CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	0 crisprs	csa3,RT	0	2
CP030077	Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence	0 crisprs	DEDDh	0	1
CP030076	Enterobacter hormaechei strain 20710 chromosome, complete genome	0 crisprs	csa3,DinG,WYL,DEDDh,cas3	0	364
CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	1 crisprs	DEDDh	1	1
CP030079	Enterobacter hormaechei strain 20710 plasmid p5-20710, complete sequence	0 crisprs	cas14j	0	1
CP030081	Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence	0 crisprs	DEDDh	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

95981 : 111910

Rhodobacter_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX05304.1\|95981_96986_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AWX05305.1\|96948_97089_-	NTP-binding protein	NA	NA	NA	NA
AWX05306.1\|97135_98818_+\|transposase	transposase	M4T586	Rhodobacter_phage	3.7e-05	24.7
AWX05307.1\|98820_99729_+\|transposase	transposase	NA	NA	NA	NA
AWX05308.1\|99725_100943_+\|transposase	transposase	NA	NA	NA	NA
AWX05309.1\|101003_101618_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.1e-37	51.0
AWX05310.1\|101656_101977_-	DUF3330 domain-containing protein	NA	NA	NA	NA
AWX05311.1\|101992_102229_-	mercury resistance protein	NA	NA	NA	NA
AWX05312.1\|102225_102591_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AWX05313.1\|102702_103341_-	organomercurial lyase MerB	NA	NA	NA	NA
AWX05314.1\|103355_103709_-	hypothetical protein	NA	NA	NA	NA
AWX05315.1\|103638_104073_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AWX05316.1\|104151_105156_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
AWX05503.1\|105729_105942_+	hypothetical protein	NA	NA	NA	NA
AWX05317.1\|106032_106380_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AWX05318.1\|106376_107015_-	organomercurial lyase MerB	NA	NA	NA	NA
AWX05319.1\|107095_107749_-	sel1 repeat family protein	NA	NA	NA	NA
AWX05320.1\|107784_109494_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-34	27.1
AWX05321.1\|109681_109957_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
AWX05322.1\|109970_110321_-	mercuric ion transporter MerT	NA	NA	NA	NA
AWX05323.1\|110392_110827_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AWX05324.1\|110905_111910_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

237379 : 268413

uncultured_Caudovirales_phage(50.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX05444.1\|237379_238294_+\|transposase	IS5 family transposase	A0A077SK28	Escherichia_phage	3.6e-172	98.4
AWX05445.1\|238332_238461_-	ABC transporter	NA	NA	NA	NA
AWX05446.1\|238459_238777_+	hypothetical protein	NA	NA	NA	NA
AWX05447.1\|238827_239235_-	hypothetical protein	NA	NA	NA	NA
AWX05448.1\|239692_240364_-\|protease	serine protease	NA	NA	NA	NA
AWX05449.1\|240408_240714_-	hypothetical protein	NA	NA	NA	NA
AWX05450.1\|240736_241054_-	hypothetical protein	NA	NA	NA	NA
AWX05451.1\|241267_242671_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
AWX05508.1\|242699_243332_-	hypothetical protein	NA	NA	NA	NA
AWX05452.1\|243528_244932_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
AWX05453.1\|244964_245669_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.8e-86	72.9
AWX05454.1\|245755_246076_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.7e-20	53.7
AWX05455.1\|246121_247411_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	9.9e-168	71.4
AWX05456.1\|247423_247849_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.6e-50	70.7
AWX05457.1\|247908_248736_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	4.9e-43	37.2
AWX05458.1\|248754_250233_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	7.3e-199	74.4
AWX05459.1\|250724_251000_-	hypothetical protein	NA	NA	NA	NA
AWX05509.1\|251140_251338_-	hypothetical protein	NA	NA	NA	NA
AWX05460.1\|251407_251695_-	hypothetical protein	NA	NA	NA	NA
AWX05461.1\|251732_251987_-	hypothetical protein	NA	NA	NA	NA
AWX05462.1\|252032_252266_-	hypothetical protein	NA	NA	NA	NA
AWX05463.1\|252324_252582_-	hypothetical protein	NA	NA	NA	NA
AWX05464.1\|253016_253913_-	hypothetical protein	NA	NA	NA	NA
AWX05465.1\|253915_254431_-	nuclease	A0A1X6WF84	Pacmanvirus	2.1e-07	38.6
AWX05466.1\|254645_256073_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	3.4e-100	52.3
AWX05467.1\|256323_257643_+	DUF1173 family protein	NA	NA	NA	NA
AWX05468.1\|257655_257859_+	hypothetical protein	NA	NA	NA	NA
AWX05469.1\|257922_259128_-	ATP/GTP-binding protein	NA	NA	NA	NA
AWX05470.1\|259124_259943_-	DUF4942 domain-containing protein	NA	NA	NA	NA
AWX05471.1\|260408_260681_-	transcriptional repressor RcnR	NA	NA	NA	NA
AWX05472.1\|260803_261919_+	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
AWX05473.1\|262176_262611_-	copper-binding protein	NA	NA	NA	NA
AWX05474.1\|262828_264175_-	sensor histidine kinase	W8CYF6	Bacillus_phage	8.8e-18	26.6
AWX05475.1\|264258_265182_+\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	8.4e-177	99.7
AWX05476.1\|265370_266990_+	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
AWX05477.1\|267066_267543_+	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
AWX05478.1\|267708_268413_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030077

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30184 : 48571

Escherichia_phage(33.33%)

integrase,transposase

attL 40376:40390|attR 52279:52293

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04842.1\|30184_30538_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.9e-62	100.0
AWX04843.1\|30574_31279_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWX04990.1\|32462_32675_+	hypothetical protein	NA	NA	NA	NA
AWX04844.1\|32821_33691_-	23S ribosomal RNA methyltransferase Erm	NA	NA	NA	NA
AWX04845.1\|34325_34559_+	hypothetical protein	NA	NA	NA	NA
AWX04846.1\|34621_34867_+	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	5.3e-06	41.0
AWX04847.1\|35591_35783_-	hypothetical protein	NA	NA	NA	NA
AWX04848.1\|35836_36496_+	type A-1 chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	8.4e-131	100.0
AWX04849.1\|36696_37074_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWX04850.1\|37384_38389_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AWX04851.1\|38467_41434_-\|transposase	Tn3-like element TnAs3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6
40376:40390	attL	NA	NA	NA	NA
AWX04852.1\|41436_41997_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
AWX04853.1\|42122_42737_-	DUF3330 domain-containing protein	NA	NA	NA	NA
AWX04854.1\|42675_43689_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AWX04991.1\|43846_44320_+	trimethoprim-resistant dihydrofolate reductase DfrA17	A0A1B2IAU3	Erwinia_phage	1.3e-16	34.6
AWX04855.1\|44450_45239_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA5	NA	NA	NA	NA
AWX04856.1\|45444_45792_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AWX04857.1\|45785_46625_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AWX04858.1\|47029_48571_+\|transposase	IS91 family transposase	NA	NA	NA	NA
52279:52293	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP030076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14433

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00228.1\|124_625_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
AWX00229.1\|1034_2366_+	MFS transporter	NA	NA	NA	NA
AWX00230.1\|2381_4418_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
AWX00231.1\|4524_4971_+	DUF441 domain-containing protein	NA	NA	NA	NA
AWX00232.1\|4954_5746_-	AraC family transcriptional regulator	NA	NA	NA	NA
AWX00233.1\|5845_7033_+	cyanate MFS transporter	NA	NA	NA	NA
AWX00234.1\|7064_7772_-	hypothetical protein	NA	NA	NA	NA
AWX00235.1\|7922_8267_+	DUF488 domain-containing protein	NA	NA	NA	NA
AWX00236.1\|8267_8573_-	hypothetical protein	NA	NA	NA	NA
AWX00237.1\|8653_8908_-	DUF333 domain-containing protein	NA	NA	NA	NA
AWX00238.1\|8920_9103_-	hypothetical protein	NA	NA	NA	NA
AWX00239.1\|9220_10249_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	5.0e-13	32.1
AWX00240.1\|10294_10393_+	hypothetical protein	NA	NA	NA	NA
AWX04635.1\|10393_10468_+	hypothetical protein	NA	NA	NA	NA
AWX00241.1\|10521_10770_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AWX04636.1\|10798_10984_-	hypothetical protein	NA	NA	NA	NA
AWX00242.1\|11140_11233_+	stress response membrane protein YncL	NA	NA	NA	NA
AWX00243.1\|11357_12857_+	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
AWX00244.1\|12861_13107_-	DUF2543 family protein	NA	NA	NA	NA
AWX00245.1\|13182_14433_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.9e-21	94.4

DBSCAN-SWA_2

17515 : 18886

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00250.1\|17515_18886_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.5e-109	45.8

DBSCAN-SWA_3

24692 : 34775

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00256.1\|24692_25811_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	6.4e-30	34.1
AWX00257.1\|25794_26652_+	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	2.7e-12	24.8
AWX00258.1\|26648_27440_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
AWX00259.1\|27436_28471_+	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
AWX00260.1\|28505_29327_-	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	1.2e-22	34.6
AWX00261.1\|29341_30253_-	N-acetylglucosamine kinase	NA	NA	NA	NA
AWX00262.1\|30307_31552_-	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
AWX00263.1\|31551_32253_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.4e-37	42.3
AWX00264.1\|32245_33445_-	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
AWX00265.1\|33701_34775_+	hypothetical protein	A0A142KBN9	Gordonia_phage	1.1e-07	25.9

DBSCAN-SWA_4

39554 : 39812

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00268.1\|39554_39812_-	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	3.3e-06	38.6

DBSCAN-SWA_5

52056 : 53699

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00280.1\|52056_53061_-	DNA polymerase III subunit delta'	A0A2H4IBD4	Erwinia_phage	2.0e-06	28.4
AWX00281.1\|53057_53699_-	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.1e-29	39.6

DBSCAN-SWA_6

56976 : 58102

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00285.1\|56976_57213_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	3.4e-10	45.2
AWX00286.1\|57367_58102_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-15	33.3

DBSCAN-SWA_7

72364 : 73318

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00299.1\|72364_73318_-	flagellar assembly peptidoglycan hydrolase FlgJ	A0A160LKR7	Bacillus_phage	2.8e-10	38.0

DBSCAN-SWA_8

88418 : 88664

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00317.1\|88418_88664_+	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	4.5e-13	50.0

DBSCAN-SWA_9

93267 : 94194

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00324.1\|93267_94194_+	lipid A biosynthesis lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	3.1e-54	41.5

DBSCAN-SWA_10

101855 : 102392

Red_sea_bream_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00332.1\|101855_102392_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	4.6e-26	41.9

DBSCAN-SWA_11

106543 : 107377

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00340.1\|106543_107377_+	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	2.3e-40	39.9

DBSCAN-SWA_12

114418 : 115483

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00348.1\|114418_115483_-	phosphate starvation-inducible protein PhoH	A0A1B2ICF6	Erwinia_phage	1.4e-90	69.5

DBSCAN-SWA_13

131821 : 134978

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00363.1\|131821_132316_+	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	1.6e-41	83.3
AWX00364.1\|132337_133660_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	5.7e-211	89.0
AWX00365.1\|133770_134691_-	DMT family transporter	NA	NA	NA	NA
AWX00366.1\|134807_134978_-	stress-induced protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_14

143203 : 147844

uncultured_Caudovirales_phage(66.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00375.1\|143203_144235_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-13	23.2
AWX00376.1\|144231_144993_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.4e-12	30.4
AWX00377.1\|145285_146914_-	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
AWX00378.1\|147000_147186_-	hypothetical protein	NA	NA	NA	NA
AWX00379.1\|147184_147844_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	2.0e-47	53.9

DBSCAN-SWA_15

152074 : 154129

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00386.1\|152074_154129_-	DNA helicase IV	A7KV33	Bacillus_phage	6.7e-17	27.8

DBSCAN-SWA_16

166618 : 171855

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00397.1\|166618_168526_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	3.3e-50	28.5
AWX04642.1\|168538_170647_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
AWX00398.1\|170745_171855_+	MOSC domain-containing protein	A0A0E3FP00	Synechococcus_phage	4.1e-05	35.1

DBSCAN-SWA_17

177290 : 183803

Bacillus_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00405.1\|177290_178061_+	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.5e-30	39.0
AWX00406.1\|178164_180777_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.0e-18	21.8
AWX00407.1\|181031_182234_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.8e-45	31.9
AWX00408.1\|182402_183803_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	8.5e-80	37.3

DBSCAN-SWA_18

202664 : 207212

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00423.1\|202664_204413_-	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.7e-58	30.5
AWX00424.1\|204449_206714_-	ComEC family protein	NA	NA	NA	NA
AWX00425.1\|206924_207212_-	integration host factor subunit beta	A7KV42	Bacillus_phage	5.5e-10	40.2

DBSCAN-SWA_19

211388 : 212477

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00429.1\|211388_212477_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.5e-81	46.5

DBSCAN-SWA_20

216534 : 246284

Tetraselmis_virus(14.29%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00432.1\|216534_218817_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-161	41.9
AWX00433.1\|219020_219761_+	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.8e-20	26.1
AWX00434.1\|219797_220319_-	hypothetical protein	NA	NA	NA	NA
AWX00435.1\|220442_221591_-	MFS transporter	NA	NA	NA	NA
AWX00436.1\|221631_221814_+	hypothetical protein	NA	NA	NA	NA
AWX00437.1\|221865_222729_-	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
AWX00438.1\|222730_223348_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.4e-74	59.1
AWX00439.1\|223358_225803_-	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	8.9e-218	49.4
AWX00440.1\|226014_227307_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.7e-93	45.2
AWX00441.1\|227399_228743_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-80	40.3
AWX00442.1\|228752_229367_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AWX00443.1\|229494_233160_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	2.6e-88	49.2
AWX00444.1\|233295_233790_-	leucine-responsive regulatory protein	NA	NA	NA	NA
AWX00445.1\|234333_235302_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	7.9e-61	42.7
AWX00446.1\|235416_237183_+	thiol reductant ABC exporter subunit CydD	F2Y302	Organic_Lake_phycodnavirus	1.6e-11	27.4
AWX00447.1\|237182_238904_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	F2Y2R6	Organic_Lake_phycodnavirus	1.0e-18	27.2
AWX00448.1\|238949_239654_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AWX00449.1\|239938_240157_+	translation initiation factor IF-1	NA	NA	NA	NA
AWX00450.1\|240228_240690_-	hypothetical protein	NA	NA	NA	NA
AWX00451.1\|241156_243436_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.0
AWX00452.1\|243463_243784_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.9
AWX00453.1\|244051_244273_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
AWX00454.1\|244343_246284_-	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	3.8e-38	40.5

DBSCAN-SWA_21

263116 : 265819

Orgyia_leucostigma_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00466.1\|263116_265819_-	PKD domain-containing protein	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	2.6e-186	59.6

DBSCAN-SWA_22

282224 : 282953

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00485.1\|282224_282953_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.8e-28	36.2

DBSCAN-SWA_23

286073 : 297293

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00490.1\|286073_287543_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.1e-24	30.1
AWX00491.1\|287526_288234_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.4e-36	36.3
AWX00492.1\|288355_289483_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	2.5e-29	27.2
AWX00493.1\|289523_290021_-	DUF2593 family protein	NA	NA	NA	NA
AWX00494.1\|290063_290909_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AWX00495.1\|290905_291859_-	putrescine ABC transporter permease PotH	NA	NA	NA	NA
AWX00496.1\|291868_293002_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.5e-30	34.4
AWX00497.1\|293145_294258_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AWX00498.1\|294423_294612_+	hypothetical protein	NA	NA	NA	NA
AWX00499.1\|294608_295085_-	YbjN domain-containing protein	NA	NA	NA	NA
AWX00500.1\|295148_296051_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.2e-36	33.6
AWX00501.1\|296115_296838_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AWX00502.1\|297023_297293_+	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	7.9e-27	71.8

DBSCAN-SWA_24

303650 : 305745

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00509.1\|303650_303971_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-22	53.7
AWX00510.1\|304011_305301_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.8e-169	71.7
AWX00511.1\|305313_305745_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	9.0e-49	66.4

DBSCAN-SWA_25

311753 : 313804

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00518.1\|311753_312512_+	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	1.8e-12	26.1
AWX04647.1\|312598_313804_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-98	47.2

DBSCAN-SWA_26

321289 : 323161

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00526.1\|321289_323161_-	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	4.5e-12	29.8

DBSCAN-SWA_27

326376 : 330503

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00530.1\|326376_327039_-	fructose-6-phosphate aldolase	A0A0E3HJ81	Synechococcus_phage	2.8e-25	32.7
AWX00531.1\|327166_328066_+	glycyl-radical enzyme activating protein	NA	NA	NA	NA
AWX00532.1\|328070_330503_+	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A076YHZ7	Citrobacter_phage	1.0e-08	49.1

DBSCAN-SWA_28

338078 : 339674

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00538.1\|338078_339674_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	9.4e-59	28.4

DBSCAN-SWA_29

344997 : 345366

Campylobacter_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00544.1\|344997_345366_-	hypothetical protein	H6SUH4	Campylobacter_virus	4.0e-05	31.7

DBSCAN-SWA_30

353677 : 358817

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00552.1\|353677_354196_-	outer membrane protein X	K7PJP9	Enterobacteria_phage	3.2e-16	31.4
AWX00553.1\|354550_355438_+	threonine/homoserine exporter RhtA	NA	NA	NA	NA
AWX00554.1\|355736_356240_+	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	9.3e-05	24.4
AWX00555.1\|356420_356549_-	reductase	NA	NA	NA	NA
AWX00556.1\|356601_357345_+	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
AWX00557.1\|357438_358098_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
AWX00558.1\|358094_358817_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	4.7e-34	42.7

DBSCAN-SWA_31

362345 : 362999

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00562.1\|362345_362609_+	DUF1471 domain-containing protein	A0A142IIN6	Enterobacteria_phage	1.3e-05	43.8
AWX00563.1\|362732_362999_+	DksA/TraR family C4-type zinc finger protein	E5E4B1	Acinetobacter_phage	4.9e-13	50.6

DBSCAN-SWA_32

370210 : 377474

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00571.1\|370210_372388_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	3.4e-43	26.1
AWX00572.1\|372485_373868_-	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.7e-51	33.2
AWX00573.1\|374072_374750_+	transcriptional regulator	NA	NA	NA	NA
AWX00574.1\|374746_375742_+	secretion protein HlyD	NA	NA	NA	NA
AWX00575.1\|375734_377474_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.2e-20	30.5

DBSCAN-SWA_33

387092 : 388001

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00588.1\|387092_388001_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	1.3e-25	29.3

DBSCAN-SWA_34

395225 : 398644

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04648.1\|395225_396533_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.0e-19	30.2
AWX00596.1\|396580_397057_+	kinase inhibitor	NA	NA	NA	NA
AWX00597.1\|397123_398644_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.6e-84	39.6

DBSCAN-SWA_35

406912 : 413441

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00605.1\|406912_407971_-	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-18	33.3
AWX00606.1\|407970_408663_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AWX00607.1\|408659_409436_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX00608.1\|409614_409767_-	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
AWX00609.1\|409894_410683_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AWX00610.1\|410750_412223_+	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	2.3e-11	29.5
AWX00611.1\|412424_413441_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.2e-79	45.4

DBSCAN-SWA_36

417764 : 421234

Edwardsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00616.1\|417764_418817_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	5.2e-82	48.3
AWX00617.1\|419120_419480_+	hypothetical protein	NA	NA	NA	NA
AWX00618.1\|419579_420518_+	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	4.4e-24	28.4
AWX00619.1\|420514_421234_-	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	6.8e-25	36.4

DBSCAN-SWA_37

449887 : 450679

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00644.1\|449887_450679_-	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.0e-09	28.1

DBSCAN-SWA_38

453775 : 460139

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00648.1\|453775_455188_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	8.9e-61	33.1
AWX00649.1\|455786_455993_-	DUF2517 family protein	NA	NA	NA	NA
AWX00650.1\|456303_456393_+	potassium-transporting ATPase subunit F	NA	NA	NA	NA
AWX00651.1\|456392_458072_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
AWX00652.1\|458090_460139_+	K(+)-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	8.4e-28	22.8

DBSCAN-SWA_39

463411 : 464089

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00655.1\|463411_464089_+	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.0e-26	29.7

DBSCAN-SWA_40

475656 : 479443

Escherichia_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00667.1\|475656_477324_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.0
AWX00668.1\|477493_479443_-	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.9e-08	48.6

DBSCAN-SWA_41

484050 : 485715

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00673.1\|484050_485715_+	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	1.6e-85	39.0

DBSCAN-SWA_42

489641 : 490688

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00677.1\|489641_490688_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	6.4e-48	45.6

DBSCAN-SWA_43

496518 : 497244

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00684.1\|496518_497244_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.1e-30	36.8

DBSCAN-SWA_44

500820 : 503427

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00688.1\|500820_503427_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.7e-182	42.1

DBSCAN-SWA_45

509818 : 512275

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00695.1\|509818_510925_+	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	1.8e-08	51.6
AWX00696.1\|511063_512275_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.0e-101	49.4

DBSCAN-SWA_46

517065 : 517908

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00703.1\|517065_517449_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.4e-24	54.6
AWX00704.1\|517668_517908_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	8.0e-23	72.9

DBSCAN-SWA_47

537982 : 544346

Morganella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00721.1\|537982_538411_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	5.3e-17	36.4
AWX00722.1\|538470_540036_-	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.4e-43	34.0
AWX00723.1\|540278_540842_-	alkyl hydroperoxide reductase subunit C	NA	NA	NA	NA
AWX00724.1\|542511_543735_+	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	2.6e-61	34.3
AWX00725.1\|543719_544346_+	hypothetical protein	A0A0F7L444	uncultured_marine_virus	3.2e-55	51.3

DBSCAN-SWA_48

553720 : 558137

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00736.1\|553720_555223_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-17	26.5
AWX00737.1\|555382_556471_+	oxidoreductase	NA	NA	NA	NA
AWX00738.1\|556528_557272_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
AWX00739.1\|557455_557758_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AWX00740.1\|557732_558137_+	XRE family transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	4.0e-06	34.1

DBSCAN-SWA_49

570066 : 574781

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00751.1\|570066_570867_+	iron-enterobactin ABC transporter ATP-binding protein	M1HQ77	Paramecium_bursaria_Chlorella_virus	8.4e-08	23.2
AWX00752.1\|570923_574781_-	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	7.1e-60	28.7

DBSCAN-SWA_50

581055 : 589324

Brazilian_cedratvirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00759.1\|581055_581862_-	manganese/iron ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.1e-12	26.5
AWX00760.1\|581864_582776_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX00761.1\|582987_583272_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AWX00762.1\|583410_585444_-\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	3.4e-21	27.6
AWX00763.1\|585572_586160_+	transcriptional regulator BetI	NA	NA	NA	NA
AWX00764.1\|586173_587646_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
AWX00765.1\|587659_589324_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	5.2e-60	31.4

DBSCAN-SWA_51

593804 : 595332

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00770.1\|593804_594641_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-13	32.0
AWX00771.1\|594627_595332_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-21	34.8

DBSCAN-SWA_52

610452 : 613161

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00785.1\|610452_613161_-	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.7e-68	27.9

DBSCAN-SWA_53

621254 : 621542

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00793.1\|621254_621542_-	XRE family transcriptional regulator	A0A088CD40	Shigella_phage	6.9e-05	38.1

DBSCAN-SWA_54

625541 : 626513

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00797.1\|625541_626513_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.9e-25	32.6

DBSCAN-SWA_55

636897 : 637287

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00805.1\|636897_637287_-	LexA family transcriptional regulator	K7P6F7	Enterobacteria_phage	6.4e-46	65.6

