CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP021413	Leptospira borgpetersenii serovar Hardjo-bovis strain 203 chromosome II, complete sequence	0 crisprs	csa3	0	0	1	0
CP021412	Leptospira borgpetersenii serovar Hardjo-bovis strain 203 chromosome I, complete sequence	1 crisprs	WYL,cas3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,RT,csa3,DinG,Cas9_archaeal	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

150512 : 216415

Pseudomonas_phage(28.57%)

protease,tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV71880.1\|150512_152915_-\|protease	cysteine protease	NA	NA	NA	NA
AWV71881.1\|153558_154197_-	energy transducer TonB	NA	NA	NA	NA
AWV71882.1\|154215_154620_-	biopolymer transporter ExbD	NA	NA	NA	NA
AWV71883.1\|154642_155257_-	TolQ transporter	NA	NA	NA	NA
AWV71884.1\|155844_158448_-	TonB-dependent receptor	NA	NA	NA	NA
AWV71885.1\|158458_158866_-	hypothetical protein	NA	NA	NA	NA
AWV71886.1\|158867_159401_-	hypothetical protein	NA	NA	NA	NA
AWV71887.1\|159372_159750_-	hypothetical protein	NA	NA	NA	NA
AWV71888.1\|160305_161358_-	methylmalonyl Co-A mutase-associated GTPase MeaB	NA	NA	NA	NA
AWV71889.1\|161365_163564_-	methylmalonyl-CoA mutase	NA	NA	NA	NA
AWV71890.1\|163560_165441_-	methylmalonyl-CoA mutase	NA	NA	NA	NA
AWV71891.1\|165531_166521_-	tellurium resistance protein TerC	K7QKE8	Escherichia_phage	1.1e-36	35.5
AWV71892.1\|166609_167239_+	lysoplasmalogenase	NA	NA	NA	NA
AWV71893.1\|167297_168197_+	rubrerythrin	NA	NA	NA	NA
AWV71894.1\|168196_169354_+	aminotransferase	A0A2K9L2Y3	Tupanvirus	1.1e-24	26.1
AWV71895.1\|173293_174679_+	hypothetical protein	NA	NA	NA	NA
AWV71896.1\|174722_176114_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AWV71897.1\|176096_178196_-	hypothetical protein	NA	NA	NA	NA
AWV71898.1\|178303_178762_-	molecular chaperone DnaK	NA	NA	NA	NA
AWV71899.1\|178779_178944_-	50S ribosomal protein L33	NA	NA	NA	NA
AWV71900.1\|180112_181207_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV71901.1\|181448_181745_+	hypothetical protein	NA	NA	NA	NA
AWV71902.1\|182165_182900_-	dimethylmenaquinone methyltransferase	NA	NA	NA	NA
AWV71903.1\|183301_183817_+	flagellar motor protein MotA	NA	NA	NA	NA
AWV71904.1\|183830_184247_+	biopolymer transporter ExbD	NA	NA	NA	NA
AWV71905.1\|184243_184588_-	pyrophosphatase	NA	NA	NA	NA
AWV71906.1\|184584_185655_-	hypothetical protein	NA	NA	NA	NA
AWV71907.1\|185664_187062_-	membrane-bound O-acyltransferase family protein	A0A125RNP0	Pseudomonas_phage	3.2e-63	36.2
AWV71908.1\|187058_188219_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
AWV71909.1\|188232_189648_-	membrane-bound O-acyltransferase family protein	A0A125RNP0	Pseudomonas_phage	6.0e-57	32.2
AWV71910.1\|189719_191102_-	hypothetical protein	NA	NA	NA	NA
AWV71911.1\|191322_191925_-	hypothetical protein	NA	NA	NA	NA
AWV71912.1\|191935_193072_-	glycosyl transferase	NA	NA	NA	NA
AWV71913.1\|193046_194645_-	hypothetical protein	NA	NA	NA	NA
AWV71914.1\|194649_195693_+\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AWV71915.1\|195790_197413_+\|protease	ATP-dependent protease	NA	NA	NA	NA
AWV71916.1\|197690_199073_+	hypothetical protein	NA	NA	NA	NA
AWV71917.1\|199193_199499_+	nucleoid-associated protein, YbaB/EbfC family	NA	NA	NA	NA
AWV71918.1\|199623_199851_-	hypothetical protein	NA	NA	NA	NA
AWV71919.1\|200168_200909_+	hypothetical protein	NA	NA	NA	NA
AWV72015.1\|200921_201656_-	hypothetical protein	NA	NA	NA	NA
AWV71920.1\|201937_202528_+	hypothetical protein	NA	NA	NA	NA
AWV71921.1\|202541_203234_+	heme-binding protein HmuY	NA	NA	NA	NA
AWV71922.1\|203238_205332_+	TonB-dependent receptor	NA	NA	NA	NA
AWV71923.1\|205732_206929_-	MFS transporter	NA	NA	NA	NA
AWV71924.1\|206930_207608_-	heme oxygenase (biliverdin-producing)	M4QDD1	Prochlorococcus_phage	2.9e-41	43.8
AWV71925.1\|208118_209693_+	hypothetical protein	NA	NA	NA	NA
AWV71926.1\|209692_210937_+	hypothetical protein	NA	NA	NA	NA
AWV71927.1\|211657_213241_-	PDZ domain-containing protein	NA	NA	NA	NA
AWV72016.1\|213255_214764_-\|protease	serine protease	A0A1V0CPG8	Kaumoebavirus	3.1e-19	24.3
AWV71928.1\|214794_215328_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.6e-29	44.5
AWV71929.1\|215527_216415_-\|protease	protease HtpX	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP021412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP021412_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP021412_1

2031667-2031741

Orphan

Consensus_repeat	Method
GCGGAGCGTTTAAAATTTGTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP021412_1

>merge|CP021412|1|2031667-2031741|CRISPRCasFinder
GCGGAGCGTTTAAAATTTGTCTTTCAACACGTTAGTTGAAAAATAGAGCGAAGCGGAGCGTTTAAAATTTGATCT

>CP021412|1|1|2031667-2031741|CRISPRCasFinder
GCGGAGCGTTTAAAATTTGTCTT	TCAACACGTTAGTTGAAAAATAGAGCGAA
GCGGAGCGTTTAAAATTTGATCT

Protein	Signature genes	Signature genes Name	Protein_function
CP021412.1\|AWV70345.1\|2018390_2020022_+\|hypothetical-protein	unknown	unknown	unknown
CP021412.1\|AWV70361.1\|2045702_2046260_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379590
CP021412.1\|AWV70355.1\|2033112_2036427_-\|CusA/CzcA-family-heavy-metal-efflux-RND-transporter	unknown	unknown	gnl\|CDD\|226220
CP021412.1\|AWV70354.1\|2032781_2033090_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP021412.1\|AWV70356.1\|2036423_2037176_-\|hypothetical-protein	unknown	unknown	unknown
CP021412.1\|AWV71663.1\|2024849_2025236_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|260011
CP021412.1\|AWV70358.1\|2040748_2043457_-\|preprotein-translocase-subunit-SecA	unknown	unknown	gnl\|CDD\|237259
CP021412.1\|AWV70353.1\|2030496_2031630_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|133022
CP021412.1\|AWV70360.1\|2045146_2045728_-\|hypothetical-protein	unknown	unknown	unknown
CP021412.1\|AWV70347.1\|2024482_2024830_-\|hypothetical-protein	unknown	unknown	unknown
CP021412.1\|AWV70349.1\|2025675_2026443_+\|arginyltransferase	unknown	unknown	gnl\|CDD\|234939
CP021412.1\|AWV70352.1\|2029008_2030478_+\|dolichyl-phosphate-mannose--protein-mannosyltransferase	unknown	unknown	gnl\|CDD\|227621
CP021412.1\|AWV70346.1\|2023191_2024490_-\|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme	unknown	unknown	gnl\|CDD\|237339
CP021412.1\|AWV70359.1\|2043587_2044340_-\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153212
CP021412.1\|AWV71664.1\|2039723_2040101_-\|hypothetical-protein	unknown	unknown	unknown
CP021412.1\|AWV70350.1\|2026733_2027474_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|180838
CP021412.1\|AWV71665.1\|2044336_2044975_-\|redoxin	unknown	unknown	gnl\|CDD\|239264
CP021412.1\|AWV70357.1\|2038175_2039573_-\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
CP021412.1\|AWV70351.1\|2027503_2029000_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
CP021412.1\|AWV70348.1\|2025235_2025553_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP021412.1\|AWV70361.1\|2045702_2046260_-\|hypothetical-protein	gnl\|CDD\|379590	pfam14385, DUF4416, Domain of unknown function (DUF4416). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 176 and 187 amino acids in length. There is a conserved DPG sequence motif.	5.24303e-47
CP021412.1\|AWV70355.1\|2033112_2036427_-\|CusA/CzcA-family-heavy-metal-efflux-RND-transporter	gnl\|CDD\|226220	COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism].	0
CP021412.1\|AWV70354.1\|2032781_2033090_+\|transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.45533e-09
CP021412.1\|AWV71663.1\|2024849_2025236_-\|ribonuclease-HI	gnl\|CDD\|260011	cd09279, RNase_HI_like, RNAse HI family that includes archaeal, some bacterial as well as plant RNase HI. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties.	6.2147e-54
CP021412.1\|AWV70358.1\|2040748_2043457_-\|preprotein-translocase-subunit-SecA	gnl\|CDD\|237259	PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed.	0
CP021412.1\|AWV70353.1\|2030496_2031630_+\|glycosyl-transferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	3.17174e-47
CP021412.1\|AWV70349.1\|2025675_2026443_+\|arginyltransferase	gnl\|CDD\|234939	PRK01305, PRK01305, arginyl-tRNA-protein transferase; Provisional.	1.19805e-87
CP021412.1\|AWV70352.1\|2029008_2030478_+\|dolichyl-phosphate-mannose--protein-mannosyltransferase	gnl\|CDD\|227621	COG5305, COG5305, Predicted membrane protein [Function unknown].	1.23534e-12
CP021412.1\|AWV70346.1\|2023191_2024490_-\|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme	gnl\|CDD\|237339	PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisional.	6.74956e-86
CP021412.1\|AWV70359.1\|2043587_2044340_-\|glutamine-amidotransferase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	1.94945e-44
CP021412.1\|AWV70350.1\|2026733_2027474_+\|short-chain-dehydrogenase	gnl\|CDD\|180838	PRK07102, PRK07102, SDR family oxidoreductase.	4.3732e-64
CP021412.1\|AWV70357.1\|2038175_2039573_-\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	1.42612e-18
CP021412.1\|AWV70351.1\|2027503_2029000_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.138e-44
CP021412.1\|AWV71665.1\|2044336_2044975_-\|redoxin	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.83386e-10

>CP021412.1|AWV70353.1|2030496_2031630_+|glycosyl-transferase
MKKKNVTYVIPCLNEEKTLPLVLEKLARLKKELKQYNVEILVSDNGSEDKSISIAKKYGAKVVHCEERGYGAALNFGIKNASGEIVLFADADDTYDFLESPALLAEMEKGAEFVIGSRLDGSIHKGAMPFLHRYLGTPVINWIINLLYSKKGNRVKDANSGFRCFLKKKFLEWEIESTGMEFASEMLVKALRSGVKLSHVPISLYPDVEGRVPHLRTWRDGMRHLLQILIHSQQLFYYTGLILFWIGWAFTILGYFTGIVAIGPFHIFGIHSLTVFLLVATFGQTIWAIGLFLAARKTPELSFYSRLNLLSEDLLFWYSARMILFVILLFAFILFRWWKNSFQVLDLEKEILMISFLSVQILNLIGQTITAHLLKRT
>CP021412.1|AWV70352.1|2029008_2030478_+|dolichyl-phosphate-mannose--protein-mannosyltransferase
MNRLNALLIEIKKDKVFLFLLGLGAFFRFFRLDLQSPWEDELFSIRASSETSFGNLWDWMKNDPHPPLYQTLLYFWFQLFQPTVFVGRLFSAIAGILVPFSFYLLSPHNLSGRIKTSVVVFLSLSTGLIYYSQELRSYSLLVLFSTIQLAILLKSVYENRKEKNLRIYWSLLGISLLASYTHFFGFIWSASIFLGIFITKWIFTKKFPKVEFYFGILFGILFIPVLYLLFNSDKIGIASWIPEAGFTAFLVFFDLIFHSGILKKFIPGIVASLALLAGFVSIYFPKNQMKTVALEPDHKKFVILLGIVFLIFSVVLGILSLIQPLITARNLLVTAPALYFLITTSFSLFPIYKGKRLESILILISIVSLYYFTRFYYKPFKEQWRESSQYIISTIQDRPLEFTLLCSSHTYNMEYFLKTAKIQGVVPKIYTKKEANLFVQDPTKKDLVILETSWKYLNSEDLDSLFAQKIFDRKDQLFYGMRVITIRKR
>CP021412.1|AWV70351.1|2027503_2029000_+|FAD-binding-oxidoreductase
MAKASKVSPKKKTSAKTSKTAKVKKSPIEITLPLPSKVETWGMNHYSLSPVFFPEKEEDFRDLFSYANNKGLKLTLRGGGCSYGDAATNTKGVVIDISKYNRILEFNSKTGIIKAESGVTIKQLWEFGIEKGYWPPVVSGTMFPTLGGALSMNIHGKNNFAVGSIGDHVLEFTFMTPNGKVFVCSRKKNRELFFAAISGFGMLGVFLNITIQLKAIYAGKMKVWPVVGKNLQDMFDYFEREYKSADYLVGWIDAFASGNSLGRGQIHKAVHLKKGEDPDFPENCKLERQNLPSTFLGIIPKSWMWLFMIPFANNLGMRLVNFAKFVSGYLTNNKPYFQGHAEYAFLLDYVPNWKLMYKPGSMIQYQSFIPKENAVDAFCEILKICQKRRIVTWLAVFKKHKSDPFLLTHALDGYSMAMDFPVTFGNRKRLWELAGELDEIVLKFGGKFYFAKDSTLRPETVQRAFPKKNLEKFYSLKRKLDPKGILETDLYRRITGTW
>CP021412.1|AWV70350.1|2026733_2027474_+|short-chain-dehydrogenase
MAKKIVVVGASSGIGKELAILLLEQGHTVTLVARRDKELKAIAAPFNSPGKTNAFVIKQDVTNFDQVDSAFQKAVKSMKGVDEIYYASGIMYDVKPDEFDVTKDIAMLNTNLLGCVAWLNLAAVLFQKQKSGKIIGISSIAGDRGRRGNPVYNTSKAGMNTYLEALRNRLSTLGVQVLTVKPGFIDTAMTRGMKGLFWLISAKEAATIIVKAADSGKECVYVPARWGLVGLIIRLIPSFLFKRLSI
>CP021412.1|AWV70349.1|2025675_2026443_+|arginyltransferase
MIRHKLQNFVNSLPISPERSCSYYPDRLSQIQYLPLQGKIEKDNLQFFFDSGFRRTGNILYRTSCNACRECLSYRVPLNQFVPSRNRKRLLKKNSDLVVRFGSPHLTVEKEILYLRYQRSRYQSFVIGESDQELLEGMRWNLFGYPENSLEMTLSLDEKILGFMILDSASDSLSAVYSVYDPDYPDRSLGSFAILYSILYAKELGMKYYHLGYFLPGHPDMDYKKHWVPSEIRELDTNDWIPFEEFQKKYADFSW
>CP021412.1|AWV70348.1|2025235_2025553_-|hypothetical-protein
MHNLFTNFEVKKRGLRVALFFTIVSLICFLIENTILQFIFLGLGFVSFAFTLVQPEIFYSFTNRSLEFVLVFLSGIVKVGLLLIYLIVFKPIRFVIGLFLREKKS
>CP021412.1|AWV71663.1|2024849_2025236_-|ribonuclease-HI
MSIFCDGASKGNPGPSSIGVVAYKGDKEEFRISERIGETTNNVAEWASLKKGLEECIRRKFDTIHAYMDSELVVKQVSGKYKVKHPNLLEYKKEVDKLLSSLQNFQITHVPREKNSVADKLANEAFQK
>CP021412.1|AWV70347.1|2024482_2024830_-|hypothetical-protein
MWRISFYVFLFYTASNCGRSLEDKLVVLQKEEKFEEMLLLCLSEKETQDTKELCRLAMEKTEAGIDRILSEKTELPYSQITVDPEWKKKIDIILENNRTLKNRYGNLWKKMIQND
>CP021412.1|AWV70346.1|2023191_2024490_-|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme
MTNVDPDELIKKIPENFREDIIRITQNIRKEGGECYLIGGSVRDLLLSKIPDEFDLTTSLLPDKILTLFKRTVPTGIKHGTVTVLIQDRSYEITTFRKDVDYIDGRRPEAVEFGVSLSEDLKRRDFTMNALALDLEAKRLIDEHSGLEDIQNKIIRTIGDPIERFTEDGLRPIRAIRFVSSLGFALESETAKAIIQCRNITAKISKERVHDELNKTLKSKNPAPSLKLFKEFRILELFTSLKLYPTENTNVEKKIREVPVVPLSLRLSFLHAWLFGSFQDRNSAKQFMKDLRYSNQNTKDSLFFSDMLFMMLNRKDDASLTDAEIRKAVLHPICVYAGRENLRILTEYILNLAYTYEPILKDIFDFRRILDLTERSQALVVTELALRGEDILRACPNLPPKQIGSVLEKLLFHVLENPDENRKDFLFPLLFK
>CP021412.1|AWV70345.1|2018390_2020022_+|hypothetical-protein
MFNRLIFSPYFRYFIYLFAVLFLIFNRFKLDDKVPFVSSDSEIKYYQTIMFFEKGFKAVAESECLYPGKIYDPEFRYFPFDYPWAFLKENENRKCIFQYPPLFALLNGIPAYFFGAKIITLLPLLYLFGCLLIFDKILSLFIDKTWVILIGTLVPFTLSFPALSSVEFSEVPLNNFLLLSFGYFLIRSLFADKITVQNKNLNSNFRIFSFISGFLAVTAFFLRTESAFPIFLFGFLAFFSQKTRNNLKEYLIFSVPGGVLSFGFIGVLNFFYSGHPMGIRFLVSSQDAMSQFSIGKQIVILEGYLLGDATKSGFLKASPYAILIFGIFSDLIRKKELSGGSILGLVGIGTLFSISFFSPYTAGVHHFGLRYLESGFVFLSAGILIFLYQRNIEFPNIGRVLILLTFLSLYYNYKFTREGFKILFGSIAPYLQIQNEFQSKRIIVHKGQFTNYLIGYSYLNSLHFTVYTEKDAIQLEQTFKKNRVDSYSILEYEPEPPKDPNLPEKQFKEKIAVRFPDPNRYYRVKDQKKILNFSLRTYQLYKN
>CP021412.1|AWV70354.1|2032781_2033090_+|transcriptional-regulator
MFKSLHSREAKIFCKNLIAARKSADLTQLEIAKRLGEPQSYISKIESGERRLDVIEFWRIYKILGKSFEFYFQFDEKPEGSEKRSKTLKAASGKRKKKRSKF
>CP021412.1|AWV70355.1|2033112_2036427_-|CusA/CzcA-family-heavy-metal-efflux-RND-transporter
MIRGLIEGVLRFRLATLIASAAAIVFGIWAWIDIRKEAYSDIADTQVRLIAKFPGKAAVEVEERVTIPIERVLNAIPKVSVRRSRTINGLVVFQFVFEDGTDDYFARTRLLERVRDADIPAEIQPTLGPMSSPVGEIFRYVVETKANHTPMELRTIQDWVIMPKMLGIPGIADVVTFGGLPKQYHVVTTPDKLIRYRLTIDDVIKAIQQNNLNTGGNLLLQGEQGFPIRSLGAIRDPKHIENIVVKTVNGVPVFIRDLGTVEISHPIPSGVLGYTVQNDQEGLIDVDSSVQGLVAIRRWGDPNIMGDRIRDKVKEINENYLPEGVQIRTTYDRTDLVNYTLRTIGKTLVEGVVVVSLVLIFFIGSIKASMVVVATIPFAMLFAFLLMNITGIPASLLSLGAIDFGIIVDGAVVMVENVMRRYRDASPVDKKKGIIRFTVDAASEVGTEIIFSILIIVLAYLPIFSFERIEGRLLKPMAFTISFAILGALIFSMTAIPVMMSYIYRNYFESPNPGPIEWHNPFYEWLEKKYERLIEWLVDRSKRVVTICFSVVGTLLVLGGLSLGTEFLPEMDEGGFNLRIFFPVGISLPESRKFIPKIRQIIYKNEQVNVVLSQLGRNDDGTDPLPPNRLEVLVGLKDYDDWKEKITKTELLLRMRNDLEAGLPGARVSFSQPIMDNLSEAIMGTIADLAVFVSGNDLKVMRQISTEILDIVKEMKGASEYGIEQEADSPQLTVRIDREAAARFGINVSDIQQMVEAAIGMQRIDTLYEGPSDIPPKTPARFGIVVRFSKDYRTSQRAIENMPIISPKGERIPLSELAKVTLEDGPTMIFRQEGRRTVTVRTNIRGRDQGGFVAELRKLVDKKVKLPEGYEVRYGGQYENLARVGTRLAMVIPLTIAIIFGVLYLLYKNLKYVYVALACIPLSLVGGIYALLMRGYYFNVSGGVGFISLFGIATMAGVLFVSRTNHLLHEDDEISVKEAVKKAAVIQLRPMLMTMLLALLGLIPATLASGVGSDVQRPLATVIVGGLFSALFLVLTVLPSLYLILVGEREYVPKKQKDLEPYSYLDQYPLEEYESKEFDLSTETKKTISKKKQKSSGSKKKKKE
>CP021412.1|AWV70356.1|2036423_2037176_-|hypothetical-protein
MKQFKFLVLLILLGFLNVSILAQSQNPKYDSNSKDDSSPEWTDDPDRKTKFGKEEEGGDILKGKPLPKSTNFLVYGVSIGSPGSINLNLGYYYKDVVVRISGGKWNPHWWGGQVDIGYNFWKTPVIAHSISLVFGRFEVDPFEAELGRGGQTRYPSGSSFPGYTHRDPTYEDLIIRSYVTEQSPELALYLERESRDRQKVHLNQQYVGLTYDFLLGNFFLQVGGGIGKGDYKNPQLLIQVGYLFDTRSAE
>CP021412.1|AWV70357.1|2038175_2039573_-|TolC-family-protein
MRKIFTFLLLLWMVPILSEGGKTGADPGLGIPESPNQSENPIQREVVATPDKERTLDLKTAEEKLWKNNLLLLASRFNIDARKAGIEQAGLYANPNIFIDQSIYAEPTQRYFDFTRSGQTVVQIQQLFLLGGKIGKRVRVAELNARMGEQEFYDLARELVTKLRKLFYAIYYYRQAISFYDQSLEALGRTVTSAEMGYKRRAILQAEVLRLKALYFFLKKEREELNIRILEREADLRVLLNDDSFRSSDVKIVPMIVENQLDNLEPGKLKRDELLELARNKRPDLKKAIQALRYEEANLELQHANAIPDLAFGPMYNRGGTAFQNYWGITAQLNIPIFDRNQGNIKASEKAILSRKQELKNTLLEVENEVAVSIETARLKDELYKKFRNTYTKEYTDLSKDMILSYEKRYITISEFTDFFETYCSSVVEMLKLQTDRMDAIEGVNFSVGQGVLIPKFSDPVTEEK
>CP021412.1|AWV71664.1|2039723_2040101_-|hypothetical-protein
MKVRWIHRFLILVLTTVIVLPCEEDGTFDLAFLDVRGGEIHFALAKKIQNQSHRKTRSEIQSGIEARDLVVCLRGRYDFLDLVFSGFFELSKTEVHFFSGKFSAPKTHFSYLLSSLLLNLPPPTA
>CP021412.1|AWV70358.1|2040748_2043457_-|preprotein-translocase-subunit-SecA
MIQNILRVILGSKFERDLKKLIPIVGQINSLEKEMKETSDSLLSSQTQKFRERIARGESLDSILPEAFATVREVSLRTMGMRHFDVQMMGGIALHRGNIAEMKTGEGKTLTSTLAVYLNSLAGKGVHVVTVNDYLAKRDANWMKPIYDFLGISVGVIQHDMDHEQRKIAYSADITYGTNNEFGFDYLRDNMVSHKDHKVQRSHFFAIVDEVDSILIDEARTPLIISGSSDETTDKYVRINKIIPKLVAIEDFEVDEKARNVLLSEKGVSHVEEILGIENLYAPENVDLVHHVHQALKAHKIFQKDVDYVVQNGEVIIVDEFTGRLMAGRRYSDGLHQALEAKESVTIAKESQTLASITFQNYFRMYDKLAGMTGTADTEAEEFRKIYDLDVIVIPPNVSVRRKDSPDRVYRTEKEKFDAILAEIRELQSKKQPVLVGTISIEKSEILSKMLSSAGIQHNVLNAKFHEREAEIVANAGKPGAVTIATNMAGRGTDIVLGGAQLYKENLETWKDDDDLVRRFKESILKQELDNAELLIREMDSSVKQKRASEILESVKIWKKNHEDVLVAGGLHILGTERHEARRIDNQLRGRSGRQGDPGSSRFYLSLQDDLMRIFGSDRISGLMKWANMPEGQEIESKMVSNAIARAQKRVEGHNFDIRKHLLEYDDVMNRQRIVIYKMRNEVLENEDISSLILSFIEEAVENQIVAHCEGNNPSSWNLDSLKEWLEGLELNLEINEEDFKKTKNPQLALFEKVNAAAKQKYEDRAESIGKDIWKLLERNIFLDILDHRWKEHLYSMDHLREGIWTVGYSERNPLVEYKLQGFRMFDVAIENLKNEVVNFLFRVEVSENSKLPEERREYKKVGQEVTGGFQELSSGTPSPTVTVTTSSGGGTERKTSRRRKR
>CP021412.1|AWV70359.1|2043587_2044340_-|glutamine-amidotransferase
MRSLIVRFKDCEGPGILLDSLKERNYKITYHNAYDSRVRPFPDAHLVFDLVVLLGGPQSVTDPTLVPFFEPWLNLVRYTASMPNRKVIGICLGAQIISKALGGEVRRGEKGPEVGFYDVQVQEPTHLVFDGITSFPAFHLHEDIFSIPQRAKHLLKSEMYSNQMFSFQDRIFGIQCHMEVTASMLKVWRVVHSDFIRSWVPGPDTEILRSQMENVGRRVFAAILDLTPDSTVDRSAFIPQSPDFVAAENG
>CP021412.1|AWV71665.1|2044336_2044975_-|redoxin
MNSEPHFRIISSFFLGSYIYLMNRILLCFVFCILTVHCTLSEQPNLGIYEFQGITLDGTLVRLSEVEAPRLVLNVYGPNCVPCIKEIPALNYLYQDMQKDPKIQFYMAVDPTLFFDEAETMSEEELLTKGIFLVKEEIRKYGIQVPTLLMKKPFRVSRTGSIVTGTPETLLFKTKPFVLYYNFIGPISEEENPQRLSVDQKVLFFKRMAGSS
>CP021412.1|AWV70360.1|2045146_2045728_-|hypothetical-protein
MFRISVKHNIVPFAFLFHLLSFSGACVPVQLEITSVTLCDHFNRSGECLEPVEKDHHYKVEIPHIKKPDTWEKFANYLYFHARETPGFLIRFNRKLTPSESRAIQDSYYATMSFSGTVERMEGFEIGEDWIGSFQYLGSIIKNKLKKENRLGSYPYTNMIFPAEVEFKFDSSLFEGGEKTKINLSYIVLPPEK
>CP021412.1|AWV70361.1|2045702_2046260_-|hypothetical-protein
MDSSKKNTPIKGKLAKPPGASFFIVVVYENAEIFYSIKTKTEKKFSATLYESNSMPAWKDPEEELWNQSPGRHTKILSFKRRIHREELPSIQKECLSIQNAAIERDRGVRIFPGYLCNHSVVISSIQDDFHRIYLFNGVYAETVYNYQKQKMVYRETAPSFFKTTEAVYFFTSLRESYVQNISKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP021412_1	1.1\|2031690\|29\|CP021412\|CRISPRCasFinder	2031690-2031718	29	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	43605-43633	8	0.724
CP021412_1	1.1\|2031690\|29\|CP021412\|CRISPRCasFinder	2031690-2031718	29	NC_018487	Bacillus thuringiensis HD-771 plasmid p03, complete sequence	38173-38201	8	0.724

1. spacer 1.1|2031690|29|CP021412|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 8, identity: 0.724

tcaacacgttagttgaaaaatagagcgaa	CRISPR spacer
acaacacgttagttgaagaatacggttct	Protospacer
 ****************.**** .*.

2. spacer 1.1|2031690|29|CP021412|CRISPRCasFinder matches to NC_018487 (Bacillus thuringiensis HD-771 plasmid p03, complete sequence) position: , mismatch: 8, identity: 0.724

tcaacacgttagttgaaaaatagagcgaa	CRISPR spacer
acaacacgttagttgaagaatacggttct	Protospacer
 ****************.**** .*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13862 : 80459

Lake_Baikal_phage(14.29%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV68790.1\|13862_14819_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AWV68791.1\|15701_16265_-	lipoprotein LipL21	NA	NA	NA	NA
AWV68792.1\|16404_17961_+	hypothetical protein	NA	NA	NA	NA
AWV68793.1\|17983_18877_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AWV68794.1\|18818_19907_-	DNA polymerase III subunit delta	NA	NA	NA	NA
AWV68795.1\|19993_20209_+	hypothetical protein	NA	NA	NA	NA
AWV68796.1\|20644_21739_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV68797.1\|22057_24292_-	adenylate/guanylate cyclase domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	3.0e-10	25.2
AWV68798.1\|24357_25371_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AWV68799.1\|25574_25823_-	hypothetical protein	NA	NA	NA	NA
AWV68800.1\|26132_26489_+	ArsC family transcriptional regulator	M1PLC0	Streptococcus_phage	9.5e-20	52.6
AWV68801.1\|28305_29400_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV71511.1\|30398_31667_+	hypothetical protein	NA	NA	NA	NA
AWV71512.1\|31730_32417_+	hypothetical protein	NA	NA	NA	NA
AWV68802.1\|32531_34016_+	hypothetical protein	NA	NA	NA	NA
AWV68803.1\|34025_35069_+	hypothetical protein	NA	NA	NA	NA
AWV68804.1\|35065_35944_+	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
AWV68805.1\|36216_38034_-	DUF885 domain-containing protein	NA	NA	NA	NA
AWV71513.1\|38787_39315_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
AWV68806.1\|39329_40550_-	protein-disulfide isomerase	NA	NA	NA	NA
AWV68807.1\|40639_41365_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
AWV68808.1\|41361_41994_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
AWV68809.1\|41990_42572_-	imidazoleglycerol-phosphate dehydratase	NA	NA	NA	NA
AWV68810.1\|43220_43451_-	hypothetical protein	NA	NA	NA	NA
AWV68811.1\|44239_44905_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AWV68812.1\|45348_45783_+	NUDIX hydrolase	NA	NA	NA	NA
AWV68813.1\|45788_46838_+	hypothetical protein	NA	NA	NA	NA
AWV68814.1\|47470_48631_-	hypothetical protein	NA	NA	NA	NA
AWV68815.1\|48875_49481_-	hypothetical protein	NA	NA	NA	NA
AWV68816.1\|49521_50586_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	9.5e-07	45.2
AWV68817.1\|50650_52144_+	Cys/Met metabolism PLP-dependent enzyme	NA	NA	NA	NA
AWV68818.1\|55004_56741_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	2.9e-37	29.1
AWV68819.1\|57392_58052_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AWV68820.1\|58572_60624_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	2.2e-12	22.0
AWV68821.1\|60762_61002_+	hypothetical protein	NA	NA	NA	NA
AWV68822.1\|61251_62346_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV68823.1\|62823_63180_-	hypothetical protein	A0A142LP25	Marinitoga_camini_virus	9.8e-25	56.8
AWV68824.1\|63182_63296_-	hypothetical protein	NA	NA	NA	NA
AWV68825.1\|64472_65726_-	TrmA/RlmC/RlmD family RNA methyltransferase	NA	NA	NA	NA
AWV68826.1\|66044_66491_+	hypothetical protein	NA	NA	NA	NA
AWV68827.1\|66444_66855_+	hypothetical protein	NA	NA	NA	NA
AWV68828.1\|67436_68531_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV68829.1\|68730_68928_-	hypothetical protein	NA	NA	NA	NA
AWV68830.1\|70263_71196_+	ferredoxin-NADP reductase	NA	NA	NA	NA
AWV68831.1\|71538_71757_+	transcriptional regulator	NA	NA	NA	NA
AWV68832.1\|72050_72518_+\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
AWV71514.1\|72647_74111_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	3.9e-43	36.6
AWV68833.1\|74115_74463_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AWV68834.1\|74455_75049_+	recombination protein RecR	NA	NA	NA	NA
AWV68835.1\|75051_76626_-	hypothetical protein	NA	NA	NA	NA
AWV68836.1\|76629_77472_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWV68837.1\|77534_79172_-	hypothetical protein	NA	NA	NA	NA
AWV68838.1\|79364_80459_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

506819 : 557627

Heterosigma_akashiwo_virus(25.0%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV69186.1\|506819_507914_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69187.1\|509115_510210_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69188.1\|510621_511134_-	polyketide cyclase	NA	NA	NA	NA
AWV69189.1\|511266_512226_-	geranylgeranyl pyrophosphate synthase	NA	NA	NA	NA
AWV69190.1\|512294_513230_-	transglutaminase	NA	NA	NA	NA
AWV69191.1\|513608_514433_-	transketolase	NA	NA	NA	NA
AWV69192.1\|514485_514872_-	hypothetical protein	NA	NA	NA	NA
AWV69193.1\|515406_516984_-	hypothetical protein	NA	NA	NA	NA
AWV69194.1\|516973_519712_-	carboxypeptidase	NA	NA	NA	NA
AWV69195.1\|519757_520690_-	hypothetical protein	NA	NA	NA	NA
AWV69196.1\|520700_521249_-	glutathione peroxidase	NA	NA	NA	NA
AWV69197.1\|521552_522647_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69198.1\|523186_523459_-	antitoxin	NA	NA	NA	NA
AWV69199.1\|523455_523734_-	toxin	NA	NA	NA	NA
AWV69200.1\|524061_524631_-	hypothetical protein	NA	NA	NA	NA
AWV69201.1\|524923_526171_-	crotonyl-CoA carboxylase/reductase	NA	NA	NA	NA
AWV69202.1\|526920_527679_+	hypothetical protein	NA	NA	NA	NA
AWV69203.1\|528383_529259_-	J domain-containing protein	NA	NA	NA	NA
AWV69204.1\|529403_531329_+	carbon starvation protein A	NA	NA	NA	NA
AWV69205.1\|531325_531874_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AWV69206.1\|531939_533709_+	hypothetical protein	NA	NA	NA	NA
AWV69207.1\|533715_534468_+	NRDE domain protein	NA	NA	NA	NA
AWV69208.1\|534471_534852_+	PilZ domain-containing protein	NA	NA	NA	NA
AWV71552.1\|535664_536474_+	hypothetical protein	NA	NA	NA	NA
AWV69209.1\|536835_538866_+	hypothetical protein	NA	NA	NA	NA
AWV69210.1\|538840_539056_+	hypothetical protein	NA	NA	NA	NA
AWV69211.1\|539082_539280_+	hypothetical protein	NA	NA	NA	NA
AWV69212.1\|539284_539479_+	hypothetical protein	NA	NA	NA	NA
AWV69213.1\|539486_540983_+	spermidine synthase	A0A1C9C533	Heterosigma_akashiwo_virus	1.5e-10	29.1
AWV69214.1\|541682_541976_-	hypothetical protein	NA	NA	NA	NA
AWV69215.1\|542037_542172_-	DUF1877 domain-containing protein	NA	NA	NA	NA
AWV71553.1\|542529_542904_+	hypothetical protein	NA	NA	NA	NA
AWV69216.1\|543228_544323_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69217.1\|544791_545262_-	EVE domain-containing protein	NA	NA	NA	NA
AWV69218.1\|545258_547217_-\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	4.2e-109	44.6
AWV69219.1\|547372_547936_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AWV69220.1\|547983_548622_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
AWV69221.1\|548637_549576_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	1.2e-48	34.3
AWV71554.1\|549572_550331_-	UDP-N-acetylglucosamine diphosphorylase	A0A1S5V090	Saudi_moumouvirus	2.4e-28	32.8
AWV69222.1\|550435_551329_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
AWV69223.1\|551683_552628_-	WYL domain-containing protein	NA	NA	NA	NA
AWV71555.1\|552875_554273_+	hypothetical protein	NA	NA	NA	NA
AWV71556.1\|554339_554762_+	hypothetical protein	NA	NA	NA	NA
AWV69224.1\|554773_554965_-	hypothetical protein	NA	NA	NA	NA
AWV69225.1\|556532_557627_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

940780 : 992237

Tupanvirus(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWV69506.1\|940780_943525_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	4.7e-90	27.9
AWV69507.1\|943881_944622_-	hypothetical protein	NA	NA	NA	NA
AWV69508.1\|944618_944987_-	anti-sigma factor antagonist	NA	NA	NA	NA
AWV69509.1\|944900_945083_+	hypothetical protein	NA	NA	NA	NA
AWV69510.1\|945110_946952_+	hypothetical protein	NA	NA	NA	NA
AWV71583.1\|946969_947689_+	amidohydrolase	NA	NA	NA	NA
AWV69511.1\|948417_949380_-	hypothetical protein	NA	NA	NA	NA
AWV69512.1\|949633_950890_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AWV69513.1\|950901_952608_+	protein kinase	NA	NA	NA	NA
AWV69514.1\|952604_953153_+	lipoprotein signal peptidase	NA	NA	NA	NA
AWV69515.1\|953157_953685_+	cAMP-binding protein	NA	NA	NA	NA
AWV69516.1\|953677_954745_+	AI-2E family transporter	NA	NA	NA	NA
AWV69517.1\|955671_955950_+	antitoxin	NA	NA	NA	NA
AWV69518.1\|956507_957431_-	EamA family transporter	NA	NA	NA	NA
AWV69519.1\|957476_957746_-	hypothetical protein	NA	NA	NA	NA
AWV69520.1\|958208_959303_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69521.1\|959390_960257_-	bile acid:sodium symporter	NA	NA	NA	NA
AWV69522.1\|960330_960519_-	hypothetical protein	NA	NA	NA	NA
AWV69523.1\|960499_960922_+	hypothetical protein	NA	NA	NA	NA
AWV71584.1\|960984_961701_+	hypothetical protein	NA	NA	NA	NA
AWV69524.1\|962011_963379_-	alpha/beta hydrolase	NA	NA	NA	NA
AWV69525.1\|963415_963850_-	hypothetical protein	NA	NA	NA	NA
AWV69526.1\|964008_964461_-	response regulator	NA	NA	NA	NA
AWV71585.1\|964453_965851_-	histidine kinase	W8CYF6	Bacillus_phage	9.8e-12	25.7
AWV69527.1\|965882_966080_+	hypothetical protein	NA	NA	NA	NA
AWV69528.1\|966143_967007_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AWV69529.1\|967093_968128_+	metallophosphatase	NA	NA	NA	NA
AWV69530.1\|968533_969751_-\|transposase	IS4/IS5 family transposase	NA	NA	NA	NA
AWV69531.1\|970704_971094_+	hypothetical protein	NA	NA	NA	NA
AWV69532.1\|971886_972414_+	hypothetical protein	NA	NA	NA	NA
AWV71586.1\|973070_975203_+	TonB-dependent receptor	NA	NA	NA	NA
AWV69533.1\|975204_976368_+	hypothetical protein	NA	NA	NA	NA
AWV69534.1\|976734_977394_+	hypothetical protein	NA	NA	NA	NA
AWV69535.1\|977566_977800_-\|transposase	transposase	NA	NA	NA	NA
AWV69536.1\|977883_978978_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69537.1\|980409_981504_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AWV69538.1\|983699_984446_-	sphingomyelinase C	NA	NA	NA	NA
AWV69539.1\|985419_986634_+	tetracycline resistance MFS efflux pump	A0A2H4UVM2	Bodo_saltans_virus	5.7e-08	21.1
AWV69540.1\|988624_988837_+	hypothetical protein	NA	NA	NA	NA
AWV69541.1\|988833_989691_+	pirin family protein	NA	NA	NA	NA
AWV69542.1\|989792_990674_-	hypothetical protein	NA	NA	NA	NA
AWV69543.1\|990980_992237_-\|transposase	IS4/IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP021413

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP021412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection