus_phage	1.8e-13	86.0
AWM17219.1\|2261042_2261258_-	hypothetical protein	O64089	Bacillus_phage	9.7e-28	87.3
AWM17220.1\|2261261_2261513_-	hypothetical protein	A0A1P8CWV6	Bacillus_phage	5.1e-36	96.4
AWM19287.1\|2261622_2261763_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	2.4e-19	95.7

DBSCAN-SWA_6

2272713 : 2285757

Bacillus_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM17230.1\|2272713_2272896_+\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	2.0e-18	93.8
AWM17231.1\|2273027_2274158_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.9e-98	50.3
AWM17232.1\|2274611_2275079_-	hypothetical protein	NA	NA	NA	NA
AWM17233.1\|2275080_2275656_-	hypothetical protein	NA	NA	NA	NA
AWM17234.1\|2275876_2277127_-	UV damage repair protein UvrX	O64031	Bacillus_phage	1.8e-235	97.4
AWM17235.1\|2277119_2277452_-	YolD-like family protein	O64030	Bacillus_phage	5.5e-54	97.3
AWM17236.1\|2277625_2277961_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	8.3e-50	91.9
AWM17237.1\|2277999_2278359_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	3.1e-55	89.1
AWM17238.1\|2278364_2278832_-	DUF4879 domain-containing protein	O64027	Bacillus_phage	6.1e-75	91.0
AWM17239.1\|2279466_2279925_-	SMI1 / KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	7.0e-76	92.1
AWM17240.1\|2280030_2280609_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	7.7e-96	89.1
AWM17241.1\|2280664_2281123_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AWM17242.1\|2281132_2282935_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.5e-214	85.6
AWM17243.1\|2283034_2283592_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	3.7e-103	96.8
AWM17244.1\|2283612_2284599_-	HNH endonuclease	NA	NA	NA	NA
AWM17245.1\|2284866_2285757_+	endonuclease	O64020	Bacillus_phage	7.2e-109	91.9

DBSCAN-SWA_7

2506076 : 2512193

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM17469.1\|2506076_2506670_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
AWM19303.1\|2506659_2507415_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	7.2e-09	28.3
AWM17470.1\|2507716_2508241_+	DUF309 domain-containing protein	NA	NA	NA	NA
AWM17471.1\|2508254_2508629_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWM17472.1\|2508741_2509206_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AWM17473.1\|2509238_2510435_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-114	54.7
AWM17474.1\|2510449_2511097_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.4e-42	45.9
AWM17475.1\|2511107_2512193_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	8.6e-56	36.1

DBSCAN-SWA_8

2799048 : 2905091

117

Bacillus_phage(32.65%)

coat,tail,terminase,holin,tRNA,integrase,portal,head,plate,capsid,protease

attL 2842537:2842558|attR 2879487:2879508

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWM17763.1\|2799048_2799417_+\|coat	spore coat protein	NA	NA	NA	NA
AWM17764.1\|2799435_2800572_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	3.5e-15	25.6
AWM17765.1\|2800591_2800789_+	hypothetical protein	NA	NA	NA	NA
AWM17766.1\|2800804_2801104_+\|coat	spore coat protein	NA	NA	NA	NA
AWM17767.1\|2801280_2801559_-	HPr family phosphocarrier protein	NA	NA	NA	NA
AWM17768.1\|2801594_2802575_-	aldo/keto reductase	NA	NA	NA	NA
AWM17769.1\|2802740_2803643_+	AraC family transcriptional regulator	NA	NA	NA	NA
AWM17770.1\|2803820_2804234_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWM17771.1\|2804312_2804720_-	MerR family transcriptional regulator	NA	NA	NA	NA
AWM17772.1\|2804899_2805634_+	cupin domain-containing protein	NA	NA	NA	NA
AWM17773.1\|2805799_2806849_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.2e-70	42.4
AWM17774.1\|2806998_2807508_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
AWM19319.1\|2807607_2809611_-	levanase	S6ATV4	Bacillus_phage	6.0e-87	38.8
AWM17775.1\|2809800_2810628_-	fructose permease IID component	NA	NA	NA	NA
AWM17776.1\|2810649_2811459_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
AWM17777.1\|2811475_2811964_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
AWM17778.1\|2811963_2812404_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
AWM17779.1\|2812594_2815402_-	PRD domain-containing protein	NA	NA	NA	NA
AWM17780.1\|2815795_2816422_-	hypothetical protein	NA	NA	NA	NA
AWM17781.1\|2816793_2818182_+	amino acid permease	NA	NA	NA	NA
AWM17782.1\|2818274_2818907_-	hypothetical protein	NA	NA	NA	NA
AWM17783.1\|2819059_2819887_+	TrmB family transcriptional regulator	NA	NA	NA	NA
AWM17784.1\|2820090_2820591_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
AWM17785.1\|2820590_2821448_+	anti-sigma-V factor rsiV	NA	NA	NA	NA
AWM17786.1\|2821558_2823475_+	acetyltransferase	B5WZU0	Pseudomonas_phage	4.6e-44	34.6
AWM17787.1\|2823599_2823887_+	hypothetical protein	NA	NA	NA	NA
AWM17788.1\|2824167_2827329_-	cytochrome P450	V5UQK0	Mycobacterium_phage	2.2e-75	36.6
AWM19320.1\|2827344_2827935_-	TetR family transcriptional regulator	NA	NA	NA	NA
AWM17789.1\|2828159_2828702_-	methyltransferase domain-containing protein	NA	NA	NA	NA
AWM17790.1\|2829209_2829359_-	YrzI family small protein	NA	NA	NA	NA
AWM17791.1\|2829748_2830549_-	formate/nitrite transporter family protein	NA	NA	NA	NA
AWM17792.1\|2830811_2831180_-	DUF2294 domain-containing protein	NA	NA	NA	NA
AWM19321.1\|2831493_2834436_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
AWM17793.1\|2834454_2834937_+	DUF1641 domain-containing protein	NA	NA	NA	NA
AWM17794.1\|2834972_2835203_-	hypothetical protein	NA	NA	NA	NA
AWM17795.1\|2835285_2836425_-	bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase	A0A0B5JD48	Pandoravirus	2.7e-23	31.0
AWM17796.1\|2836426_2837350_-	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	4.2e-59	42.4
AWM17797.1\|2837412_2838108_-	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase	NA	NA	NA	NA
AWM17798.1\|2838128_2838770_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AWM17799.1\|2838961_2839165_+	DUF2536 domain-containing protein	NA	NA	NA	NA
AWM17800.1\|2839201_2839903_-	DUF1510 domain-containing protein	NA	NA	NA	NA
AWM17801.1\|2839967_2841722_-	penicillin-binding protein 2	NA	NA	NA	NA
AWM17802.1\|2841775_2842249_-	transcription elongation factor GreA	NA	NA	NA	NA
2842537:2842558	attL	NA	NA	NA	NA
AWM17803.1\|2842912_2843101_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	8.5e-12	55.0
AWM19322.1\|2843144_2843999_-	hypothetical protein	NA	NA	NA	NA
AWM17804.1\|2844057_2844237_-	hypothetical protein	NA	NA	NA	NA
AWM17805.1\|2844340_2845273_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	2.5e-96	76.6
AWM17806.1\|2845315_2845738_-\|holin	holin	D6R405	Bacillus_phage	1.3e-55	84.2
AWM17807.1\|2845788_2845989_-	XkdX family protein	Q9ZXD9	Bacillus_phage	1.7e-05	39.1
AWM17808.1\|2845989_2846355_-	hypothetical protein	O64053	Bacillus_phage	9.7e-20	55.7
AWM17809.1\|2846366_2848133_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	1.5e-57	48.4
AWM17810.1\|2848145_2850041_-	teichoic acid biosynthesis protein	A0A185AMX0	Staphylococcus_phage	2.1e-41	30.2
AWM17811.1\|2850051_2851926_-	autolysin	D6R400	Bacillus_phage	9.3e-50	27.6
AWM17812.1\|2851939_2852773_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	1.9e-34	34.8
AWM17813.1\|2852785_2856562_-	hypothetical protein	A0A2H4JA91	uncultured_Caudovirales_phage	2.9e-106	63.8
AWM17814.1\|2856624_2856807_-	hypothetical protein	NA	NA	NA	NA
AWM17815.1\|2856818_2857181_-	hypothetical protein	NA	NA	NA	NA
AWM17816.1\|2857238_2857820_-\|tail	major tail protein	J7KKC8	Streptococcus_phage	6.3e-29	40.1
AWM17817.1\|2857841_2858231_-	DUF3168 domain-containing protein	NA	NA	NA	NA
AWM17818.1\|2858227_2858620_-\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	8.8e-11	37.9
AWM17819.1\|2858619_2858946_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AWM17820.1\|2858935_2859229_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.0e-07	33.0
AWM17821.1\|2859283_2859691_-	collagen-like protein	D6R3Z0	Bacillus_phage	8.3e-12	53.0
AWM17822.1\|2859717_2860923_-\|capsid	phage major capsid protein	A0A2H4JFE3	uncultured_Caudovirales_phage	8.9e-78	49.7
AWM17823.1\|2860971_2861568_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	9.5e-49	53.3
AWM17824.1\|2861560_2862787_-\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	8.2e-71	39.0
AWM17825.1\|2862791_2862998_-	hypothetical protein	NA	NA	NA	NA
AWM17826.1\|2863014_2864748_-\|terminase	terminase large subunit	A0A2H4JCI4	uncultured_Caudovirales_phage	1.1e-145	49.5
AWM17827.1\|2864737_2865223_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	1.4e-18	37.9
AWM17828.1\|2865456_2865669_-	hypothetical protein	NA	NA	NA	NA
AWM17829.1\|2865671_2866055_-	HNH endonuclease	D2JLE2	Staphylococcus_phage	3.1e-08	33.3
AWM17830.1\|2866045_2866261_-	hypothetical protein	NA	NA	NA	NA
AWM17831.1\|2866402_2866720_-	hypothetical protein	NA	NA	NA	NA
AWM17832.1\|2867475_2868018_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	5.8e-61	63.9
AWM17833.1\|2868014_2868467_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
AWM17834.1\|2869224_2869971_-	hypothetical protein	A0A2H4J6H9	uncultured_Caudovirales_phage	5.9e-96	72.3
AWM17835.1\|2870051_2870861_-	DNA adenine methylase	U5P0W8	Brevibacillus_phage	6.8e-90	59.0
AWM17836.1\|2870864_2871122_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	1.6e-05	42.9
AWM17837.1\|2871118_2871349_-	hypothetical protein	J9PL10	Bacillus_phage	1.0e-11	44.2
AWM17838.1\|2871345_2871723_-	hypothetical protein	NA	NA	NA	NA
AWM17839.1\|2871765_2871963_-	hypothetical protein	NA	NA	NA	NA
AWM17840.1\|2872204_2872345_-	BH0509 family protein	NA	NA	NA	NA
AWM17841.1\|2872452_2872998_-	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	7.7e-05	40.4
AWM17842.1\|2873312_2874143_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	6.4e-35	35.1
AWM17843.1\|2874126_2874999_-	replication protein	V9QKF6	Oenococcus_phage	4.5e-47	41.4
AWM17844.1\|2874991_2875210_-	hypothetical protein	NA	NA	NA	NA
AWM17845.1\|2875211_2875541_-	hypothetical protein	NA	NA	NA	NA
AWM17846.1\|2875581_2875779_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWM17847.1\|2875982_2876372_+	XRE family transcriptional regulator	A0A0U4B088	Bacillus_phage	2.9e-06	30.5
AWM17848.1\|2876745_2877927_-	XRE family transcriptional regulator	Q2I8D6	Bacillus_phage	2.2e-12	26.8
AWM17849.1\|2878229_2879387_+\|integrase	site-specific integrase	S6C485	Thermus_phage	7.0e-64	36.1
AWM17850.1\|2879449_2880085_-	uridine kinase	A0A1V0SAA3	Catovirus	3.2e-34	38.7
2879487:2879508	attR	NA	NA	NA	NA
AWM17851.1\|2880090_2881359_-\|protease	collagenase-like protease	Q6DW11	Phage_TP	1.2e-37	31.8
AWM17852.1\|2881377_2882307_-	U32 family peptidase	NA	NA	NA	NA
AWM17853.1\|2882312_2882966_-	SAM-dependent methyltransferase	W8CYT3	Bacillus_phage	5.4e-05	31.7
AWM19323.1\|2883117_2884224_-	endolytic transglycosylase MltG	NA	NA	NA	NA
AWM17854.1\|2884335_2884617_-	DUF1292 domain-containing protein	NA	NA	NA	NA
AWM17855.1\|2884634_2885051_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
AWM17856.1\|2885058_2885325_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
AWM17857.1\|2885409_2888046_-\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	6.3e-68	34.5
AWM17858.1\|2888379_2889441_-	AI-2E family transporter	NA	NA	NA	NA
AWM17859.1\|2889639_2890368_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-36	41.6
AWM17860.1\|2890389_2891211_+	amino acid ABC transporter substrate-binding protein	E3T502	Cafeteria_roenbergensis_virus	8.9e-05	26.4
AWM17861.1\|2891271_2891922_+	amino acid ABC transporter permease	NA	NA	NA	NA
AWM17862.1\|2891938_2892595_+	amino acid ABC transporter permease	NA	NA	NA	NA
AWM17863.1\|2892630_2892762_-	DUF3918 domain-containing protein	NA	NA	NA	NA
AWM17864.1\|2892783_2892975_-	hypothetical protein	NA	NA	NA	NA
AWM17865.1\|2892986_2893511_-	hypothetical protein	NA	NA	NA	NA
AWM17866.1\|2893567_2895964_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	6.5e-80	29.4
AWM17867.1\|2895988_2896657_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AWM17868.1\|2896694_2897810_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AWM17869.1\|2897837_2898980_-	cysteine desulfurase	NA	NA	NA	NA
AWM19324.1\|2898998_2899415_-	transcriptional regulator	NA	NA	NA	NA
AWM17870.1\|2899616_2900882_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.8e-113	53.5
AWM17871.1\|2900923_2901688_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	A0A291ATS8	Pandoravirus	2.7e-19	31.6
AWM17872.1\|2902024_2903803_-\|tRNA	aspartate--tRNA ligase	K7Y9W2	Megavirus	7.1e-07	33.6
AWM17873.1\|2903816_2905091_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_9

3948592 : 3972133