DBSCAN-SWA_56

641550 : 680562

Erwinia_phage(42.11%)

plate,terminase,head,integrase

attL 636728:636774|attR 680576:680622

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
636728:636774	attL	NA	NA	NA	NA
AWX00808.1\|641550_642192_-	hypothetical protein	E5AGC6	Erwinia_phage	9.3e-42	45.8
AWX00809.1\|642191_642428_-	phosphoglycolate phosphatase	E5AGC5	Erwinia_phage	3.3e-29	81.6
AWX00810.1\|642436_643207_-	hypothetical protein	E5AGC4	Erwinia_phage	9.3e-105	76.2
AWX00811.1\|643184_644603_-	hypothetical protein	E5AGC3	Erwinia_phage	4.1e-207	77.8
AWX04658.1\|644668_645010_-	hypothetical protein	E5AGC2	Erwinia_phage	1.3e-45	74.3
AWX00812.1\|645077_645314_-	hypothetical protein	NA	NA	NA	NA
AWX00813.1\|645323_645998_-\|plate	baseplate assembly protein	E5AGC1	Erwinia_phage	3.3e-106	83.5
AWX00814.1\|645997_646933_-	hypothetical protein	E5AGC0	Erwinia_phage	4.1e-155	89.3
AWX00815.1\|646907_647249_-	hypothetical protein	E5AGB9	Erwinia_phage	2.4e-52	80.5
AWX00816.1\|647245_647962_-	hypothetical protein	E5AGB8	Erwinia_phage	8.4e-92	73.0
AWX00817.1\|647963_649535_-	hypothetical protein	E5AGB7	Erwinia_phage	3.4e-146	50.3
AWX00818.1\|649696_650134_-	hypothetical protein	E5AGB6	Erwinia_phage	1.0e-47	67.8
AWX00819.1\|650168_650615_-	DUF3277 family protein	E5AGB5	Erwinia_phage	1.3e-58	75.0
AWX00820.1\|650617_651958_-	hypothetical protein	E5AGB4	Erwinia_phage	6.4e-194	77.1
AWX00821.1\|651977_652517_-	hypothetical protein	E5AGB3	Erwinia_phage	6.4e-68	69.3
AWX00822.1\|652509_652857_-	hypothetical protein	E5AGB2	Erwinia_phage	7.2e-49	82.3
AWX04659.1\|652853_653315_-	hypothetical protein	E5AGB1	Erwinia_phage	1.1e-49	64.7
AWX00823.1\|653305_653713_-	DUF4054 domain-containing protein	E5AGB0	Erwinia_phage	4.4e-53	75.4
AWX00824.1\|653712_653916_-	hypothetical protein	E5AGA9	Erwinia_phage	2.9e-18	73.1
AWX00825.1\|653948_654887_-	DNA-binding protein	E5AGA8	Erwinia_phage	2.4e-131	75.0
AWX00826.1\|654896_655406_-	hypothetical protein	E5AGA7	Erwinia_phage	4.8e-57	71.8
AWX00827.1\|655405_656578_-	hypothetical protein	E5AGA6	Erwinia_phage	1.5e-122	59.9
AWX00828.1\|656590_657397_-\|head	phage head morphogenesis protein	E5AGA5	Erwinia_phage	4.8e-96	63.5
AWX00829.1\|657389_658646_-	DUF1073 domain-containing protein	E5AGA4	Erwinia_phage	9.1e-150	62.7
AWX00830.1\|658654_660214_-\|terminase	terminase	E5AGA3	Erwinia_phage	1.7e-294	94.2
AWX00831.1\|660805_661327_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	97.7
AWX00832.1\|661599_661770_-	rz1 lytic protein	U5P461	Shigella_phage	2.1e-09	56.6
AWX00833.1\|661750_662128_-	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	2.8e-14	39.6
AWX00834.1\|662124_662613_-	lysozyme	A0A2H4FND7	Salmonella_phage	3.7e-83	92.6
AWX00835.1\|662612_662885_-	hypothetical protein	A0A2H4FNF0	Salmonella_phage	2.0e-41	98.9
AWX00836.1\|663108_663630_-	endodeoxyribonuclease	A0A1V0E5R7	Salmonella_phage	7.0e-56	64.7
AWX00837.1\|664220_664739_-	DUF1133 family protein	Q716B8	Shigella_phage	2.5e-85	89.5
AWX00838.1\|664738_664921_-	hypothetical protein	C6ZR61	Salmonella_phage	3.2e-08	50.0
AWX00839.1\|664908_665175_-	hypothetical protein	G0ZNC5	Cronobacter_phage	2.7e-27	72.6
AWX00840.1\|665171_665567_-	RusA family crossover junction endodeoxyribonuclease	A0A0M4REJ2	Salmonella_phage	6.1e-68	94.7
AWX00841.1\|665563_665860_-	hypothetical protein	F1C5C8	Cronobacter_phage	8.9e-40	81.4
AWX00842.1\|665822_666005_-	NinF family protein	A0A0M4S6T3	Salmonella_phage	7.2e-16	66.0
AWX00843.1\|665997_666372_-	hypothetical protein	A0A192Y677	Salmonella_phage	3.4e-12	36.2
AWX00844.1\|666373_666589_-	hypothetical protein	NA	NA	NA	NA
AWX00845.1\|666591_666768_-	NinE family protein	C6ZR57	Salmonella_phage	2.3e-19	74.1
AWX00846.1\|666764_667175_-	recombination protein NinB	A0A0P0ZCW6	Stx2-converting_phage	3.6e-63	86.8
AWX00847.1\|667146_667398_-	restriction alleviation protein, Lar family	NA	NA	NA	NA
AWX00848.1\|667352_667676_-	hypothetical protein	E7C9R6	Salmonella_phage	1.1e-22	55.1
AWX00849.1\|668539_668806_-	hypothetical protein	NA	NA	NA	NA
AWX00850.1\|668802_670173_-	replicative DNA helicase	Q9MCP7	Enterobacteria_phage	1.5e-193	75.3
AWX00851.1\|670169_670976_-	replication of DNA	Q76H52	Enterobacteria_phage	3.2e-116	80.5
AWX00852.1\|670968_671115_-	DUF2740 domain-containing protein	Q687G5	Enterobacteria_phage	8.0e-18	93.8
AWX00853.1\|671149_671428_-	hypothetical protein	A5VW96	Enterobacteria_phage	1.1e-34	82.4
AWX00854.1\|671536_671722_-	hypothetical protein	Q5G8T3	Enterobacteria_phage	7.8e-26	95.1
AWX00855.1\|671805_672456_+	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	2.9e-115	93.1
AWX00856.1\|673366_673639_+	hypothetical protein	NA	NA	NA	NA
AWX00857.1\|674258_674567_+	hypothetical protein	K7PJM4	Enterobacteria_phage	8.4e-25	52.9
AWX00858.1\|674563_675454_+	DNA recombinase	K7PKG9	Enterobacteria_phage	7.4e-130	78.3
AWX00859.1\|675453_675936_+	hypothetical protein	G8C7S9	Escherichia_phage	4.3e-68	84.4
AWX00860.1\|675945_676224_+	hypothetical protein	A0A0M4R304	Salmonella_phage	1.1e-15	55.6
AWX00861.1\|676220_676394_+	DUF2737 domain-containing protein	A0A2H4FUQ1	Salmonella_phage	1.2e-17	70.2
AWX00862.1\|676390_676879_+	hypothetical protein	B1GS42	Salmonella_phage	8.7e-16	41.3
AWX00863.1\|676875_677076_+	hypothetical protein	NA	NA	NA	NA
AWX00864.1\|677072_677408_+	hypothetical protein	NA	NA	NA	NA
AWX04660.1\|677555_678119_+	hypothetical protein	G8C7V0	Escherichia_phage	1.9e-43	53.8
AWX04661.1\|678326_678527_+	hypothetical protein	G8C7S1	Escherichia_phage	5.0e-10	50.0
AWX00865.1\|678539_679169_+	Eac protein	A0A220NQT7	Salmonella_phage	6.0e-102	85.2
AWX00866.1\|679171_679543_+	DNA-binding protein	B9UDM0	Salmonella_phage	3.5e-57	92.7
AWX00867.1\|679398_680562_+\|integrase	integrase	B9UDL9	Salmonella_phage	2.9e-211	91.5
680576:680622	attR	NA	NA	NA	NA

DBSCAN-SWA_57

690170 : 691037

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00876.1\|690170_691037_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	5.0e-30	34.5

DBSCAN-SWA_58

694775 : 696161

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00881.1\|694775_696161_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-44	34.8

DBSCAN-SWA_59

704268 : 704955

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00889.1\|704268_704955_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-32	35.9

DBSCAN-SWA_60

708087 : 708759

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00893.1\|708087_708759_-	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	2.7e-23	33.3

DBSCAN-SWA_61

711789 : 714288

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00898.1\|711789_714288_+	Cu+ exporting ATPase	A0A218MNH6	uncultured_virus	5.9e-108	37.2

DBSCAN-SWA_62

724265 : 729810

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00907.1\|724265_726140_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	8.6e-112	36.1
AWX00908.1\|726250_726856_-	recombination protein RecR	NA	NA	NA	NA
AWX00909.1\|726855_727188_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AWX00910.1\|727241_729170_-	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	7.9e-44	42.9
AWX00911.1\|729258_729810_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	45.9

DBSCAN-SWA_63

736579 : 743633

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00919.1\|736579_739726_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-52	23.1
AWX00920.1\|740236_740611_+	Hha toxicity modulator TomB	NA	NA	NA	NA
AWX00921.1\|740638_740857_+	hemolysin expression modulator Hha	NA	NA	NA	NA
AWX00922.1\|741065_741617_+	maltose O-acetyltransferase	NA	NA	NA	NA
AWX00923.1\|741733_742201_+	hypothetical protein	NA	NA	NA	NA
AWX00924.1\|742172_743633_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.0e-15	26.8

DBSCAN-SWA_64

746672 : 750936

Herpes_simplex_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00929.1\|746672_749762_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	66.1
AWX00930.1\|749865_750936_-	lac repressor	C6ZCU4	Enterobacteria_phage	2.2e-88	53.4

DBSCAN-SWA_65

758084 : 761613

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00940.1\|758084_759866_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	4.0e-42	28.0
AWX00941.1\|759858_761613_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-48	30.2

DBSCAN-SWA_66

765991 : 767357

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00945.1\|765991_766687_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	9.3e-88	68.4
AWX00946.1\|766690_767020_-	DNA-binding protein	NA	NA	NA	NA
AWX00947.1\|767006_767357_-	addiction module killer protein	A4JWV2	Burkholderia_virus	1.0e-13	47.6

DBSCAN-SWA_67

770513 : 775561

Sodalis_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00951.1\|770513_770786_-	DNA-binding protein HU-beta	A3E2K9	Sodalis_phage	8.5e-21	61.8
AWX00952.1\|770996_773351_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.7
AWX00953.1\|773535_774810_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-132	56.8
AWX00954.1\|774937_775561_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.2e-64	63.9

DBSCAN-SWA_68

796439 : 798101

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00975.1\|796439_796910_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-29	48.0
AWX00976.1\|796997_798101_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.9e-51	33.7

DBSCAN-SWA_69

801712 : 806052

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00980.1\|801712_802684_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.5e-46	40.2
AWX00981.1\|802694_804542_-	protein translocase subunit SecD	NA	NA	NA	NA
AWX00982.1\|804569_804902_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
AWX00983.1\|804924_806052_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.2e-89	46.3

DBSCAN-SWA_70

817869 : 826856

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX00992.1\|817869_819165_-	two-component system sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.2e-26	30.3
AWX00993.1\|819186_819876_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	9.7e-37	37.6
AWX00994.1\|820063_821269_+	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	1.5e-08	24.9
AWX00995.1\|821265_824397_+	exonuclease subunit SbcC	M1U9H5	Synechococcus_phage	2.3e-08	30.1
AWX00996.1\|824912_825818_-	fructokinase	NA	NA	NA	NA
AWX00997.1\|825941_826856_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.2e-100	62.4

DBSCAN-SWA_71

830463 : 831567

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01004.1\|830463_831567_-	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	9.5e-18	31.4

DBSCAN-SWA_72

839480 : 840641

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01014.1\|839480_840641_+	D-alanyl-D-alanine- carboxypeptidase/endopeptidase AmpH	A0A2H4JAN9	uncultured_Caudovirales_phage	6.7e-06	22.9

DBSCAN-SWA_73

849154 : 849922

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01022.1\|849154_849922_-	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	4.7e-24	38.0

DBSCAN-SWA_74

854769 : 856554

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01027.1\|854769_856554_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.9e-18	33.9

DBSCAN-SWA_75

860767 : 916198

Escherichia_phage(40.3%)

holin,tail,coat,lysis,terminase,integrase,transposase

attL 863907:863952|attR 912285:912330

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01032.1\|860767_861966_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	5.1e-166	88.8
AWX01033.1\|861958_862150_+	hypothetical protein	NA	NA	NA	NA
AWX01034.1\|862172_862529_-	hypothetical protein	NA	NA	NA	NA
AWX01035.1\|862531_863074_-	type IV secretion protein Rhs	NA	NA	NA	NA
863907:863952	attL	NA	NA	NA	NA
AWX01036.1\|864092_864416_-	hypothetical protein	K7PGV5	Enterobacterial_phage	4.9e-23	51.4
AWX01037.1\|864415_864655_-	hypothetical protein	K7P7N3	Enterobacteria_phage	3.5e-26	70.9
AWX01038.1\|864737_866039_-\|tail	phage tail protein	G8C7R8	Escherichia_phage	1.7e-119	55.5
AWX01039.1\|866098_867064_-	hypothetical protein	G1CSU0	Cronobacter_virus	1.3e-58	40.2
AWX01040.1\|867065_870965_-	host specificity protein	G8C7R4	Escherichia_phage	0.0e+00	76.3
AWX01041.1\|871020_871620_-\|tail	tail assembly protein	G8C7R3	Escherichia_phage	3.1e-100	95.0
AWX01042.1\|871607_872339_-	peptidase P60	G8C7R2	Escherichia_phage	5.3e-150	96.7
AWX01043.1\|872351_873125_-\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	3.9e-143	94.5
AWX01044.1\|873121_873472_-	hypothetical protein	G8C7R0	Escherichia_phage	7.5e-54	91.4
AWX01045.1\|873557_873950_-	hypothetical protein	NA	NA	NA	NA
AWX01046.1\|874000_877174_-\|tail	phage tail tape measure protein	G8C7Q6	Escherichia_phage	0.0e+00	83.6
AWX01047.1\|877173_877461_-	hypothetical protein	I6PD79	Cronobacter_phage	1.2e-17	61.5
AWX01048.1\|877478_877817_-	hypothetical protein	G8C7Q5	Escherichia_phage	9.5e-54	92.9
AWX01049.1\|877884_878793_-	hypothetical protein	G8C7Q4	Escherichia_phage	7.0e-51	66.5
AWX01050.1\|878936_879869_-\|tail	phage tail protein	G8C7Q3	Escherichia_phage	7.9e-167	99.0
AWX01051.1\|879915_880365_-	hypothetical protein	G8C7Q2	Escherichia_phage	4.6e-72	89.9
AWX01052.1\|880354_880954_-	hypothetical protein	G8C7Q1	Escherichia_phage	2.3e-98	87.9
AWX01053.1\|880956_881310_-	hypothetical protein	G8C7Q0	Escherichia_phage	5.4e-52	90.5
AWX01054.1\|881311_881794_-	hypothetical protein	G8C7P9	Escherichia_phage	4.3e-84	95.6
AWX01055.1\|881796_882054_-	hypothetical protein	G8C7P8	Escherichia_phage	9.5e-14	52.9
AWX01056.1\|882093_883230_-\|coat	P22 coat - protein 5 family protein	G8C7P7	Escherichia_phage	1.1e-194	92.3
AWX01057.1\|883246_883999_-	hypothetical protein	G8C7P6	Escherichia_phage	4.8e-130	96.0
AWX01058.1\|884106_884316_-	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	1.0e-13	48.5
AWX01059.1\|884319_885426_-	hypothetical protein	G8C7P5	Escherichia_phage	2.0e-185	89.4
AWX01060.1\|885427_886831_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	6.8e-255	95.7
AWX01061.1\|886835_888320_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	2.0e-252	83.3
AWX01062.1\|888319_888835_-	hypothetical protein	A0A0H5AUE2	Pseudomonas_phage	6.7e-51	62.2
AWX01063.1\|888838_889045_-	hypothetical protein	NA	NA	NA	NA
AWX01064.1\|889374_889893_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	98.8
AWX01065.1\|890179_890662_-\|lysis	lysis protein	M9NYX9	Enterobacteria_phage	2.7e-38	57.2
AWX01066.1\|890658_891135_-	lysozyme	K7PKX1	Enterobacterial_phage	6.0e-78	90.3
AWX01067.1\|891138_891414_-\|holin	phage holin family protein	S4TNV9	Salmonella_phage	5.8e-09	41.0
AWX01068.1\|891410_891812_-	hypothetical protein	NA	NA	NA	NA
AWX01069.1\|892308_892998_-	antiterminator	I6PDF8	Cronobacter_phage	1.4e-56	51.9
AWX01070.1\|892994_893111_-	hypothetical protein	NA	NA	NA	NA
AWX01071.1\|893107_893713_-	recombination protein NinG	A0A0M4RU10	Salmonella_phage	2.2e-40	69.8
AWX01072.1\|893705_893870_-	hypothetical protein	G8C7V4	Escherichia_phage	6.1e-14	73.2
AWX01073.1\|893862_894300_-	recombination protein NinB	Q5G8S5	Enterobacteria_phage	6.8e-44	59.2
AWX01074.1\|894484_894766_-	hypothetical protein	NA	NA	NA	NA
AWX01075.1\|894910_895096_-	hypothetical protein	NA	NA	NA	NA
AWX01076.1\|895095_895377_-	hypothetical protein	A0A2D2W302	Escherichia_phage	1.6e-06	40.8
AWX01077.1\|895376_896108_-	hypothetical protein	A5LH60	Enterobacteria_phage	1.9e-14	36.8
AWX01078.1\|896104_896314_-	hypothetical protein	A0A1I9LJM3	Stx_converting_phage	8.2e-24	69.1
AWX01079.1\|896315_896702_-	hypothetical protein	A0A2H4FRZ0	Salmonella_phage	6.7e-11	46.2
AWX01080.1\|896714_897134_-	hypothetical protein	NA	NA	NA	NA
AWX01081.1\|897130_897631_-	hypothetical protein	A0A0A6Z565	Enterobacter_phage	2.0e-07	37.6
AWX01082.1\|897627_897909_-	hypothetical protein	S4TW48	Salmonella_phage	3.2e-15	55.3
AWX01083.1\|897991_898336_-	transcriptional regulator	G8C7U7	Escherichia_phage	4.2e-41	73.0
AWX01084.1\|898332_899034_-	Replication protein P	A0A0M3ULE2	Salmonella_phage	3.7e-92	70.8
AWX01085.1\|899030_899963_-	replication protein	A5VW95	Enterobacteria_phage	1.5e-53	79.4
AWX01086.1\|900148_900691_-	regulator	M9NZI6	Enterobacteria_phage	3.3e-88	92.2
AWX01087.1\|900721_900973_-	helix-turn-helix domain-containing protein	G8C7U2	Escherichia_phage	9.0e-17	54.7
AWX01088.1\|901100_901793_+	hypothetical protein	G8C7U1	Escherichia_phage	1.8e-59	52.9
AWX01089.1\|901828_902305_+	hypothetical protein	Q5G8W9	Enterobacteria_phage	1.1e-50	64.7
AWX01090.1\|903166_903358_+	hypothetical protein	A0A2H4FQS9	Salmonella_phage	8.3e-15	57.8
AWX01091.1\|903403_903664_+	hypothetical protein	NA	NA	NA	NA
AWX01092.1\|903805_904003_+	hypothetical protein	NA	NA	NA	NA
AWX01093.1\|904157_904367_+	cell division protein FtsZ	M9NZE2	Enterobacteria_phage	6.7e-34	95.7
AWX01094.1\|904413_904923_+	Pathogenesis-related transcriptional factor and ERF protein	A0A1W6DY33	Salmonella_phage	1.3e-35	44.7
AWX01095.1\|904919_905204_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	2.2e-48	94.7
AWX01096.1\|905222_905969_+	phage recombination protein Bet	A0A0M4RD39	Salmonella_phage	1.8e-65	65.8
AWX01097.1\|905965_906583_+	exonuclease	A0A0S2SY31	Pseudomonas_phage	6.2e-59	60.2
AWX01098.1\|906579_907008_+	regulator	M9NYX4	Enterobacteria_phage	4.9e-71	93.0
AWX01099.1\|907168_907720_+	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	5.2e-57	60.0
AWX01100.1\|907716_907935_+	hypothetical protein	NA	NA	NA	NA
AWX01101.1\|907931_908204_+	hypothetical protein	K7P7M4	Enterobacteria_phage	4.2e-20	57.5
AWX01102.1\|908200_908401_+	hypothetical protein	NA	NA	NA	NA
AWX01103.1\|908397_908934_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	9.2e-35	51.0
AWX01104.1\|909000_909222_+	TraR/DksA family transcriptional regulator	M1FQT7	Enterobacteria_phage	1.0e-16	61.1
AWX01105.1\|909417_909657_+	hypothetical protein	M1FPC8	Enterobacteria_phage	5.4e-27	73.1
AWX01106.1\|909666_909852_+	hypothetical protein	A0A1B0V7L5	Salmonella_phage	1.1e-06	52.0
AWX01107.1\|910043_910244_+	hypothetical protein	G8C7S1	Escherichia_phage	2.2e-26	84.8
AWX01108.1\|910254_910584_+	hypothetical protein	G9L655	Escherichia_phage	3.5e-21	52.1
AWX01109.1\|911109_912270_+\|integrase	integrase	K7P7R5	Enterobacteria_phage	3.1e-213	92.7
AWX01110.1\|912471_913725_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.2e-96	46.1
912285:912330	attR	NA	NA	NA	NA
AWX01111.1\|913736_914840_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-59	39.9
AWX01112.1\|915145_916198_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.6e-118	60.9

DBSCAN-SWA_76

929401 : 929980

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01127.1\|929401_929980_-	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.5e-14	31.4

DBSCAN-SWA_77

935739 : 937989

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01130.1\|935739_937989_+	type I secretion system permease/ATPase	F2Y2R6	Organic_Lake_phycodnavirus	5.2e-23	33.5

DBSCAN-SWA_78

947235 : 947943

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01138.1\|947235_947943_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-32	36.6

DBSCAN-SWA_79

957715 : 961588

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01148.1\|957715_961588_-	hemagglutinin	A0A0R6PJK4	Moraxella_phage	4.3e-25	35.5

DBSCAN-SWA_80

981525 : 985730

Bradyrhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01154.1\|981525_982266_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.0e-39	39.5
AWX01155.1\|982321_982789_+	ribonuclease HI	J9Q745	Salmonella_phage	4.0e-50	58.4
AWX01156.1\|982789_983506_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AWX01157.1\|983538_984297_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AWX01158.1\|984365_985730_+	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	9.9e-09	36.0

DBSCAN-SWA_81

989786 : 990590

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01162.1\|989786_990590_-	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	2.7e-38	35.8

DBSCAN-SWA_82

997256 : 998288

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01164.1\|997256_998288_+	D-methionine ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_83

1010252 : 1014370

Saccharomonospora_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01178.1\|1010252_1013735_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.7e-207	36.5
AWX01179.1\|1013773_1014370_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.6e-27	40.8

DBSCAN-SWA_84

1023196 : 1023955

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01188.1\|1023196_1023955_-	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	1.4e-25	43.0

DBSCAN-SWA_85

1035313 : 1036747

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01198.1\|1035313_1036747_-\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-26	29.2

DBSCAN-SWA_86

1040682 : 1041027

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01202.1\|1040682_1041027_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.5e-27	51.4

DBSCAN-SWA_87

1046933 : 1047731

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01207.1\|1046933_1047731_-	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	4.6e-14	27.4

DBSCAN-SWA_88

1052899 : 1059673

Acanthamoeba_polyphaga_mimivirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01211.1\|1052899_1055329_-	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	5.3e-37	30.6
AWX01212.1\|1055402_1055957_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
AWX01213.1\|1055946_1056651_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
AWX01214.1\|1056827_1057283_+	RNA polymerase-binding transcription factor DksA	NA	NA	NA	NA
AWX01215.1\|1057342_1058233_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
AWX04674.1\|1058248_1059673_+	polynucleotide adenylyltransferase	H7BUW3	unidentified_phage	1.6e-25	31.5

DBSCAN-SWA_89

1072244 : 1078785

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01229.1\|1072244_1073171_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-22	32.3
AWX01230.1\|1073278_1073941_+	carbonate dehydratase	NA	NA	NA	NA
AWX01231.1\|1074005_1074542_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.3e-17	33.1
AWX01232.1\|1074748_1077139_+	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
AWX01233.1\|1077225_1078785_-	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	3.2e-19	57.6

DBSCAN-SWA_90

1087026 : 1088451

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01240.1\|1087026_1088451_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.5e-41	27.3

DBSCAN-SWA_91

1099391 : 1099955

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01248.1\|1099391_1099955_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	6.7e-12	33.1

DBSCAN-SWA_92

1104146 : 1105190

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01253.1\|1104146_1105190_-	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.1e-103	56.6

DBSCAN-SWA_93

1131141 : 1132866

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01276.1\|1131141_1132866_-	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	4.9e-37	26.7

DBSCAN-SWA_94

1145651 : 1146353

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01288.1\|1145651_1146353_+	thiamine ABC transporter ATP-binding protein ThiQ	G9BWD6	Planktothrix_phage	1.1e-22	34.5

DBSCAN-SWA_95

1152626 : 1158018

Yellowstone_lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01294.1\|1152626_1154984_+	DNA polymerase II	A0A0P0YM26	Yellowstone_lake_phycodnavirus	1.4e-29	25.7
AWX01295.1\|1155111_1158018_+	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	4.9e-21	36.6

DBSCAN-SWA_96

1165656 : 1167024

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01303.1\|1165656_1166505_+	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	4.9e-06	42.3
AWX01304.1\|1166544_1167024_-	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	1.2e-28	42.5

DBSCAN-SWA_97

1176560 : 1177709

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01309.1\|1176560_1177709_-	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.4e-48	31.9

DBSCAN-SWA_98

1181208 : 1195036

Megavirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01314.1\|1181208_1184025_-\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	3.8e-79	25.5
AWX01315.1\|1184070_1184997_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AWX01316.1\|1185004_1185097_-	DUF2575 domain-containing protein	NA	NA	NA	NA
AWX01317.1\|1185325_1185589_+	30S ribosomal protein S20	NA	NA	NA	NA
AWX01318.1\|1185647_1186547_-	transcriptional activator NhaR	NA	NA	NA	NA
AWX01319.1\|1186605_1187781_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	4.7e-84	53.7
AWX01320.1\|1187954_1189100_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.1e-24	35.3
AWX01321.1\|1189187_1191101_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.8e-147	50.6
AWX01322.1\|1191218_1191404_-	hypothetical protein	NA	NA	NA	NA
AWX01323.1\|1191396_1191963_+	acetate uptake transporter	NA	NA	NA	NA
AWX01324.1\|1191939_1193262_-	MFS transporter	NA	NA	NA	NA
AWX01325.1\|1193384_1193972_-	molybdopterin adenylyltransferase	NA	NA	NA	NA
AWX01326.1\|1194082_1195036_-	transaldolase	A0A127KNC6	Cyanophage	5.7e-11	32.1

DBSCAN-SWA_99

1208436 : 1215699

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01341.1\|1208436_1210374_-	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	3.6e-12	36.2
AWX01342.1\|1210600_1212268_+	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	1.1e-41	26.6
AWX01343.1\|1212359_1213259_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWX01344.1\|1213367_1214369_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
AWX01345.1\|1214466_1215699_-	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.4e-88	44.4

DBSCAN-SWA_100

1224646 : 1225969

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01355.1\|1224646_1225969_-	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.2e-78	39.8

DBSCAN-SWA_101

1231428 : 1234227

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01360.1\|1231428_1231608_-	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.5e-13	69.8
AWX01361.1\|1231715_1232333_-	molecular chaperone OsmY	NA	NA	NA	NA
AWX01362.1\|1232637_1234227_-	peptide chain release factor 3	D0R0F5	Streptococcus_phage	7.0e-30	26.0

DBSCAN-SWA_102

1237965 : 1239030

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01368.1\|1237965_1239030_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.4e-20	36.9

DBSCAN-SWA_103

1246294 : 1247574

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01378.1\|1246294_1246840_+	primosomal protein DnaT	T1SA92	Salmonella_phage	4.4e-24	56.4
AWX01379.1\|1246836_1247574_+	AAA family ATPase	A0A1W6JP39	Morganella_phage	7.1e-62	48.1

DBSCAN-SWA_104

1251305 : 1252970

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01383.1\|1251305_1252970_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-14	30.4

DBSCAN-SWA_105

1292121 : 1299234

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01421.1\|1292121_1292727_-\|protease	ATP-dependent Clp protease proteolytic subunit	G3M9Z8	Bacillus_virus	7.2e-28	39.8
AWX01422.1\|1293027_1293645_+	DNA-binding response regulator	NA	NA	NA	NA
AWX01423.1\|1293648_1299234_-	GAF domain-containing protein	Q67624	IC4_retrovirus	3.4e-07	33.3

DBSCAN-SWA_106

1305019 : 1307925

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01431.1\|1305019_1305841_+	alpha/beta hydrolase	A0A249XMC3	Mycobacterium_phage	4.3e-15	28.4
AWX01432.1\|1305972_1307925_+	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	2.6e-26	30.2

DBSCAN-SWA_107

1320875 : 1322171

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01449.1\|1320875_1321319_-	antirestriction protein	A9J566	Pseudomonas_phage	5.1e-15	30.1
AWX01450.1\|1321349_1322171_-	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	8.8e-45	37.3

DBSCAN-SWA_108

1329780 : 1332243

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01460.1\|1329780_1332243_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	7.9e-73	35.7

DBSCAN-SWA_109

1337053 : 1344699

Liberibacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01464.1\|1337053_1340149_+	restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	4.2e-55	28.5
AWX01465.1\|1340148_1340862_+	metal-dependent hydrolase	NA	NA	NA	NA
AWX01466.1\|1340907_1342389_-	SAM-dependent methyltransferase	A0A2H4PQP4	Staphylococcus_phage	5.6e-58	33.1
AWX01467.1\|1342381_1342984_-	restriction endonuclease subunit S	NA	NA	NA	NA
AWX01468.1\|1343000_1343189_-	hypothetical protein	NA	NA	NA	NA
AWX01469.1\|1343451_1344699_-	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	2.1e-82	43.5

DBSCAN-SWA_110

1363071 : 1373248

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01487.1\|1363071_1364004_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-52	40.2
AWX01488.1\|1364016_1364478_+	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
AWX01489.1\|1364551_1364938_+	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
AWX01490.1\|1365076_1366525_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.1e-21	36.1
AWX01491.1\|1366619_1369004_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
AWX01492.1\|1369078_1369309_+	hypothetical protein	NA	NA	NA	NA
AWX04686.1\|1369204_1371913_-	magnesium-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	2.6e-37	25.1
AWX01493.1\|1372300_1373248_+	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	1.2e-13	22.1

DBSCAN-SWA_111

1378455 : 1381199

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01499.1\|1378455_1380594_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.7e-268	64.9
AWX01500.1\|1380734_1381199_+	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	2.3e-50	55.2

DBSCAN-SWA_112

1394609 : 1402766

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01516.1\|1394609_1395608_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	3.7e-69	43.0
AWX01517.1\|1395648_1397217_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.4e-08	27.4
AWX01518.1\|1397310_1398312_-	sugar ABC transporter permease YjfF	NA	NA	NA	NA
AWX01519.1\|1398298_1399321_-	ABC transporter permease	NA	NA	NA	NA
AWX01520.1\|1399334_1400837_-	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.0e-10	28.8
AWX01521.1\|1400969_1401926_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX01522.1\|1402235_1402766_+	inorganic pyrophosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.6e-55	62.7

DBSCAN-SWA_113

1419375 : 1421025

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01537.1\|1419375_1421025_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	30.7

DBSCAN-SWA_114

1437031 : 1438963

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01559.1\|1437031_1438963_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	36.2

DBSCAN-SWA_115

1442938 : 1455924

Lactococcus_phage(20.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01563.1\|1442938_1445380_-	ribonuclease R	Q0GXV6	Lactococcus_phage	8.4e-67	32.2
AWX01564.1\|1445418_1445844_-	HTH-type transcriptional repressor NsrR	NA	NA	NA	NA
AWX04688.1\|1446036_1447335_-	adenylosuccinate synthase	W5S5V7	Pithovirus	6.4e-66	35.4
AWX01565.1\|1447439_1447637_-	DUF2065 domain-containing protein	NA	NA	NA	NA
AWX01566.1\|1447708_1448713_-\|protease	protease modulator HflC	NA	NA	NA	NA
AWX01567.1\|1448715_1449975_-\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
AWX01568.1\|1450031_1451312_-	GTPase HflX	NA	NA	NA	NA
AWX01569.1\|1451386_1451698_-	RNA-binding protein Hfq	NA	NA	NA	NA
AWX01570.1\|1451783_1452734_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AWX01571.1\|1452726_1454571_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.2e-59	30.4
AWX01572.1\|1454580_1455924_-	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	2.6e-17	30.1

DBSCAN-SWA_116

1459840 : 1460386

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01576.1\|1459840_1460386_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-29	41.0

DBSCAN-SWA_117

1467669 : 1468647

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01580.1\|1467669_1468647_-	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	5.8e-27	28.8

DBSCAN-SWA_118

1474592 : 1475123

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01587.1\|1474592_1475123_+	hypothetical protein	A0A1W6JNX6	Morganella_phage	3.3e-45	51.6

DBSCAN-SWA_119

1481413 : 1483394

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01598.1\|1481413_1483060_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3
AWX01599.1\|1483100_1483394_-	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3

DBSCAN-SWA_120

1500231 : 1501734

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01610.1\|1500231_1501734_-	proline/glycine betaine transporter ProP	Q6JIH2	Burkholderia_virus	5.9e-55	32.0

DBSCAN-SWA_121

1508250 : 1509039

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01616.1\|1508250_1509039_+	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.9e-14	28.7

DBSCAN-SWA_122

1514589 : 1516035

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01623.1\|1514589_1515345_+	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	6.1e-16	26.7
AWX01624.1\|1515354_1516035_+	phosphonate C-P lyase system protein PhnL	F2Y1V6	Organic_Lake_phycodnavirus	3.5e-07	26.0

DBSCAN-SWA_123

1521818 : 1523333

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01631.1\|1521818_1523333_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	7.2e-08	24.0

DBSCAN-SWA_124

1527908 : 1531044

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01637.1\|1527908_1528640_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.8e-26	37.7
AWX01638.1\|1528896_1531044_+	formate dehydrogenase subunit alpha	A0A077SK27	Escherichia_phage	3.2e-30	24.2

DBSCAN-SWA_125

1534134 : 1536093

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01642.1\|1534134_1536093_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.0e-91	41.1

DBSCAN-SWA_126

1542111 : 1543461

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01649.1\|1542111_1543461_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.0e-159	72.0

DBSCAN-SWA_127

1549648 : 1553247

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01656.1\|1549648_1550173_-	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	5.1e-54	96.3
AWX01657.1\|1550424_1553247_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.8

DBSCAN-SWA_128

1556411 : 1558920

Yellowstone_lake_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01662.1\|1556411_1557491_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.6e-30	28.6
AWX01663.1\|1557507_1558920_-	replicative DNA helicase DnaB	O80281	Escherichia_phage	8.2e-200	78.3

DBSCAN-SWA_129

1565980 : 1566589

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01672.1\|1565980_1566589_-	repressor LexA	Q9G0C2	Lactococcus_phage	2.7e-14	40.7

DBSCAN-SWA_130

1573688 : 1574798

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01678.1\|1573688_1574798_-	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_131

1589546 : 1595571

Brucella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01692.1\|1589546_1589849_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.9e-22	53.8
AWX04692.1\|1589855_1590143_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.2e-12	44.3
AWX04693.1\|1590139_1591771_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
AWX01693.1\|1591887_1595571_-	methionine synthase	A0A140XBC7	Dickeya_phage	2.2e-26	91.8

DBSCAN-SWA_132

1608173 : 1613585

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01699.1\|1608173_1609763_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.4e-67	48.4
AWX01700.1\|1609778_1611071_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AWX01701.1\|1611118_1611811_-	DUF1481 domain-containing protein	NA	NA	NA	NA
AWX01702.1\|1611822_1612095_-	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	1.2e-19	56.7
AWX01703.1\|1612281_1612872_-	DUF416 family protein	NA	NA	NA	NA
AWX01704.1\|1612913_1613585_-	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	1.3e-22	30.1

DBSCAN-SWA_133

1622005 : 1632738

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01714.1\|1622005_1623547_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.3e-12	34.4
AWX01715.1\|1623727_1624036_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AWX01716.1\|1624035_1624353_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
AWX01717.1\|1624409_1628633_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	4.5e-68	27.4
AWX01718.1\|1628709_1632738_-	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	3.6e-22	29.4

DBSCAN-SWA_134

1636727 : 1641776

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01725.1\|1636727_1637912_-	elongation factor Tu	A0A2K9L516	Tupanvirus	2.6e-13	26.5
AWX01726.1\|1638789_1639740_+	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.1e-27	32.0
AWX01727.1\|1639782_1640796_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-17	29.4
AWX01728.1\|1640792_1641776_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-14	28.9

DBSCAN-SWA_135

1651322 : 1653692

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01737.1\|1651322_1653692_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	2.4e-71	30.2

DBSCAN-SWA_136

1658870 : 1663346

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01743.1\|1658870_1659845_+	glyoxylate/hydroxypyruvate reductase GhrB	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.8e-21	27.7
AWX01744.1\|1659903_1660116_-	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	1.2e-22	74.3
AWX01745.1\|1660359_1661070_-	DUF3053 domain-containing protein	NA	NA	NA	NA
AWX01746.1\|1661400_1661688_+	transcriptional regulator	NA	NA	NA	NA
AWX01747.1\|1661726_1663346_-	ABC transporter ATP-binding protein	A0A2I4R674	Erysipelothrix_phage	4.0e-25	26.1

DBSCAN-SWA_137

1667281 : 1670572

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01752.1\|1667281_1668052_-	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.9e-25	31.3
AWX01753.1\|1668054_1668597_-	Sec-independent protein translocase TatB	NA	NA	NA	NA
AWX01754.1\|1668600_1668855_-	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
AWX01755.1\|1668931_1670572_-	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.7e-42	28.4

DBSCAN-SWA_138

1682917 : 1684747

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01768.1\|1682917_1684747_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	1.3e-83	37.4

DBSCAN-SWA_139

1688673 : 1692534

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01774.1\|1688673_1690836_-	DNA helicase II	A7KV33	Bacillus_phage	2.5e-115	37.2
AWX01775.1\|1690915_1691632_-	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
AWX01776.1\|1691631_1692534_-	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	2.0e-18	29.4

DBSCAN-SWA_140

1710283 : 1714482

uncultured_marine_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01793.1\|1710283_1711414_-	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	5.1e-19	33.5
AWX01794.1\|1711418_1712096_-	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
AWX01795.1\|1712092_1713355_-	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	1.5e-22	26.4
AWX01796.1\|1713351_1714482_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.4e-27	30.2

DBSCAN-SWA_141

1718545 : 1730471

Indivirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01800.1\|1718545_1718875_-	thioredoxin TrxA	A0A1V0SD63	Indivirus	2.5e-14	38.5
AWX01801.1\|1719019_1720288_+	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	2.2e-42	31.4
AWX01802.1\|1720294_1721779_+	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
AWX01803.1\|1721829_1723854_-	DNA helicase Rep	A7KV33	Bacillus_phage	5.8e-114	37.5
AWX01804.1\|1723939_1724221_+	peptidylprolyl isomerase C	NA	NA	NA	NA
AWX04694.1\|1724275_1725097_-	serine O-acetyltransferase	NA	NA	NA	NA
AWX01805.1\|1725172_1726192_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AWX01806.1\|1726191_1726659_-	protein-export chaperone SecB	NA	NA	NA	NA
AWX01807.1\|1726690_1726942_-	glutaredoxin 3	A0A141ZMK2	Faustovirus	3.8e-07	38.2
AWX01808.1\|1726953_1727385_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AWX01809.1\|1727633_1729178_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AWX01810.1\|1729187_1730471_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	4.6e-08	35.4

DBSCAN-SWA_142

1734587 : 1737968

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01815.1\|1734587_1735616_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
AWX01816.1\|1735625_1736822_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	4.6e-34	27.8
AWX01817.1\|1737035_1737968_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	2.9e-36	36.4

DBSCAN-SWA_143

1747660 : 1755259

Catovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01827.1\|1747660_1748650_+	glycosyltransferase	A0A1V0SAH6	Catovirus	7.2e-09	27.3
AWX01828.1\|1748716_1749991_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AWX01829.1\|1749990_1750761_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AWX01830.1\|1750764_1751244_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.4e-26	43.9
AWX01831.1\|1751246_1752056_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	1.2e-25	32.6
AWX01832.1\|1752128_1752296_-	50S ribosomal protein L33	NA	NA	NA	NA
AWX01833.1\|1752318_1752555_-	50S ribosomal protein L28	NA	NA	NA	NA
AWX01834.1\|1752772_1753438_-	JAB domain-containing protein	NA	NA	NA	NA
AWX04696.1\|1753611_1754823_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	5.1e-41	32.6
AWX04695.1\|1754803_1755259_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	9.5e-49	60.8

DBSCAN-SWA_144

1767725 : 1772734

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01848.1\|1767725_1769396_-	NAD-dependent DNA ligase LigB	A0A218MKC8	uncultured_virus	1.1e-20	23.3
AWX01849.1\|1769413_1769599_+	hypothetical protein	NA	NA	NA	NA
AWX01850.1\|1769646_1770270_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	9.7e-20	35.0
AWX01851.1\|1770324_1770600_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AWX01852.1\|1770619_1772734_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis(diphosphate) 3'-diphosphatase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5

DBSCAN-SWA_145

1776944 : 1778336

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01856.1\|1776944_1778336_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	2.3e-69	95.9

DBSCAN-SWA_146

1784500 : 1793657

uncultured_Caudovirales_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01860.1\|1784500_1785724_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	5.5e-160	69.4
AWX01861.1\|1785819_1787445_-	ATP-dependent helicase	Q331U3	Clostridium_botulinum_C_phage	1.1e-09	21.9
AWX01862.1\|1787446_1789147_-	ATP-dependent endonuclease	NA	NA	NA	NA
AWX01863.1\|1789352_1789703_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.8e-23	50.9
AWX01864.1\|1789750_1790113_+	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AWX01865.1\|1790130_1791882_+	arsenical pump-driving ATPase	NA	NA	NA	NA
AWX01866.1\|1791929_1793219_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.6e-170	73.8
AWX01867.1\|1793231_1793657_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.0e-52	73.6

DBSCAN-SWA_147

1797122 : 1800369

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01872.1\|1797122_1797836_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	9.5e-96	72.6
AWX04697.1\|1797837_1798161_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AWX01873.1\|1798291_1798687_-	hypothetical protein	NA	NA	NA	NA
AWX01874.1\|1798795_1799815_-	inovirus Gp2 family protein	NA	NA	NA	NA
AWX01875.1\|1800165_1800369_-	AlpA family phage regulatory protein	A0A1V0E8E5	Vibrio_phage	7.5e-06	41.1

DBSCAN-SWA_148

1804256 : 1805078

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01880.1\|1804256_1805078_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.8e-45	38.0

DBSCAN-SWA_149

1809310 : 1810294

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01888.1\|1809310_1810294_+	hydroxyacid dehydrogenase	Q9JMN3	Wolbachia_phage	2.4e-73	44.2

DBSCAN-SWA_150

1821792 : 1825967

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01901.1\|1821792_1822317_-	hypothetical protein	A0A1W6JNX6	Morganella_phage	9.9e-50	58.9
AWX01902.1\|1822434_1823160_+	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	5.2e-41	42.7
AWX01903.1\|1823259_1823670_+	hydroxyisourate hydrolase	NA	NA	NA	NA
AWX01904.1\|1823772_1824732_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
AWX01905.1\|1824878_1825967_+	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	3.9e-125	62.2

DBSCAN-SWA_151

1831260 : 1833357

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01912.1\|1831260_1833357_-	peptidase domain-containing ABC transporter	F2Y1V5	Organic_Lake_phycodnavirus	3.9e-12	23.9

DBSCAN-SWA_152

1859747 : 1860905

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01937.1\|1859747_1860905_+	MFS transporter	S4TR35	Salmonella_phage	1.3e-28	26.6

DBSCAN-SWA_153

1871872 : 1872877

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01950.1\|1871872_1872877_-	alpha/beta hydrolase	A0A2K9KZN8	Tupanvirus	2.6e-06	28.4

DBSCAN-SWA_154

1878334 : 1880023

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01956.1\|1878334_1880023_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.6e-59	31.5

DBSCAN-SWA_155

1883263 : 1884448

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04699.1\|1883263_1884448_+	multidrug transporter EmrD	S4TR35	Salmonella_phage	1.6e-15	25.6

DBSCAN-SWA_156

1895834 : 1896810

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01971.1\|1895834_1896263_-	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	1.1e-14	37.3
AWX01972.1\|1896399_1896810_-	heat shock protein IbpA	A0A218MKI2	uncultured_virus	5.4e-19	39.2

DBSCAN-SWA_157

1900254 : 1901403

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01976.1\|1900254_1901403_-	galactonate dehydratase	Q6A202	Oenococcus_phage	9.4e-53	33.1

DBSCAN-SWA_158

1906825 : 1914213

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01983.1\|1906825_1909237_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.1e-114	34.2
AWX01984.1\|1909265_1910339_-	DNA replication/repair protein RecF	NA	NA	NA	NA
AWX01985.1\|1910338_1911439_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.5e-52	35.0
AWX01986.1\|1911443_1912838_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
AWX01987.1\|1913163_1913364_-	hypothetical protein	NA	NA	NA	NA
AWX01988.1\|1913475_1913616_+	50S ribosomal protein L34	NA	NA	NA	NA
AWX01989.1\|1913632_1913992_+	ribonuclease P protein component	NA	NA	NA	NA
AWX01990.1\|1913955_1914213_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7

DBSCAN-SWA_159

1921081 : 1927935

Moraxella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX01997.1\|1921081_1922422_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.6e-65	37.6
AWX01998.1\|1922584_1923250_+	6-phosphogluconate phosphatase	NA	NA	NA	NA
AWX01999.1\|1923344_1924070_-	phosphate transport system regulator PhoU	NA	NA	NA	NA
AWX02000.1\|1924096_1924870_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
AWX02001.1\|1924917_1925808_-	phosphate ABC transporter permease PtsA	NA	NA	NA	NA
AWX02002.1\|1925807_1926767_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
AWX02003.1\|1926894_1927935_-	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.3e-48	38.7

DBSCAN-SWA_160

1933567 : 1937008

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02007.1\|1933567_1935397_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.2e-131	42.9
AWX02008.1\|1935637_1937008_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	2.9e-32	33.2

DBSCAN-SWA_161

1948791 : 1949784

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02022.1\|1948791_1949784_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.5e-48	37.0

DBSCAN-SWA_162

1952948 : 1960897

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02025.1\|1952948_1954817_+	low affinity potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.3e-64	29.7
AWX02026.1\|1955042_1955462_+	D-ribose pyranase	NA	NA	NA	NA
AWX02027.1\|1955469_1956975_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	7.6e-18	21.7
AWX02028.1\|1956979_1957945_+	ribose ABC transporter permease	NA	NA	NA	NA
AWX02029.1\|1957972_1958863_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	3.3e-05	23.7
AWX02030.1\|1958971_1959901_+	ribokinase	NA	NA	NA	NA
AWX02031.1\|1959904_1960897_+	transcriptional regulator RbsR	C6ZCU4	Enterobacteria_phage	1.1e-36	33.7

DBSCAN-SWA_163

1973032 : 1975825

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02039.1\|1973032_1975825_+	DNA polymerase I	A0A1B1IWN2	uncultured_Mediterranean_phage	8.4e-55	27.6

DBSCAN-SWA_164

1979696 : 1982170

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02044.1\|1979696_1981109_-	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	1.1e-05	27.9
AWX02045.1\|1981120_1982170_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	3.4e-09	26.1

DBSCAN-SWA_165

1993875 : 1996653

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02054.1\|1993875_1994766_-	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	2.1e-63	94.6
AWX02055.1\|1994921_1995818_+	sugar kinase	NA	NA	NA	NA
AWX02056.1\|1995852_1996653_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.1e-23	30.5

DBSCAN-SWA_166

2017757 : 2019260

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02078.1\|2017757_2019260_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-11	25.7

DBSCAN-SWA_167

2027440 : 2030923

Bacillus_thuringiensis_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02087.1\|2027440_2028061_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.2e-64	59.8
AWX02088.1\|2028127_2028802_+	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
AWX02089.1\|2028854_2030228_-	two-component system sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	7.2e-15	25.6
AWX02090.1\|2030224_2030923_-	DNA-binding transcriptional regulator CpxR	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3

DBSCAN-SWA_168

2042780 : 2047244

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02102.1\|2042780_2043626_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	7.5e-15	28.7
AWX02103.1\|2044025_2044265_+	septal ring assembly protein ZapB	NA	NA	NA	NA
AWX02104.1\|2044345_2044831_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
AWX02105.1\|2044923_2045850_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
AWX02106.1\|2045912_2047244_-	HslU--HslV peptidase ATPase subunit	A0A173GE36	Erwinia_phage	1.9e-44	29.7

DBSCAN-SWA_169

2062576 : 2065755

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02119.1\|2062576_2063239_-	fructose-6-phosphate aldolase	A0A0E3FJJ0	Synechococcus_phage	2.2e-30	34.6
AWX02120.1\|2063253_2065755_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.9e-11	25.9

DBSCAN-SWA_170

2084738 : 2086589

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02136.1\|2084738_2086589_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	1.0e-11	28.4

DBSCAN-SWA_171

2096669 : 2098316

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02142.1\|2096669_2098316_+	acetolactate synthase 2 catalytic subunit	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	1.5e-64	31.9

DBSCAN-SWA_172

2124118 : 2125957

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02164.1\|2124118_2125957_+\|tRNA	selenocysteinyl-tRNA-specific translation elongation factor SelB	A0A2K9KZ60	Tupanvirus	6.9e-13	25.1

DBSCAN-SWA_173

2149218 : 2150760

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02184.1\|2149218_2150760_-	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-15	29.3

DBSCAN-SWA_174

2155085 : 2156081

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02187.1\|2155085_2156081_-	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	1.8e-12	24.3

DBSCAN-SWA_175

2164808 : 2165423

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02194.1\|2164808_2165423_+	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	6.2e-19	34.0

DBSCAN-SWA_176

2211792 : 2213835

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02225.1\|2211792_2213835_+	oligopeptidase A	A0A1V0SD92	Indivirus	5.2e-46	22.9

DBSCAN-SWA_177

2218811 : 2219837

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02230.1\|2218811_2219837_+	tellurium resistance protein TerC	K7QKE8	Escherichia_phage	2.1e-75	47.7

DBSCAN-SWA_178

2239027 : 2240105

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02253.1\|2239027_2239693_-	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	3.3e-58	55.3
AWX02254.1\|2239862_2240105_+	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	6.0e-10	80.6

DBSCAN-SWA_179

2243219 : 2246094

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02258.1\|2243219_2245391_-	zinc/cadmium/mercury/lead-transporting ATPase	E4ZFI9	Streptococcus_phage	9.9e-120	37.3
AWX02259.1\|2245467_2246094_-	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.9e-32	63.7

DBSCAN-SWA_180

2249098 : 2253322

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02264.1\|2249098_2249770_+	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	3.9e-14	26.6
AWX02265.1\|2249756_2250812_+	cell division protein FtsX	NA	NA	NA	NA
AWX02266.1\|2251062_2251920_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.2e-45	42.3
AWX02267.1\|2252056_2253322_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	3.7e-26	27.8

DBSCAN-SWA_181

2258898 : 2260378

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02273.1\|2258898_2259663_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.8e-13	26.0
AWX02274.1\|2259664_2260378_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	1.1e-14	31.2

DBSCAN-SWA_182

2263779 : 2265587

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02278.1\|2263779_2264850_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.2e-21	32.5
AWX02279.1\|2264846_2265587_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	9.2e-09	24.1

DBSCAN-SWA_183

2282707 : 2285155

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02293.1\|2282707_2285155_+	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	1.2e-33	83.3

DBSCAN-SWA_184

2288232 : 2288991

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02297.1\|2288232_2288991_+	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.8e-21	30.3

DBSCAN-SWA_185

2292331 : 2294725

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02299.1\|2292331_2294725_+	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	4.7e-14	41.4

DBSCAN-SWA_186

2299877 : 2300660

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02304.1\|2299877_2300660_+	pimeloyl-[acyl-carrier protein] methyl ester esterase	A0A0M3UKI8	Mycobacterium_phage	3.1e-07	32.0

DBSCAN-SWA_187

2306897 : 2310677

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02309.1\|2306897_2307617_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.5e-29	34.7
AWX02310.1\|2307613_2308960_+	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	2.5e-12	24.1
AWX02311.1\|2309057_2310677_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.5e-139	51.7

DBSCAN-SWA_188

2327459 : 2328272

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02327.1\|2327459_2328272_+	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	2.7e-70	50.2

DBSCAN-SWA_189

2338520 : 2345066

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02339.1\|2338520_2339084_+	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	5.1e-60	56.5
AWX02340.1\|2339156_2340392_+	aspartate aminotransferase family protein	NA	NA	NA	NA
AWX02341.1\|2340388_2342476_-	hypothetical protein	H9YQA8	environmental_Halophage	2.0e-64	84.8
AWX02342.1\|2342533_2343166_-	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
AWX02343.1\|2343476_2343881_+	OsmC family protein	NA	NA	NA	NA
AWX02344.1\|2343947_2344817_-	phosphoribulokinase	NA	NA	NA	NA
AWX02345.1\|2344847_2345066_-	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	1.1e-05	39.1

DBSCAN-SWA_190

2350884 : 2356252

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02352.1\|2350884_2351844_+	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	9.9e-56	93.5
AWX02353.1\|2351846_2352464_+	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
AWX02354.1\|2352463_2353360_+	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
AWX02355.1\|2353399_2354332_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWX02356.1\|2354347_2356252_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	5.9e-76	33.5

DBSCAN-SWA_191

2364059 : 2367428

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02369.1\|2364059_2366174_+	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-57	27.5
AWX02370.1\|2366243_2367428_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1

DBSCAN-SWA_192

2387314 : 2391639

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02407.1\|2387314_2388262_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	8.4e-07	30.5
AWX02408.1\|2388286_2388796_-	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-18	40.3
AWX02409.1\|2388923_2390048_+	DNA-protecting protein DprA	NA	NA	NA	NA
AWX02410.1\|2390019_2390493_+	DUF494 domain-containing protein	NA	NA	NA	NA
AWX02411.1\|2390519_2391074_+	hypothetical protein	NA	NA	NA	NA
AWX02412.1\|2391066_2391639_+	L-threonylcarbamoyladenylate synthase type 1 TsaC	S4VW33	Pandoravirus	1.9e-09	25.7

DBSCAN-SWA_193

2405052 : 2407137

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02420.1\|2405052_2407137_-	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	7.0e-22	34.8

DBSCAN-SWA_194

2420391 : 2421435

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02435.1\|2420391_2421435_+	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_195

2440292 : 2441660

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02452.1\|2440292_2441660_-\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	26.4

DBSCAN-SWA_196

2445623 : 2449625

Pseudomonas_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04712.1\|2445623_2446121_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	3.8e-27	54.6
AWX02459.1\|2446223_2447006_+	transcriptional regulator NanR	NA	NA	NA	NA
AWX02460.1\|2447128_2448022_+	N-acetylneuraminate lyase	NA	NA	NA	NA
AWX02461.1\|2448134_2449625_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.4e-08	21.3

DBSCAN-SWA_197

2457615 : 2484105

Staphylococcus_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04713.1\|2457615_2458557_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.5e-16	33.6
AWX02466.1\|2458536_2460039_-	ATP-binding protein	A0A248XCZ8	Klebsiella_phage	4.8e-81	43.4
AWX02467.1\|2460176_2461823_+	DAK2 domain-containing protein	NA	NA	NA	NA
AWX02468.1\|2461970_2462990_-	NAD(P)-dependent alcohol dehydrogenase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	5.4e-44	30.7
AWX02469.1\|2463073_2463577_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWX02470.1\|2463700_2466556_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-141	36.9
AWX02471.1\|2466555_2466999_-	DNA polymerase III subunit chi	NA	NA	NA	NA
AWX02472.1\|2467067_2468579_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.2e-47	36.2
AWX02473.1\|2468844_2469945_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
AWX02474.1\|2469944_2471027_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
AWX02475.1\|2471164_2473498_+	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	8.4e-40	30.7
AWX02476.1\|2473730_2474384_+	isoprenoid biosynthesis protein ElbB	NA	NA	NA	NA
AWX02477.1\|2474380_2475106_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AWX02478.1\|2475145_2475418_-	HPr family phosphocarrier protein	NA	NA	NA	NA
AWX02479.1\|2475414_2476269_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
AWX02480.1\|2476314_2476806_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
AWX02481.1\|2476888_2477176_-	ribosome hibernation promoting factor	NA	NA	NA	NA
AWX02482.1\|2477198_2478632_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
AWX02483.1\|2478679_2479405_-	lipopolysaccharide ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	27.4
AWX02484.1\|2479411_2479966_-	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
AWX02485.1\|2479934_2480510_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AWX02486.1\|2480506_2481073_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	8.5e-55	75.6
AWX02487.1\|2481087_2482074_-	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.1e-38	31.7
AWX02488.1\|2482087_2483065_-	calcium/sodium antiporter	NA	NA	NA	NA
AWX02489.1\|2483006_2483207_-	hypothetical protein	NA	NA	NA	NA
AWX02490.1\|2483292_2484105_+	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	2.4e-18	29.8

DBSCAN-SWA_198

2488149 : 2489637

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02496.1\|2488149_2488437_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	1.0e-16	69.8
AWX02497.1\|2488665_2489637_-	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	3.5e-08	26.2

DBSCAN-SWA_199

2492768 : 2494471

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02502.1\|2492768_2493812_-	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	1.6e-11	23.0
AWX02503.1\|2493808_2494471_-	two-component system response regulator PmrA	W8CYM9	Bacillus_phage	9.0e-32	38.1

DBSCAN-SWA_200

2497913 : 2509575

Micromonas_pusilla_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02508.1\|2497913_2499848_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	2.0e-116	43.5
AWX02509.1\|2499946_2500795_+	dihydropteroate synthase	S4W084	Pandoravirus	7.5e-23	29.0
AWX02510.1\|2500787_2502125_+	phosphoglucosamine mutase	NA	NA	NA	NA
AWX02511.1\|2502347_2502680_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AWX02512.1\|2502962_2504309_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	9.6e-65	94.4
AWX02513.1\|2504867_2505332_+	ribosome maturation factor RimP	NA	NA	NA	NA
AWX02514.1\|2505360_2506863_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AWX02515.1\|2506887_2509575_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.9e-27	27.0

DBSCAN-SWA_201

2515016 : 2516912

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02522.1\|2515016_2516912_+	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	5.4e-53	31.5

DBSCAN-SWA_202

2522597 : 2530389

Invertebrate_iridovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02529.1\|2522597_2522927_-	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	8.8e-12	46.8
AWX02530.1\|2522941_2523376_+	hypothetical protein	NA	NA	NA	NA
AWX02531.1\|2523355_2523874_-	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.8e-11	29.3
AWX02532.1\|2524002_2524647_+	hypothetical protein	NA	NA	NA	NA
AWX02533.1\|2524687_2525725_+	permease	NA	NA	NA	NA
AWX02534.1\|2525775_2526351_-	osmotically-inducible protein OsmY	NA	NA	NA	NA
AWX02535.1\|2526360_2526951_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	4.1e-12	31.8
AWX02536.1\|2526972_2527368_-	YraN family protein	NA	NA	NA	NA
AWX02537.1\|2527325_2529464_-	penicillin-binding protein activator	NA	NA	NA	NA
AWX02538.1\|2529525_2530389_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.3e-50	44.2

DBSCAN-SWA_203

2547768 : 2548914

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02554.1\|2547768_2548914_+	glycerate 2-kinase	W6LM47	Streptococcus_phage	4.1e-48	39.0

DBSCAN-SWA_204

2554598 : 2556893

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02558.1\|2554598_2556893_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.5e-158	41.7

DBSCAN-SWA_205

2574080 : 2575046

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02578.1\|2574080_2575046_-	TerC family protein	A0A291LBC5	Escherichia_phage	5.2e-36	33.4

DBSCAN-SWA_206

2583058 : 2584546

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02585.1\|2583058_2584546_+	autoinducer 2 ABC transporter ATP-binding protein LsrA	W5SAS9	Pithovirus	4.9e-09	28.6

DBSCAN-SWA_207

2590258 : 2595381

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02593.1\|2590258_2591665_-	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	3.9e-32	27.4
AWX02594.1\|2592060_2593581_+	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	1.1e-32	37.1
AWX02595.1\|2593821_2595381_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-08	31.9

DBSCAN-SWA_208

2598977 : 2604301

Vibrio_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02600.1\|2598977_2600822_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
AWX02601.1\|2600974_2602720_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.9e-76	39.0
AWX02602.1\|2602835_2603051_-	30S ribosomal protein S21	NA	NA	NA	NA
AWX02603.1\|2603287_2604301_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.3e-109	58.9

DBSCAN-SWA_209

2613620 : 2614862

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02616.1\|2613620_2614862_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	6.1e-90	50.1

DBSCAN-SWA_210

2619999 : 2622834

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02620.1\|2619999_2621430_+	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.5e-39	29.0
AWX02621.1\|2621507_2621804_-	hypothetical protein	NA	NA	NA	NA
AWX02622.1\|2622180_2622834_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-45	45.5

DBSCAN-SWA_211

2629818 : 2637928

Ralstonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02629.1\|2629818_2630979_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	5.9e-87	43.4
AWX02630.1\|2630981_2631647_-	DUF1190 family protein	A0A173GEW8	Erwinia_phage	1.2e-39	47.5
AWX02631.1\|2631837_2633316_-	outer membrane channel protein TolC	NA	NA	NA	NA
AWX02632.1\|2633519_2634152_+	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.5e-20	36.2
AWX02633.1\|2634148_2634571_+	DUF1249 family protein	NA	NA	NA	NA
AWX02634.1\|2634598_2635426_+	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
AWX02635.1\|2635425_2636007_+	esterase YqiA	NA	NA	NA	NA
AWX02636.1\|2636035_2637928_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.8e-91	34.8

DBSCAN-SWA_212

2647707 : 2656079

Stx_converting_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02647.1\|2647707_2648109_+	TIGR00156 family protein	A0A1I9LJU6	Stx_converting_phage	2.8e-20	44.4
AWX02648.1\|2648227_2650486_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.2e-85	35.1
AWX02649.1\|2650648_2651386_+	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
AWX02650.1\|2651447_2652860_+	cell division protein FtsP	NA	NA	NA	NA
AWX02651.1\|2652990_2655165_+	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	3.1e-105	71.7
AWX02652.1\|2655251_2656079_-	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.9e-63	44.9

DBSCAN-SWA_213

2665190 : 2672294

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02664.1\|2665190_2666738_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9
AWX02665.1\|2666740_2667490_-	L-fucose operon activator	NA	NA	NA	NA
AWX02666.1\|2667566_2668433_-	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
AWX02667.1\|2668616_2670479_+	bifunctional glutathionylspermidine amidase/synthase	Q56ES0	Aeromonas_virus	5.9e-20	23.8
AWX02668.1\|2670531_2670966_-	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
AWX02669.1\|2670962_2672294_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	B9UDL7	Salmonella_phage	8.5e-05	34.8

DBSCAN-SWA_214

2682240 : 2684025

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02675.1\|2682240_2684025_+	hybrid sensor histidine kinase/response regulator	A0A2K9L0Z8	Tupanvirus	1.8e-13	23.3

DBSCAN-SWA_215

2725582 : 2726737

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02717.1\|2725582_2726737_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.1e-128	63.2

DBSCAN-SWA_216

2739507 : 2741056

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02729.1\|2739507_2740278_+	alpha/beta hydrolase	A0A249XTU1	Mycobacterium_phage	1.6e-08	35.7
AWX02730.1\|2740261_2741056_+	short chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-05	25.5

DBSCAN-SWA_217

2756430 : 2757663

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02743.1\|2756430_2757663_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.1e-102	47.6

DBSCAN-SWA_218

2765451 : 2768325

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02751.1\|2765451_2768325_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	4.1e-262	51.1

DBSCAN-SWA_219

2772777 : 2774211

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02757.1\|2772777_2774211_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	5.7e-31	26.2

DBSCAN-SWA_220

2778627 : 2786216

Brevibacillus_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02764.1\|2778627_2779524_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.5e-29	29.3
AWX02765.1\|2779552_2780266_+	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
AWX02766.1\|2780271_2782005_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	9.2e-60	28.5
AWX02767.1\|2782095_2783193_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	39.0
AWX02768.1\|2783203_2784721_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	7.7e-87	37.5
AWX02769.1\|2784769_2785312_-	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
AWX02770.1\|2785475_2786216_+	LysM peptidoglycan-binding domain-containing protein	A0A7K9	Microcystis_virus	2.2e-10	35.7

DBSCAN-SWA_221

2792928 : 2795829

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02777.1\|2792928_2794911_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	1.6e-153	46.0
AWX02778.1\|2794944_2795829_-	SDR family NAD(P)-dependent oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.5e-79	56.3

DBSCAN-SWA_222

2813879 : 2818879

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02800.1\|2813879_2814641_+	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-19	32.1
AWX02801.1\|2814953_2816369_+	sugar porter family MFS transporter	O13311	Aichi_virus	7.1e-26	26.5
AWX02802.1\|2816451_2817738_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX02803.1\|2817751_2818879_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.8e-11	24.5

DBSCAN-SWA_223

2825816 : 2826854

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02812.1\|2825816_2826854_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.8e-27	27.0

DBSCAN-SWA_224

2832832 : 2834992

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02818.1\|2832832_2834992_+	bifunctional acyl-ACP--phospholipid O-acyltransferase/long-chain-fatty-acid--ACP ligase	A0A2H4PQU7	Staphylococcus_phage	2.9e-18	26.5

DBSCAN-SWA_225

2839710 : 2843861

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02824.1\|2839710_2841957_+	phosphoenolpyruvate-protein phosphotransferase PtsP	A0A1V0SGR7	Hokovirus	5.4e-12	23.9
AWX02825.1\|2842184_2843060_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AWX02826.1\|2843066_2843861_+	thymidylate synthase	R4IFY1	Cronobacter_phage	2.0e-118	62.9

DBSCAN-SWA_226

2849290 : 2864740

Klosneuvirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02832.1\|2849290_2852173_+	pitrilysin	A0A1V0SJA4	Klosneuvirus	1.1e-60	23.9
AWX02833.1\|2852169_2855712_+	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	3.3e-11	21.0
AWX02834.1\|2855708_2857529_+	exodeoxyribonuclease V subunit alpha	A0A2P0VMS9	Tetraselmis_virus	3.3e-23	27.1
AWX02835.1\|2857562_2858894_-	amino-acid N-acetyltransferase	NA	NA	NA	NA
AWX02836.1\|2859121_2860375_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.4e-12	28.0
AWX02837.1\|2860873_2861119_+	hypothetical protein	NA	NA	NA	NA
AWX02838.1\|2861118_2862216_+	murein transglycosylase A	NA	NA	NA	NA
AWX02839.1\|2862291_2863098_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.1e-15	33.7
AWX02840.1\|2863088_2863535_-	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
AWX02841.1\|2863534_2864740_-	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	3.5e-74	38.0

DBSCAN-SWA_227

2868012 : 2868768

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02846.1\|2868012_2868768_-	flap endonuclease Xni	F8WQ40	Bacillus_phage	2.7e-08	28.1

DBSCAN-SWA_228

2873585 : 2874428

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02850.1\|2873585_2874428_-	preQ(1) synthase	A0A2I7SAX1	Vibrio_phage	1.8e-40	36.4

DBSCAN-SWA_229

2878914 : 2886997

Oenococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04724.1\|2878914_2880255_+	glucarate dehydratase	Q6A202	Oenococcus_phage	4.5e-06	24.0
AWX02857.1\|2880270_2881608_+	glucarate dehydratase	NA	NA	NA	NA
AWX02858.1\|2881685_2882831_+	glycerate kinase	W6LM47	Streptococcus_phage	3.3e-50	41.8
AWX02859.1\|2882881_2885641_-	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.3e-55	29.7
AWX02860.1\|2885698_2886997_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.0e-38	28.0

DBSCAN-SWA_230

2890362 : 2893381

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02863.1\|2890362_2892000_+	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	50.9
AWX02864.1\|2892082_2893381_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.4e-129	57.9

DBSCAN-SWA_231

2896745 : 2897417

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02868.1\|2896745_2897417_+	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	1.1e-11	31.4

DBSCAN-SWA_232

2911586 : 2913616

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02879.1\|2911586_2913011_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	1.0e-35	28.4
AWX02880.1\|2913010_2913616_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	5.0e-29	38.6

DBSCAN-SWA_233

2916627 : 2920302

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02886.1\|2916627_2917389_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.9e-55	47.2
AWX02887.1\|2917382_2918009_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.7e-36	50.0
AWX02888.1\|2918125_2919250_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	3.8e-06	35.1
AWX02889.1\|2919309_2920302_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6

DBSCAN-SWA_234

2925845 : 2931270

Cafeteria_roenbergensis_virus(33.33%)

integrase

attL 2923371:2923383|attR 2930977:2930989

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2923371:2923383	attL	NA	NA	NA	NA
AWX02897.1\|2925845_2928413_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	4.9e-33	21.1
AWX02898.1\|2928572_2930027_+\|integrase	integrase	A0A0R6PHE0	Moraxella_phage	5.8e-23	28.3
AWX02899.1\|2930038_2930614_+	hypothetical protein	NA	NA	NA	NA
AWX02900.1\|2930703_2931270_-	helix-turn-helix domain-containing protein	M1PL54	Cellulophaga_phage	4.7e-37	44.4
2930977:2930989	attR	NA	NA	NA	NA

DBSCAN-SWA_235

2940792 : 2946852

Liberibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02912.1\|2940792_2944032_-	DEAD/DEAH box helicase	A0A220A398	Liberibacter_phage	5.2e-64	28.4
AWX02913.1\|2944090_2945308_-	restriction endonuclease subunit S	NA	NA	NA	NA
AWX02914.1\|2945304_2946852_-	DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	2.5e-48	28.2

DBSCAN-SWA_236

2950215 : 2951937

Bdellovibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04726.1\|2950215_2951937_+	ATP-dependent helicase	H9C0J4	Bdellovibrio_phage	1.3e-08	24.9

DBSCAN-SWA_237

2956474 : 2957236

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02919.1\|2956474_2957236_-	ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	3.7e-13	29.8

DBSCAN-SWA_238

2976357 : 2977371

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02939.1\|2976357_2977371_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.4e-28	28.0

DBSCAN-SWA_239

2985698 : 2986664

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02946.1\|2985698_2986664_-	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	2.0e-35	33.8

DBSCAN-SWA_240

2992227 : 3000162

Bodo_saltans_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02954.1\|2992227_2992881_+	ATP-binding cassette domain-containing protein	A0A2H4UU96	Bodo_saltans_virus	4.0e-08	25.7
AWX02955.1\|2992877_2993738_+	metal ABC transporter permease	NA	NA	NA	NA
AWX02956.1\|2993752_2994631_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX02957.1\|2994761_2995259_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	9.1e-29	47.1
AWX02958.1\|2995348_2996407_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.5e-113	63.1
AWX02959.1\|2996475_2996976_+	recombination regulator RecX	NA	NA	NA	NA
AWX02960.1\|2997107_2999735_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.2
AWX02961.1\|2999976_3000162_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7

DBSCAN-SWA_241

3014414 : 3019684

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02973.1\|3014414_3015617_-	proline/glycine betaine ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	3.2e-27	38.3
AWX02974.1\|3015951_3016911_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	1.3e-135	72.1
AWX02975.1\|3016920_3019065_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	7.8e-202	48.8
AWX02976.1\|3019037_3019448_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.0e-17	44.3
AWX02977.1\|3019444_3019684_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.7e-12	41.9

DBSCAN-SWA_242

3024542 : 3025148

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX02986.1\|3024542_3025148_+	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	1.6e-06	25.2

DBSCAN-SWA_243

3040934 : 3045215

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03000.1\|3040934_3041282_-	addiction module antidote protein, HigA family	A0A222YWD7	Escherichia_phage	1.6e-32	63.3
AWX03001.1\|3041292_3041592_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.1e-28	61.7
AWX04731.1\|3041842_3043003_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AWX03002.1\|3043022_3045215_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-32	30.7

DBSCAN-SWA_244

3060030 : 3066117

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03006.1\|3060030_3060753_+	SDR family NAD(P)-dependent oxidoreductase	A0A2P0VP75	Tetraselmis_virus	2.0e-08	27.1
AWX03007.1\|3061253_3063452_-	glycoside hydrolase family 2	NA	NA	NA	NA
AWX03008.1\|3063420_3066117_-	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.3e-65	34.4

DBSCAN-SWA_245

3093130 : 3097456

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04733.1\|3093130_3093730_+	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	4.4e-09	36.5
AWX03031.1\|3093947_3095303_-	calmodulin-binding protein	NA	NA	NA	NA
AWX03032.1\|3095299_3097456_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	5.2e-36	41.7

DBSCAN-SWA_246

3103685 : 3105194

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03038.1\|3103685_3105194_-	DUF4041 domain-containing protein	Q5G8X0	Enterobacteria_phage	2.3e-51	46.3

DBSCAN-SWA_247

3111382 : 3111658

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03045.1\|3111382_3111658_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	1.4e-18	62.5

DBSCAN-SWA_248

3114827 : 3125141

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03051.1\|3114827_3116897_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.5e-72	34.8
AWX03052.1\|3116932_3117148_-	AlpA family transcriptional regulator	NA	NA	NA	NA
AWX03053.1\|3117510_3121983_-	ATP-binding protein	A0A2H4PQT3	Staphylococcus_phage	7.4e-69	27.0
AWX03054.1\|3122145_3122790_-	hypothetical protein	NA	NA	NA	NA
AWX03055.1\|3122791_3124039_-	DUF4102 domain-containing protein	A0A1B5FPC6	Escherichia_phage	8.5e-140	62.0
AWX03056.1\|3124658_3125141_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8

DBSCAN-SWA_249

3138126 : 3141687

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03073.1\|3138126_3139347_-	diguanylate cyclase	A0A2K8I9Y5	Pseudomonas_phage	1.2e-05	39.8
AWX03074.1\|3139339_3139876_-	YfiR family protein	NA	NA	NA	NA
AWX03075.1\|3140029_3140404_-	DUF2799 domain-containing protein	NA	NA	NA	NA
AWX03076.1\|3140616_3141687_+	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	51.5

DBSCAN-SWA_250

3148485 : 3151059

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03084.1\|3148485_3151059_+	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	2.6e-127	35.5

DBSCAN-SWA_251

3156704 : 3157157

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03085.1\|3156704_3157157_+	DUF4385 domain-containing protein	M4QHR1	Cyanophage	3.9e-34	50.0

DBSCAN-SWA_252

3163914 : 3180974

Achromobacter_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03090.1\|3163914_3164334_-	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	1.2e-13	37.2
AWX03091.1\|3164538_3165624_+\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
AWX03092.1\|3165663_3166353_-	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	48.8
AWX03093.1\|3166668_3167052_+	autonomous glycyl radical cofactor GrcA	A0A193GZ98	Escherichia_phage	2.1e-33	71.8
AWX03094.1\|3167104_3168433_-	ATP-dependent RNA helicase SrmB	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-48	33.5
AWX03095.1\|3168565_3169303_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AWX03096.1\|3169287_3170907_-	L-aspartate oxidase	NA	NA	NA	NA
AWX03097.1\|3171334_3171910_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
AWX03098.1\|3171941_3172592_+	anti-sigma-E factor RseA	NA	NA	NA	NA
AWX03099.1\|3172591_3173545_+	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
AWX03100.1\|3173541_3174018_+	SoxR-reducing system protein RseC	NA	NA	NA	NA
AWX03101.1\|3174203_3176009_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.5e-23	25.7
AWX03102.1\|3176024_3176999_+	signal peptidase I	NA	NA	NA	NA
AWX03103.1\|3177222_3177903_+	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	9.6e-21	39.0
AWX03104.1\|3177899_3178805_+	GTPase Era	NA	NA	NA	NA
AWX03105.1\|3178822_3179530_+	DNA repair protein RecO	NA	NA	NA	NA
AWX03106.1\|3179605_3180337_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
AWX03107.1\|3180336_3180717_+	holo-ACP synthase	NA	NA	NA	NA
AWX03108.1\|3180713_3180974_-	4Fe-4S dicluster domain-containing protein	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-17	51.2

DBSCAN-SWA_253

3187176 : 3198357

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03115.1\|3187176_3191064_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	7.7e-131	59.0
AWX04736.1\|3191596_3193030_+	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	6.8e-16	27.9
AWX03116.1\|3193026_3193779_+	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
AWX03117.1\|3193775_3195113_+	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	8.8e-10	33.0
AWX03118.1\|3195193_3195532_+	nitrogen regulatory protein P-II	NA	NA	NA	NA
AWX03119.1\|3195608_3196799_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
AWX03120.1\|3196871_3197117_+	hypothetical protein	NA	NA	NA	NA
AWX03121.1\|3197103_3198357_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4

DBSCAN-SWA_254

3205706 : 3212012

Faustovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03130.1\|3205706_3206921_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6
AWX03131.1\|3206945_3207332_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	77.3
AWX03132.1\|3207345_3207669_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.5e-21	46.7
AWX03133.1\|3207745_3208261_+	co-chaperone HscB	NA	NA	NA	NA
AWX03134.1\|3208275_3210126_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.0e-105	41.1
AWX03135.1\|3210127_3210463_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AWX03136.1\|3210464_3210665_+	Fe-S assembly protein IscX	NA	NA	NA	NA
AWX03137.1\|3210725_3212012_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	4.9e-34	39.4

DBSCAN-SWA_255

3225143 : 3230374

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03145.1\|3225143_3227549_+	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	9.0e-138	38.1
AWX03146.1\|3227545_3228175_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	3.0e-61	55.4
AWX03147.1\|3228167_3228947_+	dimethyl sulfoxide reductase	NA	NA	NA	NA
AWX03148.1\|3229942_3230374_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.4e-19	39.4

DBSCAN-SWA_256

3239196 : 3245442

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03155.1\|3239196_3240738_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.4e-162	57.8
AWX03156.1\|3240796_3241018_+	hypothetical protein	NA	NA	NA	NA
AWX03157.1\|3241014_3241365_-	hypothetical protein	NA	NA	NA	NA
AWX03158.1\|3241364_3242384_-	peptidase M4 family protein	NA	NA	NA	NA
AWX03159.1\|3242442_3243816_-	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.9e-39	34.0
AWX03160.1\|3243975_3245442_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-88	39.1

DBSCAN-SWA_257

3259672 : 3259861

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03172.1\|3259672_3259861_-	DUF2633 family protein	G9L6F2	Escherichia_phage	1.9e-19	76.7

DBSCAN-SWA_258

3266287 : 3274178

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03176.1\|3266287_3266929_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.6e-28	40.0
AWX03177.1\|3266925_3267963_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	7.4e-73	45.1
AWX03178.1\|3268229_3269660_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
AWX03179.1\|3269654_3269900_-	hypothetical protein	NA	NA	NA	NA
AWX03180.1\|3269876_3270503_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AWX03181.1\|3270585_3271875_+	uracil permease	Q9KX94	Enterobacteria_phage	4.1e-65	36.9
AWX03182.1\|3271956_3272673_+	DnaA inactivator Hda	NA	NA	NA	NA
AWX03183.1\|3272759_3274178_-	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	2.3e-40	33.8

DBSCAN-SWA_259

3283908 : 3284622

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03194.1\|3283908_3284622_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	9.1e-38	35.2

DBSCAN-SWA_260

3306115 : 3325886

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03209.1\|3306115_3306991_-	N-acetylmuramoyl-L-alanine amidase AmiA	E5DV68	Deep-sea_thermophilic_phage	1.6e-12	26.9
AWX03210.1\|3307203_3307629_+	GNAT family acetyltransferase	NA	NA	NA	NA
AWX03211.1\|3307615_3308065_+	hypothetical protein	NA	NA	NA	NA
AWX03212.1\|3308128_3308704_+	RpoE-regulated lipoprotein	NA	NA	NA	NA
AWX03213.1\|3308796_3309696_+	peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
AWX03214.1\|3309871_3310885_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX03215.1\|3310884_3311718_+	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
AWX03216.1\|3311717_3312593_+	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
AWX03217.1\|3312582_3313677_+	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	1.6e-30	38.9
AWX03218.1\|3313744_3314656_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.7e-55	42.0
AWX03219.1\|3314661_3315498_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AWX03220.1\|3315542_3316052_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AWX03221.1\|3316092_3317820_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.3e-17	31.6
AWX03222.1\|3317865_3318123_-	phosphocarrier protein HPr	NA	NA	NA	NA
AWX03223.1\|3318194_3318380_+	hypothetical protein	NA	NA	NA	NA
AWX03224.1\|3318310_3318433_-	transcriptional regulator	NA	NA	NA	NA
AWX03225.1\|3318440_3319412_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.1e-76	51.3
AWX03226.1\|3319575_3320337_-	sulfate transporter CysZ	NA	NA	NA	NA
AWX03227.1\|3320324_3320516_+	hypothetical protein	NA	NA	NA	NA
AWX03228.1\|3320566_3321562_+	cell division protein ZipA	NA	NA	NA	NA
AWX03229.1\|3321630_3323646_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	9.1e-152	43.3
AWX03230.1\|3323647_3323863_+	hypothetical protein	NA	NA	NA	NA
AWX03231.1\|3323859_3324855_-	bile acid:sodium symporter	NA	NA	NA	NA
AWX03232.1\|3324944_3325886_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.1e-06	24.9

DBSCAN-SWA_261

3340628 : 3341360

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03245.1\|3340628_3341360_-	DNA-binding response regulator	A0A2R2ZGH8	Clostridioides_phage	2.2e-15	25.5

DBSCAN-SWA_262

3345182 : 3348841

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04744.1\|3345182_3346103_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	4.9e-76	54.7
AWX03248.1\|3346371_3347751_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-15	37.0
AWX03249.1\|3347911_3348841_-	hypothetical protein	E7DYY8	Enterobacteria_phage	4.4e-141	83.9

DBSCAN-SWA_263

3358010 : 3359096

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03258.1\|3358010_3359096_+	chorismate synthase	A0A291AU41	Pandoravirus	1.5e-87	46.6

DBSCAN-SWA_264

3367451 : 3368588

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03267.1\|3367451_3368588_+	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	3.0e-19	27.3

DBSCAN-SWA_265

3375018 : 3376536

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03275.1\|3375018_3376536_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.4e-88	43.8

DBSCAN-SWA_266

3380771 : 3381545

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03281.1\|3380771_3381545_+	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	28.2

DBSCAN-SWA_267

3386229 : 3387249

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03289.1\|3386229_3387249_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.5e-20	26.8

DBSCAN-SWA_268

3396385 : 3399606

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03299.1\|3396385_3397045_+	sugar phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.7e-06	26.6
AWX03300.1\|3397120_3398953_+	SLC13 family permease	NA	NA	NA	NA
AWX03301.1\|3399006_3399606_-	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	1.5e-06	38.6

DBSCAN-SWA_269

3418548 : 3419553

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03317.1\|3418548_3419553_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	7.5e-30	26.5

DBSCAN-SWA_270

3441325 : 3453022

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03339.1\|3441325_3442378_+	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	7.7e-09	50.9
AWX03340.1\|3442401_3442656_-	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	2.6e-27	66.7
AWX03341.1\|3442655_3443786_-	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.0e-176	79.1
AWX03342.1\|3443894_3446180_-	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	3.8e-287	64.3
AWX03343.1\|3446528_3447257_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AWX03344.1\|3447403_3450040_+	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	9.6e-93	31.0
AWX03345.1\|3450175_3453022_+	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	8.9e-44	26.4

DBSCAN-SWA_271

3457216 : 3465818

Tupanvirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03348.1\|3457216_3458311_+	porin	Q1MVN1	Enterobacteria_phage	5.2e-117	60.1
AWX03349.1\|3458425_3459481_+	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
AWX03350.1\|3459553_3460612_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2K9L698	Tupanvirus	3.7e-19	48.0
AWX03351.1\|3460611_3461262_+	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	4.9e-06	32.4
AWX03352.1\|3461338_3462982_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	8.3e-10	23.0
AWX03353.1\|3463123_3464560_+	magnesium transporter	NA	NA	NA	NA
AWX04745.1\|3464522_3465818_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.5e-80	49.3

DBSCAN-SWA_272

3471120 : 3478638

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03359.1\|3471120_3472128_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	1.0e-82	48.6
AWX03360.1\|3472179_3472464_-	50S ribosomal protein L25	NA	NA	NA	NA
AWX03361.1\|3472589_3474350_-	ATP-dependent helicase	M4Q3N1	Vibrio_phage	4.9e-101	42.0
AWX03362.1\|3474501_3475209_+	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
AWX03363.1\|3475224_3476424_+	Bcr/CflA family drug resistance efflux transporter	S4TR35	Salmonella_phage	9.9e-21	23.0
AWX03364.1\|3476700_3477045_+	hypothetical protein	NA	NA	NA	NA
AWX03365.1\|3477048_3478638_-	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	2.1e-18	32.1

DBSCAN-SWA_273

3484330 : 3488639

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03369.1\|3484330_3484900_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	1.8e-12	36.8
AWX03370.1\|3485315_3486029_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AWX03371.1\|3486062_3487049_-	GTP-binding protein	NA	NA	NA	NA
AWX03372.1\|3487172_3488639_-	fructuronate reductase	E5EQS6	Micromonas_sp._RCC1109_virus	1.7e-38	28.6

DBSCAN-SWA_274

3496495 : 3497353

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03380.1\|3496495_3497353_-	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	4.8e-25	32.7

DBSCAN-SWA_275

3501122 : 3506261

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03384.1\|3501122_3503108_-	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.2e-09	31.9
AWX03385.1\|3503376_3504204_-	S-formylglutathione hydrolase	NA	NA	NA	NA
AWX03386.1\|3504341_3505490_+	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
AWX03387.1\|3505592_3506261_+	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	9.0e-56	56.3

DBSCAN-SWA_276

3509988 : 3511509

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03391.1\|3509988_3511509_+	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	2.6e-10	33.0

DBSCAN-SWA_277

3523655 : 3524210

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03405.1\|3523655_3524210_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	7.3e-19	37.2

DBSCAN-SWA_278

3530773 : 3538620

Enterobacteria_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03410.1\|3530773_3531724_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	5.9e-08	29.0
AWX03411.1\|3531707_3532445_+	ABC transporter permease	NA	NA	NA	NA
AWX03412.1\|3532419_3532533_-	hypothetical protein	NA	NA	NA	NA
AWX03413.1\|3532602_3533343_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	4.6e-93	82.9
AWX03414.1\|3533561_3535247_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.3e-270	88.2
AWX03415.1\|3535240_3535960_+	two-component system response regulator YehT	NA	NA	NA	NA
AWX03416.1\|3536006_3536477_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	9.8e-65	78.7
AWX03417.1\|3536586_3538620_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	2.1e-55	28.2

DBSCAN-SWA_279

3546515 : 3549887

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03425.1\|3546515_3547892_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-26	26.4
AWX03426.1\|3548203_3548647_-	hypothetical protein	NA	NA	NA	NA
AWX03427.1\|3548831_3549887_-	hypothetical protein	S4TRP0	Salmonella_phage	1.2e-06	32.1

DBSCAN-SWA_280

3560948 : 3565039

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03438.1\|3560948_3562310_-	U32 family peptidase	Q6DW11	Phage_TP	4.7e-200	91.0
AWX03439.1\|3562916_3563639_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	3.2e-30	32.4
AWX03440.1\|3563635_3565039_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	2.5e-31	27.9

DBSCAN-SWA_281

3580062 : 3589393

Catovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03448.1\|3580062_3580704_+	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	38.3
AWX03449.1\|3580795_3581377_+	dCTP deaminase	I4AZP2	Saccharomonospora_phage	1.4e-33	43.2
AWX03450.1\|3581400_3583251_+	outer membrane assembly protein AsmA	NA	NA	NA	NA
AWX03451.1\|3583364_3584948_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.2e-39	44.9
AWX03452.1\|3585641_3586778_+	polysaccharide export protein Wza	NA	NA	NA	NA
AWX03453.1\|3586784_3587228_+	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
AWX03454.1\|3587230_3589393_+	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	3.2e-17	29.8

DBSCAN-SWA_282

3594639 : 3601351

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03461.1\|3594639_3595761_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	66.3
AWX03462.1\|3595763_3596729_+	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	1.4e-86	50.6
AWX03463.1\|3596731_3597211_+	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
AWX03464.1\|3597207_3598431_+	colanic acid biosynthesis glycosyltransferase WcaI	NA	NA	NA	NA
AWX03465.1\|3598434_3599871_+	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	1.4e-53	31.6
AWX03466.1\|3599980_3601351_+	phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	1.5e-33	27.5

DBSCAN-SWA_283

3606872 : 3610567

Klebsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03471.1\|3606872_3608264_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.4e-20	33.2
AWX03472.1\|3608453_3609449_+	UDP-N-acetylglucosamine 4-epimerase	A0A0K1L6Z1	Scale_drop_disease_virus	1.1e-09	28.1
AWX03473.1\|3609664_3610567_+	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.8e-43	42.6

DBSCAN-SWA_284

3615082 : 3625426

Catovirus(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03478.1\|3615082_3615769_+	hypothetical protein	A0A1V0SBR5	Catovirus	1.6e-10	36.0
AWX03479.1\|3615770_3616784_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-83	48.3
AWX03480.1\|3616797_3617544_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.2e-11	35.8
AWX03481.1\|3617680_3619087_+	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	M4QQM4	Ostreococcus_lucimarinus_virus	5.2e-37	28.3
AWX03482.1\|3619176_3620262_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	9.7e-100	52.9
AWX03483.1\|3620262_3621144_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.0e-104	62.7
AWX03484.1\|3621383_3622550_+	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	3.1e-112	54.0
AWX03485.1\|3622598_3623603_-	protein CapI	A0A2K9L0I7	Tupanvirus	1.9e-33	28.7
AWX03486.1\|3623794_3624775_+	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
AWX03487.1\|3624814_3625426_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	2.1e-14	29.3

DBSCAN-SWA_285

3630936 : 3631836

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03494.1\|3630936_3631836_-	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_286

3637385 : 3638552

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03499.1\|3637385_3638552_+	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	4.6e-196	85.8

DBSCAN-SWA_287

3647595 : 3655388

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03508.1\|3647595_3650658_-	AcrB/AcrD/AcrF family protein	S5VL66	Leptospira_phage	4.2e-23	20.6
AWX04748.1\|3650657_3651653_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AWX03509.1\|3652215_3652647_+	universal stress protein UspG	NA	NA	NA	NA
AWX03510.1\|3652694_3655388_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.5e-69	26.5

DBSCAN-SWA_288

3671210 : 3672512

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03523.1\|3671210_3672512_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.4e-62	36.5

DBSCAN-SWA_289

3678876 : 3681657

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03528.1\|3678876_3681657_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.1e-65	29.1

DBSCAN-SWA_290

3686062 : 3694185

Burkholderia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03533.1\|3686062_3687229_-	porin OmpC	Q1MVN1	Enterobacteria_phage	3.0e-115	57.3
AWX03534.1\|3687513_3688215_+	phosphohydrolase	S4W232	Pandoravirus	1.1e-06	28.5
AWX03535.1\|3688258_3689692_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.2e-102	55.9
AWX03536.1\|3689672_3690164_+	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	1.0e-32	47.6
AWX03537.1\|3690135_3691050_-	drug/metabolite exporter YedA	NA	NA	NA	NA
AWX03538.1\|3691228_3692140_+	DUF808 domain-containing protein	NA	NA	NA	NA
AWX03539.1\|3692217_3692400_+	DUF2158 domain-containing protein	NA	NA	NA	NA
AWX03540.1\|3692484_3694185_+	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	2.1e-16	32.8

DBSCAN-SWA_291

3718849 : 3719602

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03570.1\|3718849_3719602_+	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	2.2e-26	35.4

DBSCAN-SWA_292

3727219 : 3727936

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03580.1\|3727219_3727936_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-12	28.5

DBSCAN-SWA_293

3743813 : 3745328

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03598.1\|3743813_3745328_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A285PWH2	Cedratvirus	3.1e-11	28.7

DBSCAN-SWA_294

3762367 : 3768020

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03615.1\|3762367_3764035_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-11	34.7
AWX03616.1\|3764079_3765681_+	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-07	77.3
AWX03617.1\|3765700_3766567_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
AWX03618.1\|3766563_3767613_+	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	2.3e-05	32.0
AWX03619.1\|3767630_3768020_+	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3

DBSCAN-SWA_295

3775458 : 3908579

164

Enterobacteria_phage(26.89%)

holin,head,tRNA,tail,capsid,portal,terminase,protease,integrase

attL 3784624:3784656|attR 3875736:3875768

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03625.1\|3775458_3777192_-\|tRNA	arginine--tRNA ligase	A0A1V0SIS8	Klosneuvirus	4.0e-87	37.0
AWX03626.1\|3777430_3777991_+	VOC family protein	NA	NA	NA	NA
AWX03627.1\|3778069_3778813_+	copper homeostasis protein CutC	NA	NA	NA	NA
AWX03628.1\|3778793_3779177_+	hypothetical protein	NA	NA	NA	NA
AWX03629.1\|3779073_3780045_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AWX03630.1\|3780041_3780785_-	carboxy-S-adenosyl-L-methionine synthase CmoA	A0A1S6L2V9	Erwinia_phage	6.1e-29	30.2
AWX03631.1\|3780825_3781221_-	hypothetical protein	NA	NA	NA	NA
AWX03632.1\|3781272_3782046_-	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	8.6e-58	80.3
AWX03633.1\|3782024_3783338_-\|integrase	integrase	Q8W658	Enterobacteria_phage	1.1e-222	86.2
AWX04750.1\|3783393_3783630_-	excisionase	Q8W657	Enterobacteria_phage	4.8e-36	85.9
AWX03634.1\|3783783_3783981_-	hypothetical protein	NA	NA	NA	NA
AWX03635.1\|3784013_3784283_-	hypothetical protein	K7PKM4	Enterobacterial_phage	2.6e-30	73.0
AWX03636.1\|3784343_3784628_-	DUF4752 domain-containing protein	Q76H46	Enterobacteria_phage	1.8e-21	48.3
3784624:3784656	attL	NA	NA	NA	NA
AWX03637.1\|3784627_3785464_-	hypothetical protein	M9NZE4	Enterobacteria_phage	1.4e-26	34.4
AWX03638.1\|3785460_3786288_-	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	8.1e-123	85.9
AWX04751.1\|3786287_3786701_-	hypothetical protein	K7PJS4	Enterobacterial_phage	1.4e-54	83.9
AWX03639.1\|3786971_3787196_-	hypothetical protein	NA	NA	NA	NA
AWX04752.1\|3787711_3788359_-	LexA family transcriptional repressor	H9C160	Pectobacterium_phage	3.8e-75	63.0
AWX03640.1\|3788463_3788661_+	hypothetical protein	H9C161	Pectobacterium_phage	2.7e-16	66.1
AWX03641.1\|3788686_3789157_+	hypothetical protein	K7PJS5	Enterobacterial_phage	1.2e-75	94.9
AWX03642.1\|3789397_3789583_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	5.2e-14	69.2
AWX03643.1\|3789566_3790520_+	hypothetical protein	K7PLZ7	Enterobacterial_phage	1.4e-171	93.7
AWX03644.1\|3790516_3791011_+	hypothetical protein	NA	NA	NA	NA
AWX03645.1\|3791353_3792010_+	phage regulatory protein/antirepressor Ant	G0ZND1	Cronobacter_phage	3.4e-55	52.7
AWX03646.1\|3792006_3792996_+	hypothetical protein	K7PJS6	Enterobacterial_phage	8.7e-164	83.6
AWX03647.1\|3793008_3793839_+	antitermination protein	K7P7B9	Enterobacteria_phage	3.9e-56	46.9
AWX03648.1\|3794038_3794434_+	hypothetical protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
AWX03649.1\|3794420_3794702_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.9e-44	95.7
AWX03650.1\|3794701_3795331_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	3.0e-101	87.6
AWX03651.1\|3795548_3795821_+	hypothetical protein	G8C7W1	Escherichia_phage	1.1e-07	42.9
AWX04753.1\|3796491_3796683_+	hypothetical protein	K7PM01	Enterobacterial_phage	1.4e-17	83.3
AWX03652.1\|3796712_3796937_+	hypothetical protein	A0A2H4J182	uncultured_Caudovirales_phage	8.6e-19	56.8
AWX03653.1\|3797175_3797640_-	hypothetical protein	NA	NA	NA	NA
AWX04754.1\|3798148_3798796_+	DUF1983 domain-containing protein	G8C7Q4	Escherichia_phage	2.0e-60	74.8
AWX03654.1\|3798807_3800265_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	1.2e-273	92.2
AWX03655.1\|3800308_3800827_+	HNH endonuclease	K7PJS8	Enterobacterial_phage	5.0e-46	53.2
AWX03656.1\|3800807_3801398_+	hypothetical protein	S4TR53	Salmonella_phage	4.6e-104	90.3
AWX03657.1\|3801397_3801748_+	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.0e-50	81.0
AWX03658.1\|3801905_3802379_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	1.3e-85	98.7
AWX03659.1\|3802378_3804115_+\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	99.8
AWX03660.1\|3804114_3805419_+\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	1.9e-211	84.1
AWX03661.1\|3805427_3806279_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	1.1e-90	63.5
AWX03662.1\|3806288_3807497_+\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	2.0e-162	74.6
AWX04755.1\|3807540_3807867_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	9.5e-51	88.0
AWX03663.1\|3807875_3808214_+\|head,tail	head-tail adaptor protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.1e-40	74.1
AWX03664.1\|3808210_3808660_+	hypothetical protein	K7P6X4	Enterobacteria_phage	5.8e-75	98.7
AWX03665.1\|3808656_3809004_+	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	1.6e-48	82.6
AWX03666.1\|3809063_3809507_+	hypothetical protein	K7PHL2	Enterobacterial_phage	6.0e-72	93.8
AWX03667.1\|3809515_3809899_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	1.7e-62	92.9
AWX03668.1\|3809907_3810186_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	9.9e-41	93.4
AWX03669.1\|3810206_3810626_-	hypothetical protein	NA	NA	NA	NA
AWX03670.1\|3810712_3814177_+\|tail	phage tail tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	0.0e+00	87.8
AWX03671.1\|3814179_3814518_+\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	7.3e-38	59.8
AWX03672.1\|3814514_3815273_+\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	3.9e-95	63.6
AWX03673.1\|3815275_3815986_+	peptidase P60	F1C573	Cronobacter_phage	8.6e-97	69.4
AWX03674.1\|3815985_3816570_+\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	4.3e-54	53.1
AWX03675.1\|3816623_3820505_+	host specificity protein	Q9MCR7	Enterobacteria_phage	0.0e+00	61.0
AWX03676.1\|3820506_3821472_+	hypothetical protein	G1CSU0	Cronobacter_virus	6.3e-58	39.6
AWX03677.1\|3821532_3822810_+\|tail	phage tail protein	K7P6I4	Enterobacteria_phage	4.5e-120	53.9
AWX03678.1\|3823133_3823511_-	hypothetical protein	NA	NA	NA	NA
AWX03679.1\|3823850_3824114_-	DinI family protein	K7P797	Enterobacteria_phage	2.2e-37	92.0
AWX03680.1\|3824478_3825045_-	hydrolase	NA	NA	NA	NA
AWX03681.1\|3825307_3827080_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AWX03682.1\|3827081_3827525_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
AWX03683.1\|3827552_3828293_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AWX03684.1\|3828327_3828849_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
AWX03685.1\|3828929_3829544_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AWX03686.1\|3829552_3830563_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	2.4e-07	29.9
AWX03687.1\|3830615_3831401_-	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
AWX03688.1\|3831397_3832153_-	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-15	30.2
AWX03689.1\|3832215_3833175_+	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
AWX03690.1\|3833190_3834510_+	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	40.9
AWX03691.1\|3834627_3835599_+	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
AWX03692.1\|3835642_3837085_-	pyruvate kinase	NA	NA	NA	NA
AWX03693.1\|3837199_3838069_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWX03694.1\|3838425_3839901_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	6.0e-76	36.2
AWX03695.1\|3840134_3841946_+	phosphogluconate dehydratase	NA	NA	NA	NA
AWX03696.1\|3841985_3842627_+	keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase	NA	NA	NA	NA
AWX03697.1\|3842960_3845474_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.2e-14	27.8
AWX03698.1\|3845470_3847585_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.9e-20	29.5
AWX04756.1\|3847609_3848302_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	3.4e-05	58.1
AWX03699.1\|3848305_3849013_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	3.5e-05	29.7
AWX03700.1\|3849016_3849724_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	5.9e-05	29.7
AWX03701.1\|3849727_3850435_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.1e-06	31.1
AWX03702.1\|3850438_3851146_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.8e-06	31.1
AWX03703.1\|3851158_3851416_+	PAAR domain-containing protein	NA	NA	NA	NA
AWX03704.1\|3852873_3854052_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
AWX03705.1\|3854223_3854874_+	tellurite resistance TerB family protein	NA	NA	NA	NA
AWX03706.1\|3854949_3857025_+	oligopeptidase B	NA	NA	NA	NA
AWX03707.1\|3857006_3857669_-	exodeoxyribonuclease X	NA	NA	NA	NA
AWX03708.1\|3857693_3858344_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AWX03709.1\|3858455_3858686_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.0e-15	60.3
AWX03710.1\|3858823_3859195_+	CopC domain-containing protein YobA	NA	NA	NA	NA
AWX03711.1\|3859196_3860066_+	hypothetical protein	NA	NA	NA	NA
AWX03712.1\|3860082_3860421_+	DUF2511 domain-containing protein	NA	NA	NA	NA
AWX03713.1\|3860743_3861829_-\|integrase	integrase	A0A2H4IYC8	uncultured_Caudovirales_phage	1.6e-147	68.4
AWX03714.1\|3861797_3862070_-	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	2.9e-29	64.4
AWX03715.1\|3862258_3862915_+	DUF4145 domain-containing protein	V5URE2	Shigella_phage	8.0e-57	49.1
AWX03716.1\|3862946_3863165_-	TraR/DksA family transcriptional regulator	M1FQT7	Enterobacteria_phage	2.3e-16	63.6
AWX03717.1\|3863231_3863768_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	9.2e-35	51.0
AWX03718.1\|3863764_3863965_-	hypothetical protein	NA	NA	NA	NA
AWX03719.1\|3863961_3864234_-	hypothetical protein	K7P7M4	Enterobacteria_phage	4.2e-20	57.5
AWX03720.1\|3864230_3864449_-	hypothetical protein	NA	NA	NA	NA
AWX03721.1\|3864445_3864997_-	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	5.2e-57	60.0
AWX03722.1\|3865157_3865586_-	regulator	M9NYX4	Enterobacteria_phage	2.2e-71	93.7
AWX03723.1\|3865582_3866206_-	YqaJ-like viral recombinase	S0A2A9	Cellulophaga_phage	7.2e-47	49.5
AWX03724.1\|3866202_3866706_-	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	2.7e-12	29.5
AWX03725.1\|3866717_3867002_-	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.9e-47	94.7
AWX03726.1\|3867136_3867451_+	hypothetical protein	NA	NA	NA	NA
AWX03727.1\|3867455_3867659_-	cell division inhibitor protein	K7P6H3	Enterobacteria_phage	4.4e-22	76.6
AWX03728.1\|3867816_3868086_-	hypothetical protein	NA	NA	NA	NA
AWX04757.1\|3868249_3868687_-	hypothetical protein	K7P7N6	Enterobacteria_phage	3.9e-76	97.2
AWX03729.1\|3869478_3870231_-	LexA family transcriptional repressor	A0A286S2B2	Klebsiella_phage	7.0e-73	64.0
AWX03730.1\|3870272_3870506_+	transcriptional regulator	A0A0P0ZDD7	Stx2-converting_phage	2.6e-18	62.3
AWX03731.1\|3870523_3871066_+	regulator	M9NZI6	Enterobacteria_phage	4.6e-74	78.9
AWX03732.1\|3871294_3872191_+	DNA replication protein	F1C5C3	Cronobacter_phage	2.6e-98	60.1
AWX03733.1\|3872180_3873608_+	helicase DnaB	Q9MCT4	Escherichia_phage	1.4e-170	62.1
AWX03734.1\|3873607_3873952_+	transcriptional regulator	G8C7U7	Escherichia_phage	1.9e-54	94.7
AWX03735.1\|3874816_3875098_+	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	2.7e-30	79.3
AWX03736.1\|3875101_3875764_+	DUF551 domain-containing protein	M9NZE4	Enterobacteria_phage	9.4e-21	47.3
AWX03737.1\|3875763_3876009_+	hypothetical protein	A0A1I9KF90	Aeromonas_phage	7.0e-14	51.4
3875736:3875768	attR	NA	NA	NA	NA
AWX03738.1\|3876114_3876345_+	hypothetical protein	NA	NA	NA	NA
AWX03739.1\|3876518_3876968_+	recombination protein NinB	I6R9D0	Salmonella_phage	4.7e-32	45.1
AWX03740.1\|3876960_3877131_+	hypothetical protein	G8C7V4	Escherichia_phage	7.2e-18	78.6
AWX03741.1\|3877123_3877762_+	hypothetical protein	S4TSR3	Salmonella_phage	8.0e-86	75.5
AWX03742.1\|3877758_3877875_+	hypothetical protein	NA	NA	NA	NA
AWX03743.1\|3877871_3878561_+	antiterminator	I6PDF8	Cronobacter_phage	1.1e-56	52.7
AWX03744.1\|3878633_3878921_-	hypothetical protein	NA	NA	NA	NA
AWX03745.1\|3879234_3879606_+\|holin	holin	A0A2D1GNJ3	Pseudomonas_phage	1.3e-06	32.4
AWX03746.1\|3879589_3880234_+	glycoside hydrolase family 19 protein	F1C5D2	Cronobacter_phage	1.5e-36	43.3
AWX03747.1\|3880221_3880698_+	Rz lytic protein	NA	NA	NA	NA
AWX03748.1\|3881151_3881670_+	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	98.8
AWX03749.1\|3881999_3882218_+	hypothetical protein	NA	NA	NA	NA
AWX03750.1\|3882283_3882508_-	hypothetical protein	NA	NA	NA	NA
AWX03751.1\|3882530_3883103_+\|terminase	terminase small subunit	G0ZND3	Cronobacter_phage	2.2e-71	72.6
AWX03752.1\|3883089_3884568_+	DNA-packaging protein	G0ZND4	Cronobacter_phage	1.5e-257	87.6
AWX03753.1\|3884583_3885933_+	DUF1073 domain-containing protein	A0A1V0E5Q5	Salmonella_phage	7.8e-232	87.3
AWX03754.1\|3885892_3886819_+\|head	phage head morphogenesis protein	Q5G8Y3	Enterobacteria_phage	4.0e-163	92.9
AWX03755.1\|3886821_3888090_+	hypothetical protein	Q5G8Y2	Enterobacteria_phage	2.2e-220	91.9
AWX03756.1\|3888102_3888564_+	hypothetical protein	G0ZND8	Cronobacter_phage	2.6e-62	81.1
AWX03757.1\|3888576_3889674_+	hypothetical protein	G0ZND9	Cronobacter_phage	8.7e-181	84.4
AWX03758.1\|3889684_3889969_+	hypothetical protein	A0A1V0E5P8	Salmonella_phage	1.7e-32	75.3
AWX03759.1\|3890031_3890433_+	hypothetical protein	I6S619	Salmonella_phage	2.7e-55	75.9
AWX03760.1\|3890432_3890612_+	DUF551 domain-containing protein	Q5G8X7	Enterobacteria_phage	2.6e-26	89.8
AWX03761.1\|3890604_3890967_+	hypothetical protein	Q5G8X6	Enterobacteria_phage	2.7e-62	92.5
AWX03762.1\|3890956_3891448_-	HNH endonuclease	J7HXG5	Pseudomonas_phage	1.6e-46	57.1
AWX03763.1\|3891569_3891965_+	hypothetical protein	I6RSK8	Salmonella_phage	1.5e-66	96.2
AWX03764.1\|3891961_3892348_+	hypothetical protein	A0A1V0E5P4	Salmonella_phage	2.1e-65	94.5
AWX03765.1\|3892365_3893100_+	hypothetical protein	H6WRU1	Salmonella_phage	2.1e-114	85.6
AWX04758.1\|3893137_3893791_+	hypothetical protein	I6R0Q2	Salmonella_phage	7.9e-113	92.2
AWX03766.1\|3894404_3894680_+	cor protein	Q5G8V7	Enterobacteria_phage	1.8e-26	72.5
AWX03767.1\|3894797_3895202_+	hypothetical protein	NA	NA	NA	NA
AWX03768.1\|3895266_3898671_+	hypothetical protein	R9TMK1	Aeromonas_phage	5.6e-186	50.4
AWX03769.1\|3898699_3898927_-	hypothetical protein	NA	NA	NA	NA
AWX03770.1\|3899002_3899350_+\|tail	phage tail protein	H6WRV8	Salmonella_phage	5.9e-59	93.0
AWX03771.1\|3899505_3899703_-	hypothetical protein	NA	NA	NA	NA
AWX03772.1\|3899868_3900573_+\|tail	phage minor tail protein L	A0A1V0E5N2	Salmonella_phage	1.9e-136	99.1
AWX04759.1\|3900572_3901292_+\|tail	phage tail protein	A0A1V0E5M9	Salmonella_phage	6.0e-122	82.7
AWX03773.1\|3901234_3901768_+\|tail	tail assembly protein	H6WRW3	Salmonella_phage	4.0e-54	67.6
AWX03774.1\|3901777_3905605_+	hypothetical protein	I6R9B3	Salmonella_phage	0.0e+00	60.5
AWX03775.1\|3905606_3906572_+	hypothetical protein	G1CSU0	Cronobacter_virus	3.3e-59	40.2
AWX03776.1\|3906632_3907934_+\|tail	phage tail protein	G8C7R8	Escherichia_phage	5.4e-121	56.2
AWX03777.1\|3908016_3908256_+	hypothetical protein	K7P7N3	Enterobacteria_phage	7.0e-27	72.2
AWX03778.1\|3908255_3908579_+	hypothetical protein	K7PGV5	Enterobacterial_phage	2.2e-23	51.4

DBSCAN-SWA_296

3917451 : 3919494

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03785.1\|3917451_3918750_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	3.6e-16	24.5
AWX03786.1\|3919074_3919494_-	anti-adapter protein IraM	Q20GJ2	Phage_258-320	2.8e-15	38.9

DBSCAN-SWA_297

3931086 : 3931602

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03797.1\|3931086_3931602_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-24	56.9

DBSCAN-SWA_298

3937963 : 3946769

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03803.1\|3937963_3939625_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-09	63.3
AWX03804.1\|3939770_3940637_+	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
AWX03805.1\|3940683_3940884_-	hypothetical protein	NA	NA	NA	NA
AWX04760.1\|3941209_3941629_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	6.7e-33	54.3
AWX03806.1\|3941976_3944406_+	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
AWX03807.1\|3944492_3946769_-	pyrroloquinoline quinone biosynthesis protein PqqF	A0A2P1EIE5	Megavirus	5.0e-05	26.6

DBSCAN-SWA_299

3951249 : 3952515

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03813.1\|3951249_3952515_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	5.3e-206	81.5

DBSCAN-SWA_300

3966358 : 3967507

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03829.1\|3966358_3967507_-	osmoprotectant ABC transporter ATP-binding protein OsmV	G9BWD6	Planktothrix_phage	8.3e-25	32.6

DBSCAN-SWA_301

3971835 : 3975242

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03835.1\|3971835_3972513_+	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	4.2e-77	63.1
AWX03836.1\|3972688_3973000_-	DNA damage-inducible SOS regulon protein	NA	NA	NA	NA
AWX03837.1\|3973109_3973724_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	1.9e-28	34.7
AWX03838.1\|3973768_3974623_-	dimethylsulfoxide reductase	A0A077SK59	Escherichia_phage	7.6e-23	34.6
AWX03839.1\|3974624_3975242_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.0e-74	59.1

DBSCAN-SWA_302

3982840 : 4001765

Escherichia_phage(10.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03847.1\|3982840_3984310_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	7.2e-122	50.5
AWX03848.1\|3984440_3984746_-	DUF1161 domain-containing protein	NA	NA	NA	NA
AWX03849.1\|3984848_3985703_-	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2
AWX03850.1\|3985895_3986606_+	YnfC family lipoprotein	NA	NA	NA	NA
AWX03851.1\|3986623_3987184_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
AWX03852.1\|3987183_3987522_-	DUF1283 family protein	NA	NA	NA	NA
AWX03853.1\|3987672_3987999_+	YnfA family protein	A0A218MNG8	uncultured_virus	7.1e-22	54.5
AWX03854.1\|3988110_3989325_+	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	3.3e-48	30.0
AWX03855.1\|3989339_3990359_+	Zn-dependent oxidoreductase	NA	NA	NA	NA
AWX03856.1\|3990432_3991812_+	MFS transporter	NA	NA	NA	NA
AWX03857.1\|3992035_3993499_+	D-mannonate oxidoreductase	H8ZJP8	Ostreococcus_tauri_virus	2.2e-46	30.5
AWX03858.1\|3993543_3993747_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	4.4e-14	56.7
AWX03859.1\|3994034_3994466_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	4.5e-16	34.5
AWX03860.1\|3994501_3995188_-	GntR family transcriptional regulator	NA	NA	NA	NA
AWX03861.1\|3995278_3996025_-	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
AWX03862.1\|3996168_3998202_+	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	1.3e-20	21.1
AWX04762.1\|3998328_3999120_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AWX03863.1\|3999229_4000033_+	AraC family transcriptional regulator	NA	NA	NA	NA
AWX03864.1\|4000141_4000633_+	DUF523 domain-containing protein	NA	NA	NA	NA
AWX03865.1\|4000692_4001376_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.4e-80	60.0
AWX03866.1\|4001525_4001765_-	DinI family protein	K7PKM2	Enterobacterial_phage	5.0e-33	91.1

DBSCAN-SWA_303

4009458 : 4010448

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03873.1\|4009458_4010448_-	2-hydroxyacid dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	1.6e-69	44.7

DBSCAN-SWA_304

4035400 : 4037377

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03897.1\|4035400_4037377_+	alkyl/aryl-sulfatase	A0A2P0VMX1	Tetraselmis_virus	2.4e-157	45.2

DBSCAN-SWA_305

4041771 : 4042992

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03904.1\|4041771_4042992_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	4.1e-38	31.6

DBSCAN-SWA_306

4049198 : 4054687

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03913.1\|4049198_4049885_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.5e-09	31.1
AWX03914.1\|4049975_4050581_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AWX03915.1\|4050784_4054687_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	5.0e-53	29.4

DBSCAN-SWA_307

4061640 : 4064036

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03920.1\|4061640_4062171_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	1.0e-17	43.0
AWX03921.1\|4062211_4063279_-	oxidoreductase	NA	NA	NA	NA
AWX03922.1\|4063292_4064036_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.6e-15	28.1

DBSCAN-SWA_308

4084460 : 4086626

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03925.1\|4084460_4086626_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.0e-31	27.4

DBSCAN-SWA_309

4094431 : 4095550

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03936.1\|4094431_4095550_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	4.7e-33	29.1

DBSCAN-SWA_310

4099979 : 4101473

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03940.1\|4099979_4101473_+	carboxylesterase/lipase family protein	S4VZJ7	Pandoravirus	2.2e-33	30.6

DBSCAN-SWA_311

4109581 : 4110811

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03949.1\|4109581_4110811_-	peptidase T	A0A0K2CPK3	Brevibacillus_phage	2.1e-05	39.1

DBSCAN-SWA_312

4117150 : 4122841

Phage_TP(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03956.1\|4117150_4119115_+	U32 family peptidase	Q6DW11	Phage_TP	2.7e-23	28.5
AWX03957.1\|4119111_4119345_-	DUF2554 family protein	NA	NA	NA	NA
AWX03958.1\|4119588_4119951_+	hypothetical protein	NA	NA	NA	NA
AWX04768.1\|4120098_4121097_-	transcriptional regulator FtrA	NA	NA	NA	NA
AWX03959.1\|4121170_4121581_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
AWX03960.1\|4121737_4122841_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	2.4e-101	48.1

DBSCAN-SWA_313

4126982 : 4128488

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03964.1\|4126982_4127780_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.2e-11	26.8
AWX03965.1\|4127789_4128488_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	5.2e-14	25.7

DBSCAN-SWA_314

4131821 : 4132208

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03970.1\|4131821_4132208_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	2.1e-09	33.3

DBSCAN-SWA_315

4142099 : 4143065

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03980.1\|4142099_4143065_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.9e-12	30.9

DBSCAN-SWA_316

4149312 : 4151345

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX03988.1\|4149312_4150053_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.5e-30	35.5
AWX03989.1\|4150049_4151345_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.0e-15	24.2

DBSCAN-SWA_317

4188238 : 4189123

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04027.1\|4188238_4189123_+	SDR family NAD(P)-dependent oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.7e-82	56.5

DBSCAN-SWA_318

4197326 : 4201424

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04037.1\|4197326_4198877_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-06	21.8
AWX04038.1\|4198972_4199989_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
AWX04039.1\|4200017_4201424_-	glycosyl hydrolase family 32	F8WPR5	Bacillus_phage	4.4e-12	23.2

DBSCAN-SWA_319

4213499 : 4216151

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04050.1\|4213499_4214486_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	31.6
AWX04051.1\|4214478_4215405_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-14	29.3
AWX04052.1\|4215401_4216151_-	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.2e-17	33.7

DBSCAN-SWA_320

4222989 : 4225916

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04060.1\|4222989_4224699_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	9.4e-41	25.3
AWX04061.1\|4224905_4225916_+	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	1.7e-26	25.8

DBSCAN-SWA_321

4236370 : 4238980

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04070.1\|4236370_4237444_+	porin OmpD	Q1MVN1	Enterobacteria_phage	6.6e-149	70.4
AWX04071.1\|4237489_4238980_-	methyl viologen resistance protein SmvA	A0A0M3UL24	Mycobacterium_phage	5.7e-34	31.3

DBSCAN-SWA_322

4245073 : 4246618

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04075.1\|4245073_4246618_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_323

4249718 : 4257773

Acinetobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04080.1\|4249718_4250081_+	CHAP domain-containing protein	I3WW63	Acinetobacter_phage	3.0e-05	30.0
AWX04081.1\|4250080_4250506_+	DUF3828 domain-containing protein	NA	NA	NA	NA
AWX04082.1\|4250573_4252676_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.4e-62	27.0
AWX04083.1\|4252837_4253137_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AWX04084.1\|4253129_4253771_-	DNA-binding protein	NA	NA	NA	NA
AWX04085.1\|4253862_4254864_-	lipid A biosynthesis lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	3.3e-54	40.2
AWX04086.1\|4255050_4255281_-	tautomerase PptA	NA	NA	NA	NA
AWX04087.1\|4255318_4255936_-	glutathione S-transferase family protein	NA	NA	NA	NA
AWX04088.1\|4256102_4256990_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AWX04089.1\|4256999_4257773_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-20	31.5

DBSCAN-SWA_324

4263720 : 4264260

Leuconostoc_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04096.1\|4263720_4264260_-	adenylate kinase	A0A097BYE2	Leuconostoc_phage	3.4e-13	34.7

DBSCAN-SWA_325

4268958 : 4271076

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04101.1\|4268958_4271076_+	TonB-dependent siderophore receptor	A0A1B0VCF0	Salmonella_phage	6.7e-137	67.4

DBSCAN-SWA_326

4297030 : 4300436

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04125.1\|4297030_4298158_+	porin OmpS2	Q1MVN1	Enterobacteria_phage	3.0e-120	60.6
AWX04126.1\|4298192_4298615_-	GFA family protein	NA	NA	NA	NA
AWX04127.1\|4298618_4298816_-	hypothetical protein	NA	NA	NA	NA
AWX04128.1\|4299236_4299437_+	hypothetical protein	A0A0U2JGI6	Escherichia_phage	1.1e-20	71.7
AWX04129.1\|4299764_4300436_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.2e-77	59.5

DBSCAN-SWA_327

4303868 : 4307795

Shigella_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04133.1\|4303868_4304925_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	4.8e-128	74.7
AWX04134.1\|4305442_4306378_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.0e-142	95.7
AWX04135.1\|4306421_4307795_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-51	31.9

DBSCAN-SWA_328

4324560 : 4334385

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04151.1\|4324560_4324947_-	hypothetical protein	A0A077K801	Ralstonia_phage	1.3e-09	41.2
AWX04152.1\|4324985_4325189_-	hypothetical protein	NA	NA	NA	NA
AWX04153.1\|4325191_4326241_-	hypothetical protein	NA	NA	NA	NA
AWX04154.1\|4326242_4326866_-	DUF2345 domain-containing protein	NA	NA	NA	NA
AWX04155.1\|4326804_4327065_-	PAAR domain-containing protein	NA	NA	NA	NA
AWX04156.1\|4327065_4328997_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.3e-59	29.8
AWX04157.1\|4329250_4331743_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	8.7e-19	33.1
AWX04158.1\|4331739_4334385_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.9e-96	32.4

DBSCAN-SWA_329

4351879 : 4352962

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04173.1\|4351879_4352962_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.1e-13	29.3

DBSCAN-SWA_330

4370040 : 4379524

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04190.1\|4370040_4371033_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	2.3e-07	26.1
AWX04191.1\|4371034_4371841_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.8e-13	26.8
AWX04192.1\|4371837_4372428_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWX04193.1\|4372560_4372962_+	RidA family protein	NA	NA	NA	NA
AWX04194.1\|4373839_4375180_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.2e-17	30.0
AWX04195.1\|4375573_4376362_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
AWX04196.1\|4376514_4377501_+	CMD domain-containing protein	NA	NA	NA	NA
AWX04197.1\|4377589_4379524_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	5.5e-05	23.3

DBSCAN-SWA_331

4388180 : 4388771

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04205.1\|4388180_4388771_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-42	48.4

DBSCAN-SWA_332

4393695 : 4398025

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04209.1\|4393695_4396293_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	4.6e-87	34.0
AWX04210.1\|4396691_4396943_+	DUF2498 family protein	NA	NA	NA	NA
AWX04211.1\|4396978_4398025_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	1.3e-19	29.2

DBSCAN-SWA_333

4403974 : 4406932

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04218.1\|4403974_4405570_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.8e-49	37.0
AWX04219.1\|4405573_4406932_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.0e-37	41.0

DBSCAN-SWA_334

4421206 : 4424103

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04236.1\|4421206_4422043_-	transporter	A0A1B0Y2S3	Lactobacillus_phage	6.1e-09	39.8
AWX04237.1\|4422088_4423093_-	oligopeptide ABC transporter ATP-binding protein OppF	G3M9Y6	Bacillus_virus	8.9e-15	30.7
AWX04238.1\|4423089_4424103_-	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	1.8e-15	29.4

DBSCAN-SWA_335

4432318 : 4442516

Citrobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04778.1\|4432318_4432933_-	thymidine kinase	A0A0A0YP64	Citrobacter_phage	1.7e-56	54.7
AWX04244.1\|4433483_4433897_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
AWX04245.1\|4434099_4435005_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.6e-58	47.2
AWX04246.1\|4435204_4436218_-	two-component system response regulator RssB	NA	NA	NA	NA
AWX04247.1\|4436307_4437210_-	patatin-like phospholipase RssA	NA	NA	NA	NA
AWX04248.1\|4437323_4437788_+	YchJ family protein	NA	NA	NA	NA
AWX04249.1\|4437829_4438672_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.7e-12	49.3
AWX04250.1\|4439596_4440274_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
AWX04251.1\|4440273_4440984_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
AWX04252.1\|4440980_4442516_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.7e-20	42.2

DBSCAN-SWA_336

4458851 : 4459640

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04260.1\|4458851_4459640_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	36.9

DBSCAN-SWA_337

4463711 : 4472544

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04265.1\|4463711_4465496_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-14	34.6
AWX04266.1\|4465690_4465930_+	hypothetical protein	NA	NA	NA	NA
AWX04267.1\|4465960_4466656_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AWX04268.1\|4466832_4467063_-	putative cation transport regulator ChaB	A0A1S5YE01	Mythimna_unipuncta_granulovirus	1.0e-06	45.3
AWX04269.1\|4467331_4468432_+	sodium-potassium/proton antiporter ChaA	NA	NA	NA	NA
AWX04270.1\|4468538_4469393_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.4e-47	39.5
AWX04271.1\|4469429_4470239_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
AWX04272.1\|4470242_4470635_-	SirB family protein	NA	NA	NA	NA
AWX04273.1\|4470631_4471462_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
AWX04274.1\|4471461_4472544_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.5e-07	41.6

DBSCAN-SWA_338

4475646 : 4478398

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04779.1\|4475646_4476594_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.9e-44	37.8
AWX04278.1\|4476718_4478398_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	6.7e-23	24.0

DBSCAN-SWA_339

4488371 : 4489124

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04290.1\|4488371_4489124_-	Appr-1-p processing protein	A0A2L1IVW3	Streptomyces_phage	3.8e-18	34.6

DBSCAN-SWA_340

4495693 : 4506691

Serratia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04295.1\|4495693_4500118_-	type IV secretion protein Rhs	A0A2H4JHK7	uncultured_Caudovirales_phage	9.6e-29	50.8
AWX04296.1\|4500121_4500562_-	DUF1795 domain-containing protein	NA	NA	NA	NA
AWX04297.1\|4500770_4501289_-	hypothetical protein	NA	NA	NA	NA
AWX04298.1\|4501278_4503861_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-45	27.0
AWX04299.1\|4504020_4505121_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	7.9e-57	42.8
AWX04300.1\|4505159_4505540_-	hypothetical protein	NA	NA	NA	NA
AWX04301.1\|4505620_4506691_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	1.8e-58	42.6

DBSCAN-SWA_341

4510117 : 4518952

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04305.1\|4510117_4512076_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.6e-44	27.2
AWX04306.1\|4512159_4512615_-	hypothetical protein	NA	NA	NA	NA
AWX04307.1\|4512628_4513390_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
AWX04308.1\|4513386_4514853_-	phospholipase	NA	NA	NA	NA
AWX04309.1\|4514878_4516312_-	serine/threonine protein kinase	M1HKB5	Acanthocystis_turfacea_Chlorella_virus	6.1e-09	27.0
AWX04310.1\|4516336_4518952_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	3.2e-80	31.3

DBSCAN-SWA_342

4527367 : 4528357

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04318.1\|4527367_4528357_-	hypothetical protein	A0A2H4JEI9	uncultured_Caudovirales_phage	3.2e-41	32.6

DBSCAN-SWA_343

4564997 : 4572240

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04350.1\|4564997_4566716_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	26.0
AWX04351.1\|4566886_4567468_-	hypothetical protein	NA	NA	NA	NA
AWX04352.1\|4567505_4568201_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AWX04353.1\|4568267_4570178_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	8.0e-89	32.0
AWX04354.1\|4570661_4570844_-	YoaH family protein	NA	NA	NA	NA
AWX04355.1\|4570905_4572240_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	6.4e-45	41.9

DBSCAN-SWA_344

4576098 : 4577658

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04359.1\|4576098_4577658_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	6.0e-42	45.4

DBSCAN-SWA_345

4585090 : 4585300

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04367.1\|4585090_4585300_-	cold-shock protein CspC	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_346

4590564 : 4592613

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04375.1\|4590564_4592613_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.8e-82	32.6

DBSCAN-SWA_347

4599831 : 4648875

Salmonella_phage(27.12%)

holin,tail,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04380.1\|4599831_4600476_-	protein-serine/threonine phosphatase	S4TNS0	Salmonella_phage	6.2e-54	45.0
AWX04381.1\|4600643_4601624_+	DUF535 domain-containing protein	NA	NA	NA	NA
AWX04382.1\|4602053_4603322_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	4.4e-229	91.2
AWX04383.1\|4603321_4603627_-	hypothetical protein	K7PGV5	Enterobacterial_phage	5.6e-13	41.6
AWX04384.1\|4603738_4604101_+	GtrA family protein	U5P0S6	Shigella_phage	2.0e-49	84.2
AWX04385.1\|4604097_4605015_+	glycosyltransferase	U5P087	Shigella_phage	1.3e-158	91.4
AWX04386.1\|4605014_4606622_+	hypothetical protein	B9UDL6	Salmonella_phage	1.7e-60	31.4
AWX04387.1\|4608656_4611134_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	0.0e+00	93.1
AWX04388.1\|4611120_4611486_-	peptidoglycan endopeptidase	F1C5F2	Cronobacter_phage	1.6e-62	90.8
AWX04389.1\|4611499_4611970_-	hypothetical protein	F1C5F1	Cronobacter_phage	1.0e-66	80.1
AWX04390.1\|4611969_4612467_-	hypothetical protein	F1C5F0	Cronobacter_phage	2.1e-89	91.5
AWX04391.1\|4612466_4614791_-\|tail	phage tail tape measure protein	A0A1B1W284	Salmonella_phage	1.7e-146	52.2
AWX04392.1\|4614848_4615223_-	hypothetical protein	A0A0M4QWT0	Salmonella_phage	5.1e-24	53.4
AWX04393.1\|4615295_4616039_-	hypothetical protein	G0ZNE7	Cronobacter_phage	7.7e-64	52.6
AWX04394.1\|4616089_4616845_-	DNA breaking-rejoining protein	G0ZNE6	Cronobacter_phage	9.9e-59	53.4
AWX04395.1\|4616903_4617287_-	hypothetical protein	F1C5E4	Cronobacter_phage	4.9e-38	57.5
AWX04396.1\|4617283_4617652_-	HK97 gp10 family phage protein	F1C5E3	Cronobacter_phage	1.8e-45	75.4
AWX04397.1\|4617694_4617883_-	hypothetical protein	NA	NA	NA	NA
AWX04398.1\|4617896_4618247_-	hypothetical protein	G0ZNE2	Cronobacter_phage	8.9e-39	67.0
AWX04399.1\|4618246_4618420_-	50S ribosomal protein L13	I6R0P9	Salmonella_phage	6.0e-12	49.1
AWX04400.1\|4618419_4618821_-	hypothetical protein	G0ZNE1	Cronobacter_phage	1.4e-56	79.7
AWX04401.1\|4618883_4619177_-	hypothetical protein	A0A1V0E5P8	Salmonella_phage	1.9e-42	89.7
AWX04402.1\|4619186_4620263_-	hypothetical protein	Q5G8Y0	Enterobacteria_phage	1.6e-179	88.0
AWX04403.1\|4620280_4620730_-	hypothetical protein	A0A1V0E5Q8	Salmonella_phage	2.7e-64	85.2
AWX04404.1\|4620742_4622008_-	hypothetical protein	Q5G8Y2	Enterobacteria_phage	1.7e-220	91.4
AWX04405.1\|4622010_4622937_-\|head	phage head morphogenesis protein	Q5G8Y3	Enterobacteria_phage	4.0e-163	92.9
AWX04406.1\|4622896_4624246_-	DUF1073 domain-containing protein	A0A1V0E5Q5	Salmonella_phage	7.8e-232	87.3
AWX04407.1\|4624261_4625740_-	DNA-packaging protein	G0ZND4	Cronobacter_phage	1.5e-257	87.6
AWX04408.1\|4625726_4626299_-\|terminase	terminase small subunit	G0ZND3	Cronobacter_phage	2.2e-71	72.6
AWX04409.1\|4626321_4626546_+	hypothetical protein	NA	NA	NA	NA
AWX04410.1\|4626611_4626830_-	hypothetical protein	NA	NA	NA	NA
AWX04411.1\|4627159_4627678_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.3e-91	97.7
AWX04412.1\|4627950_4628121_-	rz1 lytic protein	U5P461	Shigella_phage	2.1e-09	56.6
AWX04413.1\|4628101_4628488_-	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	2.1e-12	38.1
AWX04414.1\|4628484_4628925_-	lysozyme	A0A0M4R365	Salmonella_phage	9.5e-62	81.9
AWX04415.1\|4628928_4629204_-\|holin	phage holin family protein	S4TNV9	Salmonella_phage	5.8e-09	41.0
AWX04416.1\|4629200_4629602_-	hypothetical protein	NA	NA	NA	NA
AWX04417.1\|4629875_4630376_-	antiterminator	G8C7V7	Escherichia_phage	5.5e-90	95.7
AWX04418.1\|4630375_4630492_-	hypothetical protein	NA	NA	NA	NA
AWX04419.1\|4630488_4631133_-	hypothetical protein	S4TSR3	Salmonella_phage	2.1e-73	69.6
AWX04420.1\|4631126_4631627_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	2.3e-35	50.7
AWX04421.1\|4631590_4631761_-	hypothetical protein	K7P7K0	Enterobacteria_phage	2.5e-18	86.8
AWX04422.1\|4631753_4632203_-	recombination protein NinB	I6R9D0	Salmonella_phage	1.9e-33	47.2
AWX04423.1\|4633157_4633439_-	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	5.2e-29	73.9
AWX04424.1\|4633441_4633801_-	ead/Ea22-like family protein	K7PLZ3	Enterobacterial_phage	6.0e-06	46.3
AWX04425.1\|4633797_4633995_-	hypothetical protein	NA	NA	NA	NA
AWX04426.1\|4633991_4634180_-	hypothetical protein	NA	NA	NA	NA
AWX04427.1\|4634176_4634482_-	hypothetical protein	A0A0F6N6A6	Escherichia_phage	1.7e-14	53.1
AWX04428.1\|4634478_4634727_-	XRE family transcriptional regulator	NA	NA	NA	NA
AWX04429.1\|4634723_4635038_-	protein ren	M1FPD5	Enterobacteria_phage	1.4e-14	48.4
AWX04430.1\|4635027_4636401_-	replicative DNA helicase	E5AGF0	Erwinia_phage	8.4e-165	63.1
AWX04431.1\|4636397_4637483_-	DNA replication protein	E5AGE9	Erwinia_phage	1.5e-84	45.4
AWX04432.1\|4637711_4638278_-	hypothetical protein	NA	NA	NA	NA
AWX04433.1\|4638308_4638524_-	XRE family transcriptional regulator	K7PMD5	Enterobacterial_phage	1.7e-27	81.7
AWX04434.1\|4638627_4639269_+	helix-turn-helix domain-containing protein	K7PH71	Enterobacterial_phage	5.2e-93	76.8
AWX04435.1\|4639500_4640319_+	NYN domain-containing protein	A4JWQ6	Burkholderia_virus	2.0e-36	46.8
AWX04436.1\|4640456_4640654_-	hypothetical protein	G8C7T7	Escherichia_phage	4.6e-24	92.2
AWX04437.1\|4641073_4641298_+	hypothetical protein	NA	NA	NA	NA
AWX04438.1\|4641587_4641785_+	DUF1482 family protein	NA	NA	NA	NA
AWX04439.1\|4641856_4642141_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	3.2e-47	94.7
AWX04440.1\|4642159_4643005_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	4.5e-68	55.4
AWX04441.1\|4643001_4643682_+	exonuclease	M9NZE1	Enterobacteria_phage	6.9e-128	95.6
AWX04442.1\|4643678_4644107_+	regulator	M9NYX4	Enterobacteria_phage	1.5e-72	95.8
AWX04443.1\|4644267_4644927_+	DNA methyltransferase	G8C7S6	Escherichia_phage	2.7e-121	93.2
AWX04444.1\|4644923_4645142_+	hypothetical protein	NA	NA	NA	NA
AWX04445.1\|4645138_4645435_+	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	2.4e-29	66.7
AWX04446.1\|4645431_4645623_+	hypothetical protein	A0A0P0ZC60	Stx2-converting_phage	4.6e-13	62.7
AWX04447.1\|4645714_4646224_+	hypothetical protein	A0A1W6DY33	Salmonella_phage	6.5e-38	48.8
AWX04448.1\|4646440_4646932_+	HNH endonuclease	Q7Y5G7	Xanthomonas_virus	4.9e-35	49.0
AWX04449.1\|4646974_4647205_+	hypothetical protein	G8C7S3	Escherichia_phage	8.8e-35	98.7
AWX04450.1\|4647313_4647562_+	DNA-binding protein	S4TND0	Salmonella_phage	8.3e-15	50.0
AWX04451.1\|4647594_4648875_+	DUF3596 domain-containing protein	B6DZ48	Enterobacteria_phage	1.1e-123	50.9

DBSCAN-SWA_348

4665182 : 4666457

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04467.1\|4665182_4666457_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.5e-86	43.0

DBSCAN-SWA_349

4669754 : 4671119

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04472.1\|4669754_4671119_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	9.0e-18	35.6

DBSCAN-SWA_350

4674893 : 4675412

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04475.1\|4674893_4675412_-	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	3.7e-49	56.6

DBSCAN-SWA_351

4682271 : 4693432

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04484.1\|4682271_4683030_+	peptidoglycan endopeptidase	A0A217EQL1	Bacillus_phage	9.4e-17	38.7
AWX04485.1\|4683152_4683734_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	6.2e-45	45.3
AWX04486.1\|4683771_4684938_-	MFS transporter	NA	NA	NA	NA
AWX04487.1\|4685099_4685189_-	YnhF family membrane protein	NA	NA	NA	NA
AWX04488.1\|4685486_4686512_+	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.3e-32	32.2
AWX04489.1\|4686529_4687441_-	LysR family transcriptional regulator	NA	NA	NA	NA
AWX04490.1\|4687553_4688753_+	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
AWX04491.1\|4689051_4690200_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	3.6e-84	44.8
AWX04492.1\|4690231_4690873_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.9e-24	37.3
AWX04493.1\|4691098_4692472_+	multidrug transporter MdtK	NA	NA	NA	NA
AWX04494.1\|4692961_4693432_-	heat-shock protein	A0A1D7SNF0	Cyanophage	5.8e-09	31.8

DBSCAN-SWA_352

4704815 : 4709025

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04502.1\|4704815_4705082_-	PAAR domain-containing protein	E5E3Y0	Burkholderia_phage	1.3e-05	37.8
AWX04503.1\|4706237_4707011_-	hypothetical protein	NA	NA	NA	NA
AWX04504.1\|4707003_4709025_-	lipase family protein	A0A2R8FER2	Brazilian_cedratvirus	2.1e-07	30.6

DBSCAN-SWA_353

4712875 : 4715506

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04508.1\|4712875_4715506_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.9e-96	32.4

DBSCAN-SWA_354

4728787 : 4729603

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04520.1\|4728787_4729603_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-35	41.4

DBSCAN-SWA_355

4732814 : 4735608

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04526.1\|4732814_4733837_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-14	23.9
AWX04794.1\|4734237_4735608_+	CBS domain-containing protein	A0A1W6JHY1	Lactococcus_phage	5.4e-47	36.8

DBSCAN-SWA_356

4740717 : 4747952

environmental_halophage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04532.1\|4740717_4741938_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.3e-92	41.9
AWX04533.1\|4741934_4743206_-	signal peptide peptidase SppA	NA	NA	NA	NA
AWX04534.1\|4743180_4743927_-	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	3.3e-06	24.3
AWX04535.1\|4743936_4745427_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AWX04536.1\|4745435_4745804_-	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	2.9e-16	42.2
AWX04537.1\|4745792_4746059_+	hypothetical protein	NA	NA	NA	NA
AWX04538.1\|4746300_4746660_+	CHAP domain-containing protein	NA	NA	NA	NA
AWX04539.1\|4746661_4747114_+	DUF3828 domain-containing protein	NA	NA	NA	NA
AWX04540.1\|4747223_4747952_-	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.1e-50	50.8

DBSCAN-SWA_357

4770136 : 4774881

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04560.1\|4770136_4772515_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.5e-172	36.7
AWX04561.1\|4772850_4773684_+	kinase/pyrophosphorylase	NA	NA	NA	NA
AWX04562.1\|4773834_4774881_+	3-deoxy-7-phosphoheptulonate synthase AroH	S4W5F1	Pandoravirus	6.1e-83	47.4

DBSCAN-SWA_358

4780201 : 4793621

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04567.1\|4780201_4780981_+	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.4e-12	29.1
AWX04568.1\|4780977_4782420_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	5.7e-55	34.7
AWX04569.1\|4782481_4783195_-	EAL domain-containing protein	NA	NA	NA	NA
AWX04570.1\|4783488_4783953_-	endopeptidase	A0A1V0DZX6	Clostridioides_phage	2.3e-13	36.7
AWX04571.1\|4784025_4784781_-	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2K9L407	Tupanvirus	1.7e-10	26.2
AWX04572.1\|4784780_4785332_-	glutathione peroxidase	NA	NA	NA	NA
AWX04573.1\|4785365_4786346_-	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
AWX04574.1\|4786449_4786749_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
AWX04575.1\|4786753_4789141_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AWX04576.1\|4789156_4790140_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.9e-35	43.2
AWX04577.1\|4790133_4790340_+	hypothetical protein	NA	NA	NA	NA
AWX04578.1\|4790444_4790801_-	50S ribosomal protein L20	NA	NA	NA	NA
AWX04579.1\|4790851_4791049_-	50S ribosomal protein L35	NA	NA	NA	NA
AWX04580.1\|4791146_4791689_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	32.9
AWX04581.1\|4791692_4793621_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.9e-128	37.1

DBSCAN-SWA_359

4799736 : 4805444

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04590.1\|4799736_4800498_+	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	32.3
AWX04591.1\|4800593_4801184_+	metal-dependent hydrolase	NA	NA	NA	NA
AWX04592.1\|4801311_4802703_+	L-cystine transporter	NA	NA	NA	NA
AWX04593.1\|4802751_4803006_-	cell division activator CedA	NA	NA	NA	NA
AWX04594.1\|4803194_4805444_+	catalase HPII	A0A2K9L572	Tupanvirus	8.4e-138	48.0

DBSCAN-SWA_360

4811638 : 4812466

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04602.1\|4811638_4812466_+	NAD(+) synthase	G3MA24	Bacillus_virus	1.9e-71	54.2

DBSCAN-SWA_361

4819796 : 4821017

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04610.1\|4819796_4821017_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-25	27.5

DBSCAN-SWA_362

4825624 : 4826245

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04615.1\|4825624_4826245_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.8e-08	28.4

DBSCAN-SWA_363

4831166 : 4833074

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04622.1\|4831166_4833074_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.2e-40	29.5

DBSCAN-SWA_364

4837902 : 4840020

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04626.1\|4837902_4838544_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	3.6e-17	34.6
AWX04627.1\|4838763_4840020_+	chitinase	W5VKF1	Buzura_suppressaria_nuclear_polyhedrosis_virus	1.5e-22	27.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP030078

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030078_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030078_1

40166-40255

Orphan

Consensus_repeat	Method
CCTTTTGGCTGGAAACGCCCGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030078_1

>merge|CP030078|1|40166-40255|CRISPRCasFinder
CCTTTTGGCTGGAAACGCCCGTCAGACTCTGCTTTTGTATAAGCCTGTCCAGCTGGGGTATAGCTCCCTTTTGGCTGGAAACGTCCGTCA

>CP030078|1|1|40166-40255|CRISPRCasFinder
CCTTTTGGCTGGAAACGCCCGTCA	GACTCTGCTTTTGTATAAGCCTGTCCAGCTGGGGTATAGCTC
CCTTTTGGCTGGAAACGTCCGTCA

Protein	Signature genes	Signature genes Name	Protein_function
CP030078.1\|AWX05041.1\|36175_36700_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP030078.1\|AWX05055.1\|57747_58221_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05040.1\|35902_36172_+\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
CP030078.1\|AWX05042.1\|36726_37068_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05050.1\|51223_55807_-\|phage-tail-tape-measure-protein	unknown	unknown	gnl\|CDD\|226450
CP030078.1\|AWX05036.1\|32693_33419_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05047.1\|49268_50066_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|163704
CP030078.1\|AWX05039.1\|34880_35546_-\|plasmid-stability-protein	unknown	unknown	gnl\|CDD\|222854
CP030078.1\|AWX05038.1\|34521_34881_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05046.1\|48690_49281_-\|tail-assembly-protein	unknown	unknown	gnl\|CDD\|227067
CP030078.1\|AWX05054.1\|57362_57746_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05044.1\|37842_38166_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05053.1\|56541_57288_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227779
CP030078.1\|AWX05049.1\|50846_51182_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227062
CP030078.1\|AWX05052.1\|56164_56482_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05043.1\|37136_37829_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222880
CP030078.1\|AWX05037.1\|33683_34481_+\|DUF2971-domain-containing-protein	unknown	unknown	gnl\|CDD\|378585
CP030078.1\|AWX05051.1\|55814_56084_-\|hypothetical-protein	unknown	unknown	unknown
CP030078.1\|AWX05048.1\|50058_50790_-\|phage-minor-tail-protein-L	unknown	unknown	gnl\|CDD\|130661
CP030078.1\|AWX05045.1\|39386_39818_-\|tail-fiber-assembly-protein	unknown	unknown	gnl\|CDD\|367075

Protein	Function_ID	Function_description	E-value
CP030078.1\|AWX05041.1\|36175_36700_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.17883e-07
CP030078.1\|AWX05040.1\|35902_36172_+\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	2.29605e-23
CP030078.1\|AWX05053.1\|56541_57288_-\|hypothetical-protein	gnl\|CDD\|227779	COG5492, COG5492, Bacterial surface proteins containing Ig-like domains [Cell motility and secretion].	3.78897e-33
CP030078.1\|AWX05047.1\|49268_50066_-\|phage-tail-protein	gnl\|CDD\|163704	cd08073, MPN_NLPC_P60, Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) found in proteins also containing NlpC/P60 domains. This family contains bacterial MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+)-like domains at the N-terminus of NlpC/P60 phage tail protein domains. These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity for the release of ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation. The JAMM proteins likely hydrolyze ubiquitin conjugates in a manner similar to thermolysin, in which the zinc-polarized aqua ligand serves as the nucleophile, compared with the classical DUBs that do so with a cysteine residue in the active site.	1.71636e-40
CP030078.1\|AWX05039.1\|34880_35546_-\|plasmid-stability-protein	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	6.57606e-41
CP030078.1\|AWX05049.1\|50846_51182_-\|phage-tail-protein	gnl\|CDD\|227062	COG4718, COG4718, Phage-related protein [Function unknown].	6.14718e-50
CP030078.1\|AWX05043.1\|37136_37829_-\|hypothetical-protein	gnl\|CDD\|222880	PHA02564, V, virion protein; Provisional.	5.08203e-43
CP030078.1\|AWX05046.1\|48690_49281_-\|tail-assembly-protein	gnl\|CDD\|227067	COG4723, COG4723, Phage-related protein, tail component [Function unknown].	1.74402e-72
CP030078.1\|AWX05045.1\|39386_39818_-\|tail-fiber-assembly-protein	gnl\|CDD\|367075	pfam02413, Caudo_TAP, Caudovirales tail fibre assembly protein, lambda gpK. This family contains bacterial and phage tail fibre assembly proteins. E.coli contains several members of this family although the function of these proteins is uncertain. Using the lambda phage members as examples, there are both gptfa and gpK tail proteins here. GpK forms part of the TTC or tail-tip complex that is located at the distal end of the tail. TTCs form the platform on which the tail-tube proteins self-assemble and are also the attachment point for fibers or receptor-binding proteins that mediate phage-adsorption to the surface of the host cell. TTC assembly starts with gpJ, which is also known as the central tail fibre and is involved in host-cell adsorption. It is the C-terminus of gpJ that interacts with the lamB receptor on host cells. A number of intermediates including gpK then interact with gpJ during tail morphogenesis.	4.63067e-30
CP030078.1\|AWX05037.1\|33683_34481_+\|DUF2971-domain-containing-protein	gnl\|CDD\|378585	pfam11185, DUF2971, Protein of unknown function (DUF2971). This bacterial family of proteins has no known function.	4.49896e-10
CP030078.1\|AWX05048.1\|50058_50790_-\|phage-minor-tail-protein-L	gnl\|CDD\|130661	TIGR01600, lambda_minor_tail, lambda-like phage minor tail protein L. This model detects members of the family of phage lambda minor tail protein L. This model was built as a fragment model to allow detection of fragmentary sequences, as might be found in cryptic prophage regions. [Mobile and extrachromosomal element functions, Prophage functions].	5.34639e-146
CP030078.1\|AWX05050.1\|51223_55807_-\|phage-tail-tape-measure-protein	gnl\|CDD\|226450	COG3941, COG3941, Mu-like prophage protein [General function prediction only].	2.97341e-145

>CP030078.1|AWX05045.1|39386_39818_-|tail-fiber-assembly-protein
MKKYFSNTEKSFYLEETVKTYQAQDISVPADLMIISDDEYEAFMVSPDRKAPQYNVESECMEWVDIEPPTREEAIENAEALKAQLLSVAAQAIAPLQDAVDLSMATDDEMASLSAWKKYRVLLNRVDTSEPDEIEWPESPLTE
>CP030078.1|AWX05044.1|37842_38166_-|hypothetical-protein
MSNEMAGVTPEQVERIAAIVAREVVGKLGKELREEIGQGVNDQLKTYFGDMTPSQHSIQHSNLDKLLNRLDAISSGFFGGIISKITSFLITALLLGLAAYGVKNGLQ
>CP030078.1|AWX05043.1|37136_37829_-|hypothetical-protein
MKTPRGIRNNNPGNLDKGSPWQGLIDNPAEPRFCTFKDPVWGIRALAVTLITYHDKRRAKDGSSIDTIREVIERWAPPHENNTVAYVNEVSKAVGVTPDMIIDLHDYDTLRPLVEAIIRHENGRGPLKTPNTWYAAEVIEEGLRRAGVVKPVKTVKAVPVTKETAGATVTAGIGLAQLADVMPQVSAAMDKAQGHITSGDTVRIIFGIATIVVAGFIAWSQVRKHQNGMV
>CP030078.1|AWX05042.1|36726_37068_-|hypothetical-protein
MSVLIRWEIVRPGKQSKRRPDRRTGKGFKAQWTSKMRHLMKCGGKMLLLFIASCMISGCVIKTQTSGVLFCDAANPIYVSNDDFMTEETEREILFHNTMGERLCNWQDRQALN
>CP030078.1|AWX05041.1|36175_36700_+|GNAT-family-N-acetyltransferase
MANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQRKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSLFYPTKGIEKLFGGK
>CP030078.1|AWX05040.1|35902_36172_+|DUF1778-domain-containing-protein
MSALKKQRIDLRLTDDDKSMIEEAAAMTNQTITQFMVASASERAAEVIEQHRRLILSEESWNIVMDAISNPPAPNDRLKRAAERLQSME
>CP030078.1|AWX05039.1|34880_35546_-|plasmid-stability-protein
MTRIIVVGGTKGGPGKSTVAQQIAVCLKVKKKKKTHVTDIDIQRTTTSWCEDRRQNEDLELIPFAYVQDDIVKHIKSLKGRYDYVVIDAGGFDSEIQRQAMLLADFIIIPLRPKRRDLKSLRDIDPIIDNVRNVNETVKIRAVVNQCPSLPSQASRILAAKEIVETFGIEAAPVNLYNRNVYDDAEEAGRSIFEMTGAERDKKAEAEFEEFVDYIMSLEEE
>CP030078.1|AWX05038.1|34521_34881_-|hypothetical-protein
MSMRMGDLAKRKDPEEPVKSSTPMRQPVRPQGRPTRGKEKIKSRTMSLEDEYFDLLEMMKFIPRFEKFTRSDVIRAAIFHLAEKSPQEIEDIVKLNEAITAADVTMRTDEIKRELMKKG
>CP030078.1|AWX05037.1|33683_34481_+|DUF2971-domain-containing-protein
MMILYKYVPEETLKLFFDHDATSFKFTPVGQFNDPFETYGVSFASEDKDSLAHLTFRSKINSDLASLCLSRSPLEVLMWSHYAQHHRGYVVGIDTELAGFNDENLCLITANEGGIDYLDERDKSRVIISDKNFKNKDIVKKVLFRKSQHWKYEKEVRIVIESDKLIPIGDDEEDRFYIYKAPGTNIIKEIFIGISNDDFELTALENDNLRNAILDNNIKIQKCCFKRGTWDLDKTDYDMSLLTDWPSADFGILAGVISAFEKNEI
>CP030078.1|AWX05036.1|32693_33419_-|hypothetical-protein
MSQIFFNTINNDQYDFMTEWDTTVMDKWVAENIGLSRCKDEAELFETKWFDYRDMHPLMATCLFTEAYKRQYSYIMLSHGREHYETAQFTTGLKRVPYQEQSTANKTSLWKARQFADQYCCSYDYFISTVLSAAARRLWDKLPRPQHLWQPELIEIFEQKLAKRAVTRLDDSLVSFKHLGDMQHDPIQERYFEWVLERLRGITRDKRVRIIFSAVWLMEIVPERVIYAHFPEELEEARRFC
>CP030078.1|AWX05046.1|48690_49281_-|tail-assembly-protein
MSELVHVQLGGPMARHFGRHWHLKVRNTKQALDLVEANRPGLKAWMKRNMKTYDKYHIQITNKQGHKWSVDESEFQMMGQSDNIAKIRITPVPRGSGGSAFGWFQTVVGAALMVISAFIMPALVPLGLSLMMGGISQLISPQATNDSVRQADNSNSFYFDGPQNTTNQGNPVQLIYGEEILVGSQVVSSSITIDQL
>CP030078.1|AWX05047.1|49268_50066_-|phage-tail-protein
MGNRAFPELGSDVMQEIYLTAIKRYPNEACGFLVRTTGDKYRFMEARNVSENPKNTFVMHADDIIAAEDTGDVVAIWHSHTDESAEASDADRAGCEATEVPWLILAVRKNVEGDAPFHFSEMNVITPDGFEMPYLGRPYVFGVFDCWMLCRDYLKREFNVELNPNPHLHIPSWYTGDTDILDQNYRNEGLVRLAPGTEPQRGDVFFIQYGKMPDHCAVYIGDGMILHHQIDRLSCRAYYGGMYQKHTTHHLRHRDLLKGDETCLS
>CP030078.1|AWX05048.1|50058_50790_-|phage-minor-tail-protein-L
MLAPLYFKEETMGIKADIQSLSPSALIELFELDMSNTTSGGKLFFHAGTNELMEPVVWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVSAEVQANDDLVGCRIIRKMTLARFLDAANFKDGNPTADPNQHFPDEMWFIEQKTLETHEVVEFELSSVFDLMGVQLPYRQIIKNTCPWKYRGPECGYTGPYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIHFGGFIGATRYG
>CP030078.1|AWX05049.1|50846_51182_-|phage-tail-protein
MERLTFNWYPDYESEKTVKPNVTVLNFGDDYEQRQAKGLNRIKEEWSLTFTRSYDVINAVDDFLTARAAVESFYWTNPRGKKIVVVCDSHTVKRYQGYQVLTATFRQIYEG
>CP030078.1|AWX05050.1|51223_55807_-|phage-tail-tape-measure-protein
MSQNVEFILSLEDKQFTASIDRAGKLLTRFGEQATKPAQKINNLERSLGSVSRIIGVLESKLDATADKLQDVAAGFELVSDVSRKTRGNITSLNSGLKTLIERVDTTTSSVNKLTTSLRKVQSELNEFSDWATFAGKSASRFGTEVKEASSSVSGMNTRLNTTTKRLSNWGVTTSQAAEGLKKVRDQMDAVIGRQQLISKPVRVRTSGYGEGGGNGGGGRRGGTNGHGWRGAENGVFSGLRGNIFLLGEIGDAARTVTDILFGWQKPIIEAASEMERMRVMLRGLNKDKANPGKAAAEDMQYIVDMAQNAPFAMQALTDSFVKFRSAGLDPTDGSLKALVDSVARFGGDSELLKRAAVAVQQMSGKGVVSMEELRQQLGEAVPNAMKAMADAAGITMGELTKAVSTGTVEAKQALSLMFVGLRAENENAAKDMMQTYTGALAQLQTSFTLFADRVGQAGYLDSLSKGMKELASIMNSAEGISFANSLGSGLSTAIDGLRELAQWLAKNQELVISLGKVVAAMVAFKLMRAGIAGVIGTAGQMVNTFTKMSTVLQAPFNLGATAVTRFNRAARMGLAPIPSLIFAIRGAITGLQGAFAGLTAFIAANPIGAAFTVATVAVAGLITYMTMLRSETSKVVDEIRKIPEAMTAAKRAQMAARAAELEKQIQRDQQALKTGESVNYYSTAAGPVAVKESKEVVEARLKKNQEEYERTTGTMALGDGAVAKRLAKEAAESQIEKIRADNQVFSATFVKARQEALDKIQKINDDKSLSDDEKNKLLAPLREKVNKSYLEPAQKLVDDLSSRKNATEKQIAHFSDMLEKAKKEGNTEQVQKLQGSIRGYQEHLEAVAQELTQAEFERDNAAKTGKGVMSNQGTVLGLGTTDKAAQKALAQYMRNQMDSATYQRTLPDGTAMLDFEGKPIIGPKQLKTQLNLQKASSASSLEKMSDEERAAAIAALTKAREQDAAAAEKAGQRTANASQRAARKEENAQRKLAAGYQKALDKADQLMGQMGESSKATVSFDQSLRDTTKSLTELANAVPNEFITQEMIDKAKSRLADLANASDDYREMFNRRNVEQMISTWAPESDSIISAGYKPSREEKVVDFNDTYNRNLKALMDLRDQASDPKIVALYTKQINQLVAAGNTALIKETGTATQKLALEYENLADQLENSWSNLFSNMTDTLTDFVMKGKMDFSSLAESILRDITNMVVKTQITLPLMNMLGMGTTAAGSSQSGNLLSGVASAVANQGVRMNAVNGDKSVGEATKETSSSVSGLGQTTQQTTSAIGSATNAIGSWVNGLFTSTEAKDAETKAVKTSIFSMQNLSSVTGALSAAFAMLGANMSGSGNKWLSFGATIASGLVSAWAGGGFDNIGSGSSGSNSGFNNLTGSASDGTGGIPAIPKFAKGGIFGKDGVVPLRAYQKGGIADSPQLALFGEGDMNEAYVPLPDGRSIPVTLNAEGVKGGGGGVFSPVSIEINVNSDGSVSENSNSEGAWSQAAQRMKAIALETIAQEKRPGGSLNPNSQRN
>CP030078.1|AWX05051.1|55814_56084_-|hypothetical-protein
MSPLELLGVPLTMFWMLSRNIDRLRAEEDVRNLQVARAAQADGEGVKAFMEGLQLRIGRPVVTDKVYDPRKDKADPDAKEQLMQIFGRG
>CP030078.1|AWX05052.1|56164_56482_-|hypothetical-protein
MTKLLDLDSILPPKKSIKFGGQEYPIVEMTVGLFVSIKQMEGKDLQNMSPVEQVTAYADLVRKVIPSVPDAVLEKLTVPQLQQIFTFAMEVIDEENEKAAGEGAK
>CP030078.1|AWX05053.1|56541_57288_-|hypothetical-protein
MSNTHVKNIKLGACKVSFGGVDLGYTKGGVQVEVATETLKVTVDQLGQTTISELVQGRNITITAPLAESVLQNMVDLMPGSTLSEEDNAVTITSAQGVNLIDVAKELVLTPQDTTDYVLTIPKAATAGNFTMTYQSDDVRVFSVQFTAYPDDDGVLGKMSGPKPVKTVSISPESPEVKAGETVQLTAQITPADAGDKTGVWESDNQEKATVDQTGLVRGVAEGSANISFTSNSGGKKATKAVTVNSAE
>CP030078.1|AWX05054.1|57362_57746_-|hypothetical-protein
MFIEAFASLMQKAKIGTVGTDIFCHYMPANVKSGVLLVTPNTGITIDHELKGFYHDSFTVIVRNATITKAVAKANKIMDMFPVEETVSEGVYFRLVRPMSMPITYPKNEGSLIEAGIPIEFAGYLLN
>CP030078.1|AWX05055.1|57747_58221_-|hypothetical-protein
MGLKYDAHQFKRAGDRLNNSQKAFKRYLIRDMEKLARLVERLARAMAPLETGSLESAIFARVVKEGYTGLRIELSVSGAKPREGHPGVEVGDYAEYMELGKYRLGYLSRMKSVTNPPVAGVKPRVGPLFLERAVQISEKQFTQTIAEAARKAGFTRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP030078_1	1.1\|40190\|42\|CP030078\|CRISPRCasFinder	40190-40231	42	NZ_CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	40190-40231	1.0
CP030078_1	1.1\|40190\|42\|CP030078\|CRISPRCasFinder	40190-40231	42	NZ_CP029247	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence	40170-40211	1.0
CP030078_1	1.1\|40190\|42\|CP030078\|CRISPRCasFinder	40190-40231	42	NZ_KX015668	Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence	69193-69234	1.0

1. spacer 1.1|40190|42|CP030078|CRISPRCasFinder matches to NZ_CP030078 (Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

2. spacer 1.1|40190|42|CP030078|CRISPRCasFinder matches to NZ_CP029247 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

3. spacer 1.1|40190|42|CP030078|CRISPRCasFinder matches to NZ_KX015668 (Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 107614

127

Salmonella_phage(94.74%)

tail,terminase,integrase,capsid

attL 1067:1089|attR 108237:108259

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX04998.1\|0_1065_+	replication protein RepA	J9Q7H0	Salmonella_phage	1.5e-190	100.0
1067:1089	attL	NA	NA	NA	NA
AWX04999.1\|1633_1846_-	hypothetical protein	J9Q7S8	Salmonella_phage	8.1e-35	100.0
AWX05000.1\|1845_2181_-	hypothetical protein	J9Q7Z5	Salmonella_phage	1.6e-56	99.1
AWX05001.1\|2177_2357_-	hypothetical protein	J9Q6J1	Salmonella_phage	7.3e-21	98.3
AWX05002.1\|2397_2673_-	hypothetical protein	J9Q738	Salmonella_phage	5.4e-47	96.7
AWX05003.1\|2741_3152_-	hypothetical protein	J9Q7G9	Salmonella_phage	1.1e-75	97.8
AWX05004.1\|3668_4499_-	SPFH/Band 7/PHB domain protein	J9Q7Z4	Salmonella_phage	1.1e-127	99.3
AWX05005.1\|4502_4703_-	hypothetical protein	J9Q6J0	Salmonella_phage	9.3e-25	93.9
AWX05006.1\|4794_5871_-	recombinase	J9Q736	Salmonella_phage	5.5e-204	99.7
AWX05007.1\|5873_6140_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.6e-40	100.0
AWX05008.1\|6139_7084_-	exonuclease	J9Q7S6	Salmonella_phage	8.8e-182	99.4
AWX05009.1\|7144_8173_-	regulator	J9Q7Z3	Salmonella_phage	1.3e-165	99.7
AWX05010.1\|8292_8766_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.3e-72	99.3
AWX05011.1\|8944_9196_+	hypothetical protein	NA	NA	NA	NA
AWX05012.1\|9268_9832_+	DNA-binding protein	J9Q7G7	Salmonella_phage	9.9e-64	65.1
AWX05013.1\|9861_10305_-	hypothetical protein	J9Q7S4	Salmonella_phage	7.8e-72	100.0
AWX05014.1\|10301_13820_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	99.4
AWX05015.1\|13794_13998_-	hypothetical protein	J9Q6I7	Salmonella_phage	5.5e-33	100.0
AWX05016.1\|14000_15236_-	porphyrin biosynthesis protein	J9Q733	Salmonella_phage	6.0e-239	99.8
AWX05017.1\|15332_17723_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	0.0e+00	92.7
AWX05018.1\|17832_18045_-	hypothetical protein	NA	NA	NA	NA
AWX05019.1\|18308_18695_+	XRE family transcriptional regulator	NA	NA	NA	NA
AWX05020.1\|18686_19793_-\|integrase	integrase	A0A1P8DTG6	Proteus_phage	5.6e-26	32.6
AWX05021.1\|19964_20381_-	hypothetical protein	NA	NA	NA	NA
AWX05022.1\|20371_20896_-	hypothetical protein	NA	NA	NA	NA
AWX05023.1\|20992_21238_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	2.9e-12	43.6
AWX05024.1\|21237_21603_-	hypothetical protein	K7PH35	Enterobacteria_phage	1.5e-36	65.6
AWX05025.1\|21618_21822_-	hypothetical protein	A0A0B6VT64	Edwardsiella_phage	4.4e-06	49.2
AWX05026.1\|21832_22666_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	7.0e-90	65.1
AWX05027.1\|22813_24046_+	hypothetical protein	NA	NA	NA	NA
AWX05028.1\|25051_25357_-	C-type natriuretic protein	J9Q7S1	Salmonella_phage	1.2e-47	98.0
AWX05029.1\|25353_25506_-	hypothetical protein	J9Q7Z1	Salmonella_phage	4.0e-20	100.0
AWX05120.1\|25505_25712_-	hypothetical protein	J9Q6I3	Salmonella_phage	2.8e-32	100.0
AWX05030.1\|25701_25878_-	hypothetical protein	J9Q729	Salmonella_phage	1.3e-22	93.1
AWX05031.1\|25877_27200_-	DNA ligase	J9Q7G5	Salmonella_phage	2.8e-258	99.3
AWX05121.1\|27234_27492_-	hypothetical protein	J9Q7R9	Salmonella_phage	1.2e-35	96.5
AWX05122.1\|27402_27744_+	hypothetical protein	NA	NA	NA	NA
AWX05032.1\|27792_28587_-	hypothetical protein	J9Q7Z0	Salmonella_phage	2.1e-112	76.5
AWX05033.1\|28773_30027_+	sel1 repeat family protein	NA	NA	NA	NA
AWX05034.1\|30018_31230_-	DNA primase	J9Q720	Salmonella_phage	3.7e-209	93.8
AWX05035.1\|31292_32633_-	DNA helicase	J9Q7G4	Salmonella_phage	1.3e-247	99.8
AWX05036.1\|32693_33419_-	hypothetical protein	J9Q7R8	Salmonella_phage	5.4e-139	98.3
AWX05037.1\|33683_34481_+	DUF2971 domain-containing protein	J9Q7Y9	Salmonella_phage	7.3e-12	26.4
AWX05038.1\|34521_34881_-	hypothetical protein	J9Q7G3	Salmonella_phage	2.3e-45	100.0
AWX05039.1\|34880_35546_-	plasmid stability protein	J9Q7R7	Salmonella_phage	4.7e-113	95.0
AWX05040.1\|35902_36172_+	DUF1778 domain-containing protein	NA	NA	NA	NA
AWX05041.1\|36175_36700_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWX05042.1\|36726_37068_-	hypothetical protein	J9Q7G2	Salmonella_phage	6.9e-28	80.6
AWX05043.1\|37136_37829_-	hypothetical protein	J9Q7Y7	Salmonella_phage	3.9e-126	96.1
AWX05044.1\|37842_38166_-	hypothetical protein	J9Q6E7	Salmonella_phage	8.0e-50	97.2
AWX05045.1\|39386_39818_-\|tail	tail fiber assembly protein	B6SCW7	Bacteriophage	1.5e-16	53.8
AWX05046.1\|48690_49281_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	9.0e-100	91.8
AWX05047.1\|49268_50066_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	3.5e-155	95.1
AWX05048.1\|50058_50790_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	3.9e-137	100.0
AWX05049.1\|50846_51182_-\|tail	phage tail protein	J9Q6E1	Salmonella_phage	5.2e-60	99.1
AWX05050.1\|51223_55807_-\|tail	phage tail tape measure protein	J9Q712	Salmonella_phage	0.0e+00	91.4
AWX05051.1\|55814_56084_-	hypothetical protein	J9Q7F7	Salmonella_phage	8.4e-37	100.0
AWX05052.1\|56164_56482_-	hypothetical protein	J9Q7R3	Salmonella_phage	6.0e-50	98.1
AWX05053.1\|56541_57288_-	hypothetical protein	J9Q7Y4	Salmonella_phage	6.8e-129	98.4
AWX05054.1\|57362_57746_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-67	100.0
AWX05055.1\|57747_58221_-	hypothetical protein	J9Q711	Salmonella_phage	2.3e-82	100.0
AWX05056.1\|58211_58556_-	hypothetical protein	J9Q7F6	Salmonella_phage	1.9e-57	100.0
AWX05057.1\|58653_59487_-	hypothetical protein	J9Q7R2	Salmonella_phage	1.3e-152	99.6
AWX05058.1\|59486_59921_-	hypothetical protein	J9Q7Y3	Salmonella_phage	8.1e-74	99.3
AWX05059.1\|59964_60888_-	hypothetical protein	J9Q6D6	Salmonella_phage	9.6e-157	99.7
AWX05060.1\|60962_61838_-\|capsid	phage major capsid protein	J9Q710	Salmonella_phage	8.5e-163	99.7
AWX05061.1\|61864_62758_-	hypothetical protein	J9Q7F4	Salmonella_phage	3.3e-138	91.6
AWX05062.1\|62780_64355_-	hypothetical protein	J9Q7R1	Salmonella_phage	3.5e-300	98.9
AWX05063.1\|64388_65645_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	1.8e-251	100.0
AWX05064.1\|65647_66289_-	DNA-binding protein	J9Q6D4	Salmonella_phage	3.4e-108	98.1
AWX05065.1\|66484_66751_-	hypothetical protein	J9Q757	Salmonella_phage	1.3e-42	100.0
AWX05066.1\|66760_67660_-	hypothetical protein	J9Q7I6	Salmonella_phage	8.2e-169	99.7
AWX05067.1\|67656_67911_-	hypothetical protein	J9Q7U0	Salmonella_phage	4.1e-41	98.8
AWX05068.1\|67903_68542_-	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	3.8e-112	100.0
AWX05069.1\|68538_69207_-	chromosome partitioning protein ParB	J9Q6L1	Salmonella_phage	4.3e-114	99.1
AWX05070.1\|69206_69905_-	chromosome partitioning protein ParB	J9Q756	Salmonella_phage	2.5e-125	99.1
AWX05071.1\|69969_71529_+	ATP-dependent helicase	J9Q7I4	Salmonella_phage	2.8e-294	99.2
AWX05072.1\|71531_71810_+	hypothetical protein	J9Q7T9	Salmonella_phage	1.3e-40	98.9
AWX05073.1\|71875_72400_+	hypothetical protein	NA	NA	NA	NA
AWX05074.1\|72443_73244_-	hypothetical protein	A0A0M4QWT0	Salmonella_phage	1.2e-06	39.0
AWX05075.1\|73358_73871_+	transcriptional regulator	J9Q6L0	Salmonella_phage	3.1e-56	68.2
AWX05076.1\|74188_74839_+	hypothetical protein	J9Q754	Salmonella_phage	3.5e-113	98.6
AWX05077.1\|74889_75093_+	hypothetical protein	J9Q7I3	Salmonella_phage	8.3e-29	97.0
AWX05078.1\|75734_76217_-	hypothetical protein	J9Q805	Salmonella_phage	7.1e-87	96.9
AWX05079.1\|76229_76463_-	hypothetical protein	NA	NA	NA	NA
AWX05123.1\|76422_76710_-	ABC transporter	J9Q753	Salmonella_phage	6.6e-48	97.8
AWX05080.1\|76830_77226_-	hypothetical protein	J9Q7I1	Salmonella_phage	1.2e-42	66.2
AWX05081.1\|77354_77666_-	hypothetical protein	J9Q7T7	Salmonella_phage	7.9e-47	96.1
AWX05082.1\|77806_78025_-	hypothetical protein	J9Q804	Salmonella_phage	9.2e-34	97.2
AWX05083.1\|78029_78251_-	hypothetical protein	J9Q6K7	Salmonella_phage	1.4e-34	98.6
AWX05084.1\|79829_80135_+	hypothetical protein	NA	NA	NA	NA
AWX05124.1\|80172_80490_-	hypothetical protein	J9Q750	Salmonella_phage	3.9e-49	83.8
AWX05085.1\|80489_80726_-	DUF1380 domain-containing protein	J9Q7H8	Salmonella_phage	1.6e-39	97.4
AWX05086.1\|80811_81078_-	hypothetical protein	J9Q7T5	Salmonella_phage	3.1e-31	70.5
AWX05087.1\|81264_81468_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	6.8e-31	97.0
AWX05088.1\|81523_82222_-	DUF1311 domain-containing protein	J9Q6K3	Salmonella_phage	2.0e-114	91.8
AWX05089.1\|82260_82812_-	hypothetical protein	J9Q748	Salmonella_phage	2.3e-97	92.3
AWX05090.1\|82808_83450_-	HD domain-containing protein	J9Q7H7	Salmonella_phage	1.4e-114	99.1
AWX05091.1\|83541_83913_-	hypothetical protein	J9Q7T4	Salmonella_phage	7.2e-63	99.2
AWX05092.1\|83915_84197_-	hypothetical protein	J9Q801	Salmonella_phage	3.6e-46	97.8
AWX05093.1\|84193_84883_-	hypothetical protein	J9Q6K2	Salmonella_phage	8.8e-123	96.9
AWX05094.1\|84941_86645_-	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	0.0e+00	98.8
AWX05095.1\|86768_87341_-	hypothetical protein	J9Q7H6	Salmonella_phage	5.3e-97	97.9
AWX05096.1\|87449_88292_-	hypothetical protein	J9Q7T3	Salmonella_phage	2.1e-70	71.1
AWX05097.1\|88400_88589_-	hypothetical protein	J9Q800	Salmonella_phage	1.2e-26	100.0
AWX05098.1\|88598_89093_-	hypothetical protein	J9Q6J9	Salmonella_phage	2.1e-81	98.2
AWX05099.1\|89234_89843_-	ribonuclease HI	J9Q745	Salmonella_phage	1.4e-116	99.0
AWX05100.1\|90438_90669_-	hypothetical protein	J9Q7H5	Salmonella_phage	2.1e-36	100.0
AWX05101.1\|90867_91461_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	2.1e-112	100.0
AWX05102.1\|91646_92573_-	hypothetical protein	J9Q7Z9	Salmonella_phage	1.4e-107	92.5
AWX05103.1\|92617_93175_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	7.0e-102	99.5
AWX05104.1\|93184_93604_-	hypothetical protein	J9Q743	Salmonella_phage	6.4e-68	97.8
AWX05105.1\|93667_94312_-	hypothetical protein	J9Q7H4	Salmonella_phage	5.2e-117	100.0
AWX05106.1\|94311_94788_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.4e-90	100.0
AWX05107.1\|94784_95198_-	hypothetical protein	J9Q7Z8	Salmonella_phage	1.8e-70	97.1
AWX05108.1\|95199_96315_-	thymidylate synthase	J9Q6J6	Salmonella_phage	2.4e-218	98.9
AWX05109.1\|96492_97362_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	8.7e-160	97.9
AWX05110.1\|97444_98587_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	1.7e-219	100.0
AWX05111.1\|98694_101010_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	99.7
AWX05112.1\|101087_101657_-	hypothetical protein	J9Q7Z7	Salmonella_phage	5.8e-104	100.0
AWX05113.1\|101668_102415_-	hypothetical protein	J9Q6J5	Salmonella_phage	1.3e-135	98.0
AWX05114.1\|102404_104321_-	exonuclease	J9Q741	Salmonella_phage	0.0e+00	94.4
AWX05115.1\|104317_104554_-	hypothetical protein	J9Q7H1	Salmonella_phage	1.1e-29	98.4
AWX05116.1\|104550_105636_-	exonuclease SbcCD subunit D	J9Q7S9	Salmonella_phage	4.2e-204	97.8
AWX05117.1\|105864_106368_+	hypothetical protein	J9Q7Z6	Salmonella_phage	2.1e-89	97.6
AWX05118.1\|106399_106894_-	GNAT family N-acetyltransferase	J9Q6J3	Salmonella_phage	7.8e-89	98.2
AWX05119.1\|106969_107614_-	hypothetical protein	J9Q739	Salmonella_phage	2.2e-123	99.1
108237:108259	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP030079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3436 : 46373

Escherichia_phage(29.41%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX05126.1\|3436_4141_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.0e-138	99.6
AWX05127.1\|4086_4272_-	hypothetical protein	NA	NA	NA	NA
AWX05128.1\|4640_5429_+	winged helix family transcriptional regulator	NA	NA	NA	NA
AWX05129.1\|5428_5947_+	hypothetical protein	NA	NA	NA	NA
AWX05130.1\|5951_6368_-	fosfomycin resistance glutathione transferase FosA3	Q2LI91	Bacillus_phage	2.0e-08	35.6
AWX05131.1\|6753_7458_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWX05132.1\|7579_8485_+	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
AWX05133.1\|8481_9720_+	MFS transporter	NA	NA	NA	NA
AWX05134.1\|9719_10304_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AWX05135.1\|10249_10606_+	hypothetical protein	NA	NA	NA	NA
AWX05136.1\|10796_11561_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AWX05137.1\|11730_12435_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWX05138.1\|12471_13452_-	hypothetical protein	NA	NA	NA	NA
AWX05139.1\|13451_13712_-	hypothetical protein	NA	NA	NA	NA
AWX05140.1\|13815_14019_+	hypothetical protein	NA	NA	NA	NA
AWX05141.1\|14326_14596_+	hypothetical protein	NA	NA	NA	NA
AWX05142.1\|14647_15034_+	hypothetical protein	NA	NA	NA	NA
AWX05143.1\|15069_15579_+	hypothetical protein	NA	NA	NA	NA
AWX05144.1\|15583_16360_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	3.6e-48	85.1
AWX05145.1\|16453_16738_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
AWX05146.1\|16785_17439_-	chromosome partitioning protein ParA	E5FFJ3	Burkholderia_phage	7.0e-45	45.4
AWX05147.1\|17716_18688_+	plasmid segregation protein parM	A0A222YXF2	Escherichia_phage	1.4e-68	44.5
AWX05148.1\|18692_19082_+	plasmid stability protein	NA	NA	NA	NA
AWX05149.1\|19085_20357_-	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	3.5e-157	64.0
AWX05212.1\|20356_20785_-	peptidase	A0A1W6JNS2	Morganella_phage	2.3e-28	51.2
AWX05150.1\|21239_21983_+	hypothetical protein	NA	NA	NA	NA
AWX05151.1\|22337_22799_+	hypothetical protein	NA	NA	NA	NA
AWX05152.1\|22798_23137_+	hypothetical protein	NA	NA	NA	NA
AWX05153.1\|23521_24280_+	hypothetical protein	NA	NA	NA	NA
AWX05154.1\|24687_25197_+	antirestriction protein ArdA	A0A222ZHP3	Rhodococcus_phage	6.3e-09	30.8
AWX05155.1\|25239_25428_+	hypothetical protein	NA	NA	NA	NA
AWX05156.1\|26250_26583_+	DUF905 domain-containing protein	NA	NA	NA	NA
AWX05157.1\|26650_28639_+	hypothetical protein	G8DH78	Emiliania_huxleyi_virus	1.7e-25	30.2
AWX05158.1\|28640_29108_+	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
AWX05159.1\|29104_29839_+	hypothetical protein	NA	NA	NA	NA
AWX05160.1\|29835_30072_+	hypothetical protein	NA	NA	NA	NA
AWX05161.1\|30303_30462_+	type I toxin-antitoxin system hok family toxin	NA	NA	NA	NA
AWX05213.1\|31369_31726_+	hypothetical protein	NA	NA	NA	NA
AWX05162.1\|31768_32587_+	SAM-dependent DNA methyltransferase	H7BVT3	unidentified_phage	4.0e-13	34.4
AWX05163.1\|32666_33158_+	antirestriction protein	NA	NA	NA	NA
AWX05164.1\|33202_33505_+	hypothetical protein	NA	NA	NA	NA
AWX05165.1\|33501_33759_-	XRE family transcriptional regulator	A0A248SLB9	Klebsiella_phage	2.3e-07	48.3
AWX05166.1\|33809_34022_+	hypothetical protein	NA	NA	NA	NA
AWX05167.1\|34514_34661_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
AWX05168.1\|34715_35285_+	hypothetical protein	NA	NA	NA	NA
AWX05169.1\|35692_36526_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	3.3e-47	40.6
AWX05170.1\|37255_37591_+	nikA protein	NA	NA	NA	NA
AWX05171.1\|37612_40312_+	relaxase NikB	NA	NA	NA	NA
AWX05172.1\|40407_41559_+	Fic family protein	D7RWK9	Brochothrix_phage	1.5e-29	28.4
AWX05173.1\|41684_42461_+	hypothetical protein	NA	NA	NA	NA
AWX05174.1\|42491_42761_-	hypothetical protein	NA	NA	NA	NA
AWX05175.1\|42833_45134_-	conjugal transfer protein TrbC	NA	NA	NA	NA
AWX05176.1\|45242_46373_+\|transposase	transposase	Q9G0F2	Phage_Gifsy-1	2.0e-188	85.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. CP030081

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 31135

Acanthamoeba_polyphaga_mimivirus(11.11%)

integrase,transposase

attL 9583:9601|attR 36998:37016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX05510.1\|2221_4159_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
AWX05511.1\|4124_5156_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
AWX05512.1\|5136_6363_-	type IV secretion protein	NA	NA	NA	NA
AWX05513.1\|6362_7199_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
AWX05514.1\|7200_7941_-	Type IV secretory pathway component	NA	NA	NA	NA
AWX05515.1\|7940_8162_-	hypothetical protein	NA	NA	NA	NA
AWX05516.1\|8322_9333_-	type IV secretion protein	NA	NA	NA	NA
AWX05517.1\|9344_9605_-	hypothetical protein	NA	NA	NA	NA
9583:9601	attL	NA	NA	NA	NA
AWX05518.1\|9614_10247_-	type IV secretion protein	NA	NA	NA	NA
AWX05519.1\|10243_12802_-	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
AWX05520.1\|12699_13017_-	conjugal transfer protein	NA	NA	NA	NA
AWX05551.1\|13029_13350_-	type IV secretion protein	NA	NA	NA	NA
AWX05552.1\|13312_13621_-	hypothetical protein	NA	NA	NA	NA
AWX05521.1\|13767_15738_-	type I DNA topoisomerase	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	1.2e-76	34.2
AWX05522.1\|15734_16475_-	cell wall hydrolase	NA	NA	NA	NA
AWX05523.1\|16484_16973_-	conjugal transfer protein TraL	NA	NA	NA	NA
AWX05524.1\|17397_17655_+	hypothetical protein	NA	NA	NA	NA
AWX05525.1\|17946_18270_+	hypothetical protein	NA	NA	NA	NA
AWX05526.1\|18279_19344_+	TraN	A0A0R6PHM5	Moraxella_phage	5.3e-34	34.9
AWX05527.1\|19344_19992_-	resolvase	NA	NA	NA	NA
AWX05528.1\|19991_20723_-	hypothetical protein	A0A1D6ZIU7	Xanthomonas_phage	1.9e-06	33.9
AWX05529.1\|20712_21579_-	3'-5' exonuclease	K7RFY5	Vibrio_phage	1.1e-26	40.9
AWX05530.1\|21888_22653_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AWX05531.1\|22719_22899_-	hypothetical protein	NA	NA	NA	NA
AWX05532.1\|23006_23807_-	subclass B1 metallo-beta-lactamase VIM-1	NA	NA	NA	NA
AWX05533.1\|23973_24987_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AWX05534.1\|24925_25213_+\|transposase	transposase	NA	NA	NA	NA
AWX05535.1\|25273_25585_+	addiction module antidote protein, HigA family	NA	NA	NA	NA
AWX05536.1\|25769_27122_+	replication protein	A0A1B1P892	Bacillus_phage	3.1e-10	25.4
AWX05553.1\|27768_28191_+	antirestriction protein	A0A1S5R3R9	Pseudomonas_phage	1.6e-05	33.0
AWX05537.1\|28300_29296_+	hypothetical protein	NA	NA	NA	NA
AWX05538.1\|29483_29864_+	hypothetical protein	NA	NA	NA	NA
AWX05539.1\|30064_30379_+	transcriptional regulator	NA	NA	NA	NA
AWX05540.1\|30382_31135_+	ParA family protein	H7BUL8	unidentified_phage	4.3e-14	29.9
36998:37016	attR	NA	NA	NA	NA

DBSCAN-SWA_2

37107 : 38637

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWX05548.1\|37107_38637_-	conjugal transfer protein TraC	A0A1B1IRD0	uncultured_Mediterranean_phage	6.9e-35	33.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage