CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP019611	Mycobacterium tuberculosis strain H83 chromosome, complete genome	8 crisprs	cas3,DEDDh,csa3,c2c9_V-U4,RT,DinG,WYL,cas4,cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6	17	57	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP019611_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_1

109428-110107

Orphan

Consensus_repeat	Method
CCGCCGNNNCCNCCGTNGCCGCC	CRT

9 spacers

The CRISPR arrays of CP019611_1

>merge|CP019611|1|109428-110107|CRT
CCGCCGTTGCCGCCGGCACCGCCGTTGCCGGCCTTAGCGAACGTGGCGAAGGCGTCACCACCCTTGCCGCCGATGCCGCCGTTGCCGCCGTTGCCGCCCTGTCCGCCATTCGCGCCATTGGCGGACGCGGAGAAGTCTTGGCCGTTGGCTCCGGCGCCCCCGTTGCCGCCCTTGCCGCCGTCCCCGCCCGTGCCGGCCGCCGATCCGCCGTTGCCGCCGATGCCGCCGTTGCCGCCGTTGCCGCCGTTGAGGGCAAGGCCGGTGCCGGCGACGCCATTTCCGCCGGCACCACCCGCACCGCCGTTACCGACCGACCCGCCATGGCCGCCGTTACCACCGGCGCCGCCGTTTTCTCCCGCGACGGTGGGGGTGGCGCCGGCACCTCCGTTGCCACCGTTGCCGCCGCTGGTGGGCGCGGTGCCGTTCGCCCCGGCCGAACCGTTCAGGGCCGGGTTCGCGCTAACACCGCCGGCCCCACCCTTGCCGCCAACGCCCACTTCACCGCCGTTGCCGCCGTCACCGCCGGCACCCTGGTTGACGGCCAAGGTCACATCACCGGCGGCACCGGCTCCGCCATCACCGGCCTTGCCGCCGTCACCGCCGGCGCCGCCGTCCCCGGCCTTGCCGGCGGTGCCGGCGACCGCGGTGCCGCCGGCGCCGCCACCACCGCCGTCACCGCC

>CP019611|1|1|109428-110107|CRT
CCGCCGTTGCCGCCGGCACCGCC	GTTGCCGGCCTTAGCGAACGTGGCGAAGGCGTCACCACCCTTGCCGCCGATG
CCGCCGTTGCCGCCGTTGCCGCC	CTGTCCGCCATTCGCGCCATTGGCGGACGCGGAGAAGTCTTGGCCGTTGGCTCCGGCG
CCCCCGTTGCCGCCCTTGCCGCC	GTCCCCGCCCGTGCCGGCCGCCGATCCGCCGTTGCCGCCGATG
CCGCCGTTGCCGCCGTTGCCGCC	GTTGAGGGCAAGGCCGGTGCCGGCGACGCCATTTCCGCCGGCACCACCCGCACCGCCGTTACCGACCGACCCGCCATGG
CCGCCGTTACCACCGGCGCCGCC	GTTTTCTCCCGCGACGGTGGGGGTGGCGCCGGCA
CCTCCGTTGCCACCGTTGCCGCC	GCTGGTGGGCGCGGTGCCGTTCGCCCCGGCCGAACCGTTCAGGGCCGGGTTCGCGCTAACA
CCGCCGGCCCCACCCTTGCCGCC	AACGCCCACTTCACCGCCGTTGCCGCCGTCA
CCGCCGGCACCCTGGTTGACGGC	CAAGGTCACATCACCGGCGGCACCGGCTCCGCCATCACCGGCCTTGCCGCCGTCA
CCGCCGGCGCCGCCGTCCCCGGC	CTTGCCGGCGGTGCCGGCGACCGCGGTGCCGCCGGCG
CCGCCACCACCGCCGTCACCGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY75281.1\|112531_122005_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
CP019611.1\|AWY75276.1\|95217_96447_-\|isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|236226
CP019611.1\|AWY78830.1\|99226_99958_+\|methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP019611.1\|AWY75279.1\|99966_105810_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
CP019611.1\|AWY75277.1\|96729_98079_+\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	unknown	unknown	gnl\|CDD\|236105
CP019611.1\|AWY75285.1\|136154_136949_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|369658
CP019611.1\|AWY75273.1\|91859_92300_+\|heavy-metal-responsive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133398
CP019611.1\|AWY75274.1\|92333_93203_-\|inner-membrane-protein-YhjD	unknown	unknown	gnl\|CDD\|188082
CP019611.1\|AWY75284.1\|124148_124385_-\|transposase	unknown	unknown	unknown
CP019611.1\|AWY78828.1\|91361_91841_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY75286.1\|137030_137402_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|223354
CP019611.1\|AWY75275.1\|93223_94234_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|234866
CP019611.1\|AWY75278.1\|98090_99230_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
CP019611.1\|AWY75282.1\|122585_123077_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
CP019611.1\|AWY78831.1\|122042_122534_-\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78832.1\|137544_137805_-\|oxidoreductase	unknown	unknown	unknown
CP019611.1\|AWY75280.1\|112018_112276_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378602
CP019611.1\|AWY75283.1\|123113_123854_-\|transposase	unknown	unknown	gnl\|CDD\|376574
CP019611.1\|AWY75287.1\|137299_137710_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366708
CP019611.1\|AWY78829.1\|94518_95151_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|184875

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY75281.1\|112531_122005_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	8.70836e-79
CP019611.1\|AWY75276.1\|95217_96447_-\|isocitrate-dehydrogenase	gnl\|CDD\|236226	PRK08299, PRK08299, NADP-dependent isocitrate dehydrogenase.	0
CP019611.1\|AWY78830.1\|99226_99958_+\|methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.03104e-26
CP019611.1\|AWY75279.1\|99966_105810_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.24138e-84
CP019611.1\|AWY75277.1\|96729_98079_+\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	gnl\|CDD\|236105	PRK07812, PRK07812, O-acetylhomoserine aminocarboxypropyltransferase; Validated.	0
CP019611.1\|AWY75285.1\|136154_136949_-\|oxidoreductase	gnl\|CDD\|369658	pfam08031, BBE, Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.	2.38492e-05
CP019611.1\|AWY75273.1\|91859_92300_+\|heavy-metal-responsive-transcriptional-regulator	gnl\|CDD\|133398	cd04770, HTH_HMRTR, Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper), CadR (cadmium), PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.31191e-56
CP019611.1\|AWY75274.1\|92333_93203_-\|inner-membrane-protein-YhjD	gnl\|CDD\|188082	TIGR00766, Uncharacterized_protein_Dda3937_02003, inner membrane protein YhjD. This family, including YhjD in E. coli, is a conserved inner membrane protein homologous YihY, which in turn was incorrectly assigned to be ribonuclease BN. This, any suggestion this family is similar to ribonucleases should be removed. [Transcription, Degradation of RNA].	3.67774e-123
CP019611.1\|AWY75286.1\|137030_137402_-\|oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	7.3689e-14
CP019611.1\|AWY75275.1\|93223_94234_-\|tryptophan--tRNA-ligase	gnl\|CDD\|234866	PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed.	0
CP019611.1\|AWY75278.1\|98090_99230_+\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
CP019611.1\|AWY75282.1\|122585_123077_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.38732e-12
CP019611.1\|AWY75280.1\|112018_112276_-\|hypothetical-protein	gnl\|CDD\|378602	pfam11222, DUF3017, Protein of unknown function (DUF3017). This bacterial family of proteins with unknown function appear to be restricted to Actinobacteria.	3.92596e-11
CP019611.1\|AWY75283.1\|123113_123854_-\|transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.82865e-20
CP019611.1\|AWY75287.1\|137299_137710_-\|hypothetical-protein	gnl\|CDD\|366708	pfam01565, FAD_binding_4, FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.	4.01471e-07
CP019611.1\|AWY78829.1\|94518_95151_+\|alpha/beta-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	1.23792e-15

>CP019611.1|AWY75279.1|99966_105810_-|PPE-family-protein
MSFVVMPPEINSLLIYTGAGPGPLLAAAAAWDELAAELGSAAAAFGSVTSGLVGGIWQGPSSVAMAAAAAPYAGWLSAAAASAESAAGQARAVVGVFEAALAATVDPFVIAANRSRLVSLALSNLFGQNTPAIAAAEFDYELMWAQDVAAMLGYHTGASAAAEALAPFGSPLASLAAAAEPAKSLAVNLGLANVGLFNAGSGNVGSYNVGAGNVGSYNVGGGNIGGNNVGLGNVGWGNFGLGNSGLTPGLMGLGNIGFGNAGSYNFGLANMGVGNIGFANTGSGNFGIGLTGDNLTGFGGFNTGSGNVGLFNSGTGNVGFFNSGTGNWGVFNSGSYNTGIGNSGIASTGLFNAGGFNTGVVNAGSYNTGSFNAGEANTGGFNPGSVNTGWLNTGDINTGVANSGDVNTGAFISGNYSNGVLWRGDYQGLLGFSSGANVLPVIPLSLDINGGVGAITIEPIHILPDIPININETLYLGPLVVPPINVPAISLGVGIPNISIGPIKINPITLWPAQNFNQTITLAWPVSSITIPQIQQVALSPSPIPTTLIGPIHINTGFSIPVTFSYSTPALTLFPVGLSIPTGGPLTLTLGVTAGTEAFTIPGFSIPEQPLPLAINVIGHINALSTPAITIDNIPLNLHAIGGVGPVDIVGGNVPASPGFGNSTTAPSSGFFNTGAGGVSGFGNVGAHTSGWFNQSTQAMQVLPGTVSGYFNSGTLMSGIGNVGTQLSGMLSGGALGGNNFGLGNIGFDNVGFGNAGSSNFGLANMGIGNIGLANTGNGNIGIGLSGDNLTGFGGFNSGSENVGLFNSGTGNVGFFNSGTGNLGVFNSGSHNTGFFLTGNNINVLAPFTPGTLFTISEIPIDLQVIGGIGPIHVQPIDIPAFDIQITGGFIGIREFTLPEITIPAIPIHVTGTVGLEGFHVNPAFVLFGQTAMAEITADPVVLPDPFITIDHYGPPLGPPGAKFPSGSFYLSISDLQINGPIIGSYGGPGTIPGPFGATFNLSTSSLALFPAGLTVPDQTPVTVNLTGGLDSITLFPGGLAFPENPVVSLTNFSVGTGGFTVFPQGFTVDRIPVDLHTTLSIGPFPFRWDYIPPTPANGPIPAVPGGFGLTSGLFPFHFTLNGGIGPISIPTTTVVDALNPLLTVTGNLEVGPFTVPDIPIPAINFGLDGNVNVSFNAPATTLLSGLGITGSIDISGIQITNIQTQPAQLFMSVGQTLFLFDFRDGIELNPIVIPGSSIPITMAGLSIPLPTVSESIPLNFSFGSPASTVKSMILHEILPIDVSINLEDAVFIPATVLPAIPLNVDVTIPVGPINIPIITEPGSGNSTTTTSDPFSGLAVPGLGVGLLGLFDGSIANNLISGFNSAVGIVGPNVGLSNLGGGNVGLGNVGDFNLGAGNVGGFNVGGGNIGGNNVGLGNVGWGNFGLGNSGLTPGLMGLGNIGFGNAGSYNFGLANMGVGNIGFANTGSGNFGIGLTGDNLTGFGGFNTGSGNVGLFNSGTGNVGFFNSGTGNWGVFNSGSYNTGIGNSGIASTGLFNAGGFNTGVVNAGSYNTGSFNAGQANTGGFNPGSVNTGWLNTGDTNTGVANSGDVNTGAFISGNYSNGAFWRGDYQGLLGFSYTSTIIPEFTVANIHASGGAGPIIVPSIQFPAIPLDLSATGHIGGFTIPPVSISPITVRIDPVFDLGPITVQDITIPALGLDPATGVTVGPIFSSGSIIDPFSLTLLGFINVNVPAIQTAPSEILPFTVLLSSLGVTHLTPEITIPGFHIPVDPIHVELPLSVTIGPFVSPEITIPQLPLGLALSGATPAFAFPLEITIDRIPVVLDVNALLGPINAGLVIPPVPGFGNTTAVPSSGFFNIGGGGGLSGFHNLGAGMSGVLNAISDPLLGSASGFANFGTQLSGILNRGADISGVYNTGALGLITSALVSGFGNVGQQLAGLIYTGTGP
>CP019611.1|AWY78830.1|99226_99958_+|methyltransferase
MTCSRRDMSLSFGSAVGAYERGRPSYPPEAIDWLLPAAARRVLDLGAGTGKLTTRLVERGLDVVAVDPIPEMLDVLRAALPQTVALLGTAEEIPLDDNSVDAVLVAQAWHWVDPARAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGEIIGRDGDPVRDRVTLPEPFTTVQRHQVEWTNYLTPQALIDLVASRSYCITSPAQVRTKTLDRVRQLLATHPALANSNGLALPYVTVCVRATLA
>CP019611.1|AWY75278.1|98090_99230_+|homoserine-O-acetyltransferase
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHALTGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGKPWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLLAVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIELDTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGGVSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAVGELIRQTLGLADREGACRR
>CP019611.1|AWY75277.1|96729_98079_+|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase
MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQRIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNTKAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFDWTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAARDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSPAEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
>CP019611.1|AWY75276.1|95217_96447_-|isocitrate-dehydrogenase
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGGVVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
>CP019611.1|AWY78829.1|94518_95151_+|alpha/beta-hydrolase
MLADHVERQLDELGWETSHIVGNSLGGWVAFELERRGRARSVTGIAPAGGWTRWSPVKFEVIAKFIAGAPILAVAHILGQRALRLPFSRLLATLPISATPDGVSERELSGIIDDAAHCPAYFQLLVKALVLPGLQELEHTAVPSHVVLCEQDRVVPPSRFSRHFTDSLPAGHRLTVLDGVGHVPMFEAPGRITELITSFIEECCPHVRAS
>CP019611.1|AWY75275.1|93223_94234_-|tryptophan--tRNA-ligase
MSTPTGSRRIFSGVQPTSDSLHLGNALGAVAQWVGLQDDHDAFFCVVDLHAITIPQDPEALRRRTLITAAQYLALGIDPGRATIFVQSQVPAHTQLAWVLGCFTGFGQASRMTQFKDKSARQGSEATTVGLFTYPVLQAADVLAYDTELVPVGEDQRQHLELARDVAQRFNSRFPGTLVVPDVLIPKMTAKIYDLQDPTSKMSKSAGTDAGLINLLDDPALSAKKIRSAVTDSERDIRYDPDVKPGVSNLLNIQSAVTGTDIDVLVDGYAGHGYGDLKKDTAEAVVEFVNPIQARVDELTADPAELEAVLAAGAQRAHDVASKTVQRVYDRLGFLL
>CP019611.1|AWY75274.1|92333_93203_-|inner-membrane-protein-YhjD
MGELAEPGVLDRLRARFGWLDHVVRAFTRFNDRNGSLFAAGLTYYTIFAIFPLLMVGFGVGGFALSRRPELLTTLEERIRTSVSGAVGQQLVDLMNSAIDARASVGVIGLATAAWVGLGWMWHLREALSQMWAHPVAPAGYLRTKLSDLAAMVGTFVVIVATIALTVLGHARPMAAVLRWLEIPQFSVFDEIFRGISVLVSVLVSWVLFTWMIGRLPREPVGLVTAARAGLMAAVGFELFKQVGAIYLQIVLRSPAGAVFGPVLGLMVFAFVTAWLILFATAWAATASA
>CP019611.1|AWY75273.1|91859_92300_+|heavy-metal-responsive-transcriptional-regulator
MKISEVAALTNTSTKTLRFYENSGLLPPPARTASGYRNYGPEIVDRLRFIHRGQAAGLALQEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIALEGHLQTLLDHASYGPPTEHDHSTVCWILESDLDEPTAIEVSDIHA
>CP019611.1|AWY78828.1|91361_91841_+|hypothetical-protein
MASDAGEHDGVSVLLKAVTWRALDRDPRHRCGCLVRFDRRHDVVSQRRCSLGGDQGMGALRSQIQRTTPEPLAEAHPQAFDPAPVVGMGACRRNQRMVIVASGARPARAHAVRCRWLFSSGNSFPQAAIQRYGLTEIRLVTIARTAGGSHVPSVNLLVH
>CP019611.1|AWY75280.1|112018_112276_-|hypothetical-protein
MTVRAVLRRTVGAQWPILAGVNFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
>CP019611.1|AWY75281.1|112531_122005_-|PPE-family-protein
MNFPVLPPEINSVLMYSGAGSSPLLAAAAAWDGLAEELGSAAVSFGQVTSGLTAGVWQGAAAAAMAAAAAPYAGWLGSVAAQAVAVAGQARAAVAAFEAALAATVDPAAVAVNRMAMRALAMSNLLGQNAAAIAAVEAEYELMWAADVAAMAGYHSGASAAAAALPAFSPPAQALGGGVGAFLNALFAGPAKMLRLNAGLGNVGNYNVGLGNVGIFNLGAANVGAQNLGAANAGSGNFGFGNIGNANFGFGNSGLGLPPGMGNIGLGNAGSSNYGLANLGVGNIGFANTGSNNIGIGLTGDNLTGIGGLNSGTGNLGLFNSGTGNIGFFNSGTGNFGVFNSGSYNTGVGNAGTASTGLFNVGGFNTGVANVGSYNTGSFNAGNTNTGGFNPGNVNTGWLNTGNTNTGIANSGNVNTGAFISGNFSNGVLWRGDYEGLWGLSGGSTIPAIPIGLELNGGVGPITVLPIQILPTIPLNIHQTFSLGPLVVPDIVIPAFGGGTAIPISVGPITISPITLFPAQNFNTTFPVGPFFGLGVVNISGIEIKDLAGNVTLQLGNLNIDTRINQSFPVTVNWSTPAVTIFPNGISIPNNPLALLASASIGTLGFTIPGFTIPAAPLPLTIDIDGQIDGFSTPPITIDRIPRNLGASVTVGPILINGVNIPATPGFGNTTTAPSSGFFNSGDGGVSGFGNFGAGSSGWWNQAQTEVAGAGSGFANFGSLGSGVLNFGSGVSGLYNTGGLPPGTPAVVSGIGNVGEQLSGLSSAGTALNQSLIINLGLADVGSVNVGFGNVGDFNLGAANIGDLNVGLGNVGGGNVGFGNIGDANFGLGNAGLAAGLAGVGNIGLGNAGSGNVGFGNMGVGNIGFGNTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNVGLFNSGTGNFGLFNSGSFNTGIGNGGTGSTGLFNAGNFNTGVANPGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGVANSGNVDTGALMSGNFSNGILWRGNFEGLFGLNVGITIPEFPIHWTSTGGIGPIIIPDTTILPPIHLGLTGQANYGFAVPDIPIPAIHIDFDGAADAGFTAPATTLLSALGITGQFRFGPITVSNVQLNPFNVNLKLQFLHDAFPNEFPDPTISVQIQVAIPLTSATLGGLALPLQQTIDAIELPAISFSQSIPIDIPPIDIPASTINGISMSEVVPIDVSVDIPAVTITGTRIDPIPLNFDVLSSAGPINISIIDIPALPGFGNSTELPSSGFFNTGGGGGSGIANFGAGVSGLLNQASSPMVGTLSGLGNAGSLASGVLNSGVDISGMFNVSTLGSAPAVISGFGNLGNHVSGVSIDGLLAMLTSGGSGGSGQPSIIDAAIAELRHLNPLNIVNLGNVGSYNLGFANVGDVNLGAGNLGNLNLGGGNLGGQNLGLGNLGDGNVGFGNLGHGNVGFGNSGLGALPGIGNIGLGNAGSNNVGFGNMGLGNIGFGNTGTNNLGIGLTGDNQTGFGGLNSGAGNLGLFNSGTGNIGFFNTGTGNWGLFNSGSYNTGIGNSGTGSTGLFNAGSFNTGLANAGSYNTGSLNAGNTNTGGFNPGNVNTGWFNAGHTNTGGFNTGNVNTGAFNSGSFNNGALWTGDHHGLVGFSYSIEITGSTLVDINETLNLGPVHIDQIDIPGMSLFDIHELVNIGPFRIEPIDVPAVVLDIHETMVIPPIVFLPSMTIGGQTYTIPLDTPPAPAPPPFRLPLLFVNALGDNWIVGASNSTGMSGGFVTAPTQGILIHTGPSSATTGSLALTLPTVTIPTITTSPIPLKIDVSGGLPAFTLFPGGLNIPQNAIPLTIDASGVLDPITIFPGGFTIDPLPLSLALNISVPDSSVPIIIVPPTPGFGNATATPSSGFFNSGAGGVSGFGNFGAGSSGWWNQAHAALAGAGSGVLNVGTLNSGVLNVGSGISGLYNTAIVGLGTPALVSGAGNVGQQLSGVLAAGTALTQSPIINLGLADVGNYNLGLGNVGDFNLGAANLGDLNLGLGNIGNANVGFGNIGHGNVGFGNSGLGAALGIGNIGLGNAGSTNVGLANMGVGNIGFANTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNIGFFNTGTGNWGLFNSGSYNTGIGNSGTGSTGLFNAGSFNTGLANAGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGIANSGNVDTGALMSGNFSNGILWRGNYEGLFSYSYSLDVPRITILDAHFTGAFGPVVVPPIPVPAINAHLTGNAAMGAFTIPQIDIPALNPNVTGSVGFGPIAVPSVTIPALTAARAVLDMAASVGATSEIEPFIVWTSSGAIGPTWYSVGRIYNAGDLFVGGNIISGIPTLSTTGPVHAVFNAASQAFNTPALNIHQIPLGFQVPGSIDAITLFPGGLTFPANSLLNLDVFVGTPGATIPAITFPEIPANADGELYVIAGDIPLINIPPTPGIGNTTTVPSSGFFNTGAGGGSGFGNFGANMSGWWNQAHTALAGAGSGIANVGTLHSGVLNLGSGLSGIYNTSTLPLGTPALVSGLGNVGDHLSGLLASNVGQNPITIVNIGLANVGNGNVGLGNIGNLNLGAANIGDVNLGFGNIGDVNLGFGNIGGGNVGFGNIGDANFGFGNSGLAAGLAGMGNIGLGNAGSGNVGWANMGLGNIGFGNTGTNNLGIGLTGDNQSGIGGLNSGTGNIGLFNSGTGNIGFFNSGTANFGLFNSGSYNTGIGNSGVASTGLVNAGGFNTGVANAGSYNTGSFNAGDTNTGGFNPGSTNTGWFNTGNANTGVVNAGNVNTGALITGNFSNGILWRGNYEGLAGFSFGYPIPLFPAVGADVTGDIGPATIIPPIHIPSIPLGFAAIGHIGPISIPNIAIPSIHLGIDPTFDVGPITVDPITLTIPGLSLDAAVSEIRMTSGSSSGFKVRPSFSFFAVGPDGMPGGEVSILQPFTVAPINLNPTTLHFPGFTIPTGPIHIGLPLSLTIPGFTIPGGTLIPQLPLGLGLSGGTPPFDLPTVVIDRIPVELHASTTIGPVSLPIFGFGGAPGFGNDTTAPSSGFFNTGGGGGSGFSNSGSGMSGVLNAISDPLLGSASGFANFGTQLSGILNRGAGISGVYNTGTLGLVTSAFVSGFMNVGQQLSGLLFAGTGP
>CP019611.1|AWY78831.1|122042_122534_-|hypothetical-protein
MLMKSSRIPGPTQPTVVRELVAVGEPSYTALPAGLPHHPRPQRGGSSRAAPVLVDDSMPHPGTRRCCALPQPGHQFPKPGQFRRQSWSRRSLSRAQTLSRKRRALQPLPRPPYLTTTPSKRHYKRYKPIWALMRRKCRHVCTRSGYCRLVCRSARAHHVVVRR
>CP019611.1|AWY75282.1|122585_123077_+|IS110-family-transposase
MTAENPGRSRRTLVGIDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR
>CP019611.1|AWY75283.1|123113_123854_-|transposase
MAIDPAAAYASAIRTPGLLPNAKLVVDHFHVTTLANDALTAVRRRVTWAFHDRRGRKIDPQWANRRRLLTARERLSDKSFAKMRNRINAVDPRAQILSAWIAKEELRTLLSTVRTGGDPHLARHHLHRFLPGASTRRSPNCSPWPPPLTSHPRSTPSWSPASPTRASVVGEVAEMLGDIDGQCVQVEVPVPERGPAGCGGLDGLGRAGVSATPRVCAAMTAVNVAGRCAGQQADVGPTPQHRCRGR
>CP019611.1|AWY75284.1|124148_124385_-|transposase
MKEYAVTSPKDLPYGEDRIMVRWNKIRWRCREDYCKLGPFTEAITQVPARVRSTLRLRRQMAKAIGDAARSVGRGRPG
>CP019611.1|AWY75285.1|136154_136949_-|oxidoreductase
MLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR
>CP019611.1|AWY75286.1|137030_137402_-|oxidoreductase
MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG
>CP019611.1|AWY75287.1|137299_137710_-|hypothetical-protein
MGQSGLIDRRAGAAAGQRQGVHERKADLQFELQRLESGRGGDGRLAGRRPEGGFVAAASKLKIAVRGGGHSYIGASSANGAMVLDLLGLPGGVHFDSATRNVRCRPRPISMRSIKRWPVRAGRFRPAAARPWVWRV
>CP019611.1|AWY78832.1|137544_137805_-|oxidoreductase
MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_3

482401-482489

Orphan

Consensus_repeat	Method
GCTCGGCGACGATGCGGGCCGGATGACGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP019611_3

>merge|CP019611|3|482401-482489|CRISPRCasFinder
GCTCGGCGACGATGCGGGCCGGATGACGGCCCGAGGAGGAGCCGAGCAATCGAACCGAGCTCGGCGACGATGCGGGCCGGATGACGGCC

>CP019611|3|1|482401-482489|CRISPRCasFinder
GCTCGGCGACGATGCGGGCCGGATGACGGCC	CGAGGAGGAGCCGAGCAATCGAACCGA
GCTCGGCGACGATGCGGGCCGGATGACGGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY75581.1\|485243_486065_-\|coenzyme-A-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP019611.1\|AWY75585.1\|488200_488875_+\|cAMP-receptor-protein	unknown	unknown	gnl\|CDD\|223736
CP019611.1\|AWY75582.1\|486196_486880_-\|thioredoxin	unknown	unknown	gnl\|CDD\|239264
CP019611.1\|AWY75580.1\|483068_484052_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP019611.1\|AWY75586.1\|488978_489773_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
CP019611.1\|AWY75575.1\|478892_479249_+\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	unknown
CP019611.1\|AWY78872.1\|484044_485238_-\|acid-resistance-periplasmic-serine-protease-MarP	unknown	unknown	gnl\|CDD\|379142
CP019611.1\|AWY75573.1\|476253_477180_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP019611.1\|AWY75577.1\|479514_481470_+\|acetyl-coenzyme-A-synthetase	unknown	unknown	gnl\|CDD\|234677
CP019611.1\|AWY75578.1\|481505_482204_-\|protease	unknown	unknown	unknown
CP019611.1\|AWY75587.1\|489779_490235_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|100006
CP019611.1\|AWY75576.1\|479182_479392_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY75584.1\|487724_488102_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY75579.1\|482549_483068_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377816
CP019611.1\|AWY75571.1\|472987_473758_-\|oxidoreductase	unknown	unknown	unknown
CP019611.1\|AWY75572.1\|475397_476261_-\|peptide-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
CP019611.1\|AWY75583.1\|486879_487617_-\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
CP019611.1\|AWY75574.1\|477181_478807_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173853
CP019611.1\|AWY75570.1\|471369_472233_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273654
CP019611.1\|AWY78871.1\|473754_475401_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY75581.1\|485243_486065_-\|coenzyme-A-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	1.20605e-47
CP019611.1\|AWY75585.1\|488200_488875_+\|cAMP-receptor-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	2.11707e-55
CP019611.1\|AWY75582.1\|486196_486880_-\|thioredoxin	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.72736e-22
CP019611.1\|AWY75586.1\|488978_489773_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.29322e-75
CP019611.1\|AWY78872.1\|484044_485238_-\|acid-resistance-periplasmic-serine-protease-MarP	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	1.86888e-19
CP019611.1\|AWY75573.1\|476253_477180_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.57934e-99
CP019611.1\|AWY75577.1\|479514_481470_+\|acetyl-coenzyme-A-synthetase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
CP019611.1\|AWY75580.1\|483068_484052_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.34553e-25
CP019611.1\|AWY75587.1\|489779_490235_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	7.62827e-68
CP019611.1\|AWY75579.1\|482549_483068_+\|hypothetical-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	8.41555e-32
CP019611.1\|AWY75572.1\|475397_476261_-\|peptide-ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.77559e-81
CP019611.1\|AWY75583.1\|486879_487617_-\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	2.16645e-106
CP019611.1\|AWY75574.1\|477181_478807_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.73988e-122
CP019611.1\|AWY75570.1\|471369_472233_+\|hypothetical-protein	gnl\|CDD\|273654	TIGR01490, Uncharacterized_protein_Rv3661/MT3761, HAD-superfamily subfamily IB hydrolase, TIGR01490. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled here are all bacterial. The IB subfamily includes the enzyme phosphoserine phosphatase (TIGR00338). Due to this relationship, several of these sequences have been annotated as "phosphoserine phosphatase related proteins," or "Phosphoserine phosphatase-family enzymes." There is presently no evidence that any of the enzymes in this model possess PSPase activity. OMNI\|NTL01ML1250 is annotated as a "possible transferase," however this is due to the C-terminal domain found on this sequence which is homologous to a group of glycerol-phosphate acyltransferases (between trusted and noise to TIGR00530). A subset of these sequences including OMNI\|CC1962, the Caulobacter crescentus CicA protein cluster together and may represent a separate equivalog. [Unknown function, Enzymes of unknown specificity].	5.37865e-86
CP019611.1\|AWY78871.1\|473754_475401_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0

>CP019611.1|AWY75578.1|481505_482204_-|protease
MQTAHRRFAAAFAAVLLAVVCLPANTAAADDKLPLGGGAGIVVNGDTMCTLTTIGHDKNGDLIGFTSAHCGGPGAQIAAEGAENAGPVGIMVAGNDGLDYAVIKFDPAKVTPVAVFNGFAINGIGPDPSFGQIACKQGRTTGNSCGVTWGPGESPGTLVMQVCGGPGDSGAPVTVDNLLVGMIHGAFSDNLPSCITKYIPLHTPAVVMSINADLADINAKNRPGAGFVPVPA
>CP019611.1|AWY75577.1|479514_481470_+|acetyl-coenzyme-A-synthetase
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWSGAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
>CP019611.1|AWY75576.1|479182_479392_+|hypothetical-protein
MLPLGLPPSWPSGAPTRSAAPIKLTGANERRHIAHVAHASRSPLPATVTVSTTRHNASRTLQGRPTCDV
>CP019611.1|AWY75575.1|478892_479249_+|peptide-ABC-transporter-substrate-binding-protein
MTVSYHATQSAGEPVGRCFGNAHTVVRDPVLATHRDCASQGKTSPDRALLACGILEEDRWCRRCGEEGSPRDTVTRRLTHWCGLHPGVSVDHSCLSRCCRLDCRRRGPAVPQRDPPRR
>CP019611.1|AWY75574.1|477181_478807_-|peptide-ABC-transporter-substrate-binding-protein
MVRQMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTGTNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGWKFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKSRTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFGRNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFYANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDTPLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPGFDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVDAVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWRGDYPSMIEFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRILFHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
>CP019611.1|AWY75573.1|476253_477180_-|ABC-transporter-permease
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG
>CP019611.1|AWY75572.1|475397_476261_-|peptide-ABC-transporter-permease
MAEHTGFWLDAWRGLRRRPKFVIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA
>CP019611.1|AWY78871.1|473754_475401_-|ABC-transporter-ATP-binding-protein
MSVPAAPLLSVEGLEVTFGTDAPAVCGVDLAVRSGQTVAVVGESGSGKSTTAAAILGLLPAGGRITAGRVVFDGRDITGADAKRLRSIRGREIGYVPQDPMTNLNPVWKVGFQVTEALRANTDGRAARRRAVELLAEAGLPDPAKQAGRYPHQLSGGMCQRALIAIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQGLTDELGTALLLITHDLALAAQRAEAVVVVRRGVVVESGAAQSILQSPQHEYTRRLVAAAPSLTARSRRPPESRSRATTQAGDILVVSELTKIYRESRGAPWRRVESRAVDGVSFRLPRASTLAIVGESGSGKSTLARMVLGLLQPTSGTVVFDGTYDVGALARDQVLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRVHHVGDRRQRQRAVRELVDQVALPSSILGRRPRELSGGQRQRVAIARALALRPEVLVCDEAVSALDVLVQAQILDLLADLQADLGLTYLFISHDLAVIRQIADDVLVMRAGRVVEHASTEEVFSRPRHEYTRQLLQAIPGAPSAPRKVGNL
>CP019611.1|AWY75571.1|472987_473758_-|oxidoreductase
MTVDPLAPLMELPGVAAASDRVRDALSRVHRHRANLRGWPVAAAEASLRAARASSVLDGGPARLHDAGAPTSGKPALSDPVFAGALRVGQALEGGAGPVVGVWRRAPLQALARLHMLAAADQVDDDRLGRPRSDADVGPRLELLADVVTHPTLASAPVVAAVAHGELLTLRPFGCADGVVARAVSRLVTIATGLDPHGLGVPEVIWMRQPAEYHDAARRFAGGTPDGVAGWLLLCCGAMLDGAREALSIAESLSPG
>CP019611.1|AWY75570.1|471369_472233_+|hypothetical-protein
MTVSDSPAQRQTPPQTPGGTAPRARTAAFFDLDKTIIAKSSTLAFSKPFFAQGLLNRRAVLKSSYAQFIFLLSGADHDQMDRMRTHLTNMCAGWDVAQVRSIVNETLHDIVTPLVFAEAADLIAAHKLCGRDVVVVSASGEEIVGPIARALGATHAMATRMIVEDGKYTGEVAFYCYGEGKAQAIRELAASEGYPLEHCYAYSDSITDLPMLEAVGHASVVNPDRGLRKEASVRGWPVLSFSRPVSLRDRIPAPSAAAIATTAAVGISALAAGAVTYALLRRFAFQP
>CP019611.1|AWY75579.1|482549_483068_+|hypothetical-protein
MSKIDRKNGVPSTLTTIPLADPHAGPAEPSIGDLIKDATTQMSTLVRAEVELARAEITRDVKKGLTGSVFFISSLVVGFYSTFFFFFFVAELLDTWIWRWVAFLLVFAIMVVVTAVLALLGFLKVRRIRGPRQTIASVKETRTALTPGHDKTPVTPKPVTSDRATPVDPSGW
>CP019611.1|AWY75580.1|483068_484052_+|alpha/beta-hydrolase
MAAPDPSMTRIAGPWRHLDVHANGIRFHVVEAVPSGQPEGPDAATPPMQPALARPLVILLHGFGSFWWSWRHQLCGLTGARVVAVDLRGYGGSDKPPRGYDGWTLAGDTAGLIRALGHPSATLVGHADGGLACWTTALLHSRLVRAIALISSPHPAALRRSTLTRRDQRHALLPTLLRYQLPIWPERLLTRNNAAEIERLVRARGCAKWLASEDFSQAIDHLRQAIQIPAAAHCALEYQRWAVRSQLRSEGRRFIRAMTQQLGMPLLHLRGDADPYVLADPVERTQRYAPHGRYISIAGAGHFSHEEAPEEVNRHLMRFLEQVHQLS
>CP019611.1|AWY78872.1|484044_485238_-|acid-resistance-periplasmic-serine-protease-MarP
MTPSQWLDIAVLAVAFIAAISGWRAGALGSMLSFGGVLLGATAGVLLAPHIVSQISAPRAKLFAALFLILALVVVGEVAGVVLGRAVRGAIRNRPIRLIDSVIGVGVQLVVVLTAAWLLAMPLTQSKEQPELAAAVKGSRVLARVNEAAPTWLKTVPKRLSALLNTSGLPAVLEPFSRTPVIPVASPDPALVNNPVVAATEPSVVKIRSLAPRCQKVLEGTGFVISPDRVMTNAHVVAGSNNVTVYAGDKPFEATVVSYDPSVDVAILAVPHLPPPPLVFAAEPAKTGADVVVLGYPGGGNFTATPARIREAIRLSGPDIYGDPEPVTRDVYTIRADVEQGDSGGPLIDLNGQVLGVVFGAAIDDAETGFVLTAGEVAGQLAKIGATQPVGTGACVS
>CP019611.1|AWY75581.1|485243_486065_-|coenzyme-A-pyrophosphatase
MSAGGTPLQAGATPTGSRGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRLPADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPEAGPGDGGVPDDADLLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRLHPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAFINPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQPWDTGDIRELDAAMVLIDDESDPR
>CP019611.1|AWY75582.1|486196_486880_-|thioredoxin
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG
>CP019611.1|AWY75583.1|486879_487617_-|endonuclease-III
MPGRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILSAQSTDKRVNLTTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASLIGLGQALVERFGGEVPATMDKLVTLPGVGRKTANVILGNAFGIPGITVDTHFGRLVRRWRWTTAEDPVKVEQAVGELIERKEWTLLSHRVIFHGRRVCHARRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLLALAGL
>CP019611.1|AWY75584.1|487724_488102_+|hypothetical-protein
MFTLLVSWLLVACVPGLLMLATLGLGRLERFLARDTVTATDVAEFLEQAEAVDVHTLARNGMPEALDYLHRRQARRITDSPPLGSGAGPRYAGPLFVTDLDSPVEPPRHGQPNPQFRTARHANHV
>CP019611.1|AWY75585.1|488200_488875_+|cAMP-receptor-protein
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
>CP019611.1|AWY75586.1|488978_489773_-|MBL-fold-metallo-hydrolase
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR
>CP019611.1|AWY75587.1|489779_490235_-|LysR-family-transcriptional-regulator
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPEEGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVFGDSGAHARSAVGVSELPLDAPVEVELIVEVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_5

1119860-1119971

Orphan

Consensus_repeat	Method
CCGCCGTTGCCGCCGTTGCCGATCA	PILER-CR

2 spacers

The CRISPR arrays of CP019611_5

>merge|CP019611|5|1119860-1119971|PILER-CR
CGCCGTTGCCGCCGTTGCCGATCTGCACGCCGTTACCGCCCGCTCCGCCGTTGCCGCCGGTGCCGGTCACGCTGGCGCCGCCGTCACCGCCGTTGCCGCCGTTGCCGATCAA

>CP019611|5|1|1119860-1119971|PILER-CR
CGCCGTTGCCGCCGTTGCCGATCTGC	ACGCCGTTACCGCCCGCTCCG
CCGTTGCCGCCGGTGCCGGTCACGCT	GGCGCCGCCGTCACCGC
CGTTGCCGCCGTTGCCGATCAA

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY76068.1\|1124392_1126804_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376422
CP019611.1\|AWY76076.1\|1137665_1139207_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP019611.1\|AWY78939.1\|1115964_1116690_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019611.1\|AWY76059.1\|1109598_1111281_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236097
CP019611.1\|AWY76072.1\|1129860_1131756_+\|type-VII-secretion-AAA-ATPase-EccA	unknown	unknown	gnl\|CDD\|188437
CP019611.1\|AWY76070.1\|1127094_1128705_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP019611.1\|AWY76065.1\|1117739_1118168_-\|ribonuclease-VapC25	unknown	unknown	gnl\|CDD\|350245
CP019611.1\|AWY76062.1\|1114736_1115357_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019611.1\|AWY76058.1\|1108369_1109563_-\|DNA-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225823
CP019611.1\|AWY76069.1\|1126837_1127098_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY76060.1\|1111297_1113493_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP019611.1\|AWY76073.1\|1131752_1133369_+\|ESX-3-secretion-system-protein-eccB3	unknown	unknown	gnl\|CDD\|368288
CP019611.1\|AWY76074.1\|1133365_1137358_+\|type-VII-secretion-protein-EccC	unknown	unknown	gnl\|CDD\|274858
CP019611.1\|AWY76064.1\|1116779_1117700_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226188
CP019611.1\|AWY76063.1\|1115453_1116035_+\|glyoxalase	unknown	unknown	gnl\|CDD\|366361
CP019611.1\|AWY76061.1\|1113606_1114740_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378820
CP019611.1\|AWY76075.1\|1137354_1137663_+\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP019611.1\|AWY76071.1\|1128728_1129637_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
CP019611.1\|AWY76066.1\|1118191_1118365_-\|antitoxin	unknown	unknown	unknown
CP019611.1\|AWY76067.1\|1121539_1124143_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY76076.1\|1137665_1139207_+\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.09345e-59
CP019611.1\|AWY78939.1\|1115964_1116690_-\|transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.66172e-07
CP019611.1\|AWY76059.1\|1109598_1111281_+\|acyl-CoA-synthetase	gnl\|CDD\|236097	PRK07788, PRK07788, acyl-CoA synthetase; Validated.	0
CP019611.1\|AWY76072.1\|1129860_1131756_+\|type-VII-secretion-AAA-ATPase-EccA	gnl\|CDD\|188437	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA. This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking].	0
CP019611.1\|AWY76065.1\|1117739_1118168_-\|ribonuclease-VapC25	gnl\|CDD\|350245	cd18678, PIN_MtVapC25_VapC33-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC25, VapC33, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC25, VapC29, VapC33, VapC37, and VapC39 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.23805e-60
CP019611.1\|AWY76062.1\|1114736_1115357_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.87158e-12
CP019611.1\|AWY76058.1\|1108369_1109563_-\|DNA-polymerase-domain-containing-protein	gnl\|CDD\|225823	COG3285, COG3285, Predicted eukaryotic-type DNA primase [DNA replication, recombination, and repair].	2.78761e-127
CP019611.1\|AWY76070.1\|1127094_1128705_+\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.45056e-73
CP019611.1\|AWY76060.1\|1111297_1113493_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.76306e-158
CP019611.1\|AWY76073.1\|1131752_1133369_+\|ESX-3-secretion-system-protein-eccB3	gnl\|CDD\|368288	pfam05108, T7SS_ESX1_EccB, Type VII secretion system ESX-1, transport TM domain B. EccB is a family of largely Gram-positive bacterial transmembrane componenets of the type VII secretion system characterized in Mycobacterium tuberculosis, systems ESX1-5. Translocation of virulent peptides through the membranes is thought to be mediated via a complex that includes EccB, EccC, EccD, EccE, and MycP. EccB, EccC, EccD, and EccE form a stable complex in the mycobacterial cell envelope.	0
CP019611.1\|AWY76074.1\|1133365_1137358_+\|type-VII-secretion-protein-EccC	gnl\|CDD\|274858	TIGR03924, T7SS_EccC_a, type VII secretion protein EccCa. This model represents the N-terminal domain or EccCa subunit of the type VII secretion protein EccC as found in the Actinobacteria. Type VII secretion is defined more broadly as including secretion systems for ESAT-6-like proteins in the Firmicutes as well as in the Actinobacteria, but this family does not show close homologs in the Firmicutes. [Protein fate, Protein and peptide secretion and trafficking].	0
CP019611.1\|AWY76064.1\|1116779_1117700_+\|hypothetical-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	2.89836e-118
CP019611.1\|AWY76063.1\|1115453_1116035_+\|glyoxalase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	5.1808e-20
CP019611.1\|AWY76068.1\|1124392_1126804_-\|hypothetical-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.65415e-33
CP019611.1\|AWY76075.1\|1137354_1137663_+\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.41358e-11
CP019611.1\|AWY76071.1\|1128728_1129637_+\|SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.10201e-94
CP019611.1\|AWY76061.1\|1113606_1114740_-\|alpha/beta-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	0.00172554
CP019611.1\|AWY76067.1\|1121539_1124143_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	5.7502e-34

>CP019611.1|AWY76066.1|1118191_1118365_-|antitoxin
MIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSEVLDEGLELNSRK
>CP019611.1|AWY76065.1|1117739_1118168_-|ribonuclease-VapC25
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI
>CP019611.1|AWY76064.1|1116779_1117700_+|hypothetical-protein
MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMGVALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQKAAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEADHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRGIALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPRFVREFPFNLMLWDLDRRMRRGRPLV
>CP019611.1|AWY78939.1|1115964_1116690_-|transcriptional-regulator
MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIRTICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANIVRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVAHFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDPQPPEVAGQPPSSARPARRS
>CP019611.1|AWY76063.1|1115453_1116035_+|glyoxalase
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR
>CP019611.1|AWY76062.1|1114736_1115357_-|TetR-family-transcriptional-regulator
MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN
>CP019611.1|AWY76061.1|1113606_1114740_-|alpha/beta-hydrolase
MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPKVALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLREVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAHPGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTITDWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAHGIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLASSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR
>CP019611.1|AWY76060.1|1111297_1113493_-|acyl-CoA-dehydrogenase
MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQAAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQAKVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDEWVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDAGESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGWVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLLPPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
>CP019611.1|AWY76059.1|1109598_1111281_+|acyl-CoA-synthetase
MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLEPPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLLAKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVIIYDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRASIIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALAMFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIVFVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTVKILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVSGRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLDEDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL
>CP019611.1|AWY76058.1|1108369_1109563_-|DNA-polymerase-domain-containing-protein
MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYYLAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEAVIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVREVLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWKEEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRLADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWRDRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR
>CP019611.1|AWY76067.1|1121539_1124143_-|PE-family-protein
MSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTALIAAGADEVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLDPINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAGGAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGGNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGGQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGNGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLNVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGGAGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGNAGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLFGAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSLGASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGMLSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP
>CP019611.1|AWY76068.1|1124392_1126804_-|hypothetical-protein
MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLAPINEFFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGNGGAGGLIGNGGAGGAGGAGGNGGAGGLIGNGGAGGAGGRASTGTGGAGGAGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLFGAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSSPDGGGGAGGIGGDGGTLFGSGGAGGVGGLGFDAGGAGGAGGKAGLLSGAGGAGGAGGGSFAGAGGTGGAGGAPGLVGNAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLLGRDGFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSGGTGGSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFANGGAGGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSGGTFGGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGTGGSSGIGSSGGTGGDGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLIIGENGLNGL
>CP019611.1|AWY76069.1|1126837_1127098_+|hypothetical-protein
MPTRGTSPAKIGGLQNNSGPGKGFGISQNISHIYAVGASADGSWQHPWAGAERSLVSGWDLHCGAPWCGIVVMKIMFISPLWCLRL
>CP019611.1|AWY76070.1|1127094_1128705_+|PPE-family-protein
MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADELIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAAMPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAVASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGTMNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHIVQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLPAVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGFGSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDPDWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVPGSWDPDRDAPGSAEPGDRG
>CP019611.1|AWY76071.1|1128728_1129637_+|SAM-dependent-methyltransferase
MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFCRAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILAAGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQALRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYAAKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVPGPESEAGPMFARNTLVSAARV
>CP019611.1|AWY76072.1|1129860_1131756_+|type-VII-secretion-AAA-ATPase-EccA
MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCCRALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTATTAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHVVSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTALARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQLAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTSHELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA
>CP019611.1|AWY76073.1|1131752_1133369_+|ESX-3-secretion-system-protein-eccB3
MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR
>CP019611.1|AWY76074.1|1133365_1137358_+|type-VII-secretion-protein-EccC
MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPYLIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRHTVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARNLSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSRWDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKLIATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFGDARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS
>CP019611.1|AWY76075.1|1137354_1137663_+|PE-family-protein
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
>CP019611.1|AWY76076.1|1137665_1139207_+|PPE-family-protein
MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_4

1118676-1119474

Orphan

Consensus_repeat	Method
CCGCCGGNGCCGCCGGNN	CRT

15 spacers

The CRISPR arrays of CP019611_4

>merge|CP019611|4|1118676-1119474|CRT
CCGCCGGTACCGGCGCCAAACCCGCCGGCAACCCCCGTCACCGCCGTTGCCGAACACCCCGGCGTGGCCACCGTCACCGCCGGTGCCGCCGGTACCGGCGCCTAGAGCGTTGGCACCGCTGCCGCCGGCGCCGCCGGCGCCGGCGGAGCCGAAGAGCAAGCCGCCGTTCCCGCCGGCGCCGCCGGCGCCGCCTTGCTGGATGCTGGTAAGTGCTGCCCCGCCGTGCCCGCCGGCGCCGCCGGCGCCGCCGAAGCCGAAGAGTAAGGCGCCGTTCCCGCCGGTTCCGCCGGCCCCGCCGGCAAGGGAGCTGGCGCCACCGCTGCCGCCGGCGCCACCGGAGGCGCCGAGGGAGAGTAGGCCGGCGTTGCCGCCGTGCCCGCCGCCGCCGGTGGTGATCCCGGACCCTCCCGAGCCGGCGGCGCCGCCGGTGCCGCCGGCTCCGAACAGTCCGCCGTTCCCGCCGTTCCCACCGGCCCCGAAGTTCGTGCCGGCCCCGCCGGTGCCGCCAGTTCCGAACAGTCCGCCGTTCCCGCCGTTCCCGCCGGCTGCGTTGAACCCGCCGGCCCCTCCGGCTCCGCCGTTGGCGAACAGTCCGCCGTTGCCGCCGGCGCCGCCGACGCCGGCCGGGACACCGCCAGCGGCGCCGTGGCCGCCGGTGCCGGCCGCGCCGAAGAGCAAACCGGCGTCGCCGCCGCGCCCGCCGGCCCCGCCGATGCCAGCGACGCCTATGGAGTTCCCACCGTTGCCGCCGGTGCCGCCGGAGCCGATCAGCAAGGAGACCCCACCGGCGCCGCCGGCC

>CP019611|4|3|1118676-1119474|CRT
CCGCCGGTACCGGCGCCA	AACCCGCCGGCAACCCCCGTCACCGCCGTTGCCGAACACCCCGGCGTGGCCACCGTCA
CCGCCGGTGCCGCCGGTA	CCGGCGCCTAGAGCGTTGGCACCGCTG
CCGCCGGCGCCGCCGGCG	CCGGCGGAGCCGAAGAGCAAGCCGCCGTTC
CCGCCGGCGCCGCCGGCG	CCGCCTTGCTGGATGCTGGTAAGTGCTGCCCCGCCGTGC
CCGCCGGCGCCGCCGGCG	CCGCCGAAGCCGAAGAGTAAGGCGCCGTTCCCGCCGGTT
CCGCCGGCCCCGCCGGCA	AGGGAGCTGGCGCCACCGCTG
CCGCCGGCGCCACCGGAG	GCGCCGAGGGAGAGTAGGCCGGCGTTGCCGCCGTGC
CCGCCGCCGCCGGTGGTG	ATCCCGGACCCTCCCGAG
CCGGCGGCGCCGCCGGTG	CCGCCGGCTCCGAACAGTCCGCCGTTCCCGCCGTTCCCACCGGCCCCGAAGTTC
GTGCCGGCCCCGCCGGTG	CCGCCAGTTCCGAACAGTCCGCCGTTCCCGCCGTTCCCGCCGGCTGCGTTGAAC
CCGCCGGCCCCTCCGGCT	CCGCCGTTGGCGAACAGTCCGCCGTTG
CCGCCGGCGCCGCCGACG	CCGGCCGGGACACCGCCAGCGGCGCCGTGG
CCGCCGGTGCCGGCCGCG	CCGAAGAGCAAACCGGCGTCGCCGCCGCGCCCGCCGGCC
CCGCCGATGCCAGCGACG	CCTATGGAGTTCCCACCGTTG
CCGCCGGTGCCGCCGGAG	CCGATCAGCAAGGAGACC
CCACCGGCGCCGCCGGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY76068.1\|1124392_1126804_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376422
CP019611.1\|AWY76076.1\|1137665_1139207_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP019611.1\|AWY78939.1\|1115964_1116690_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019611.1\|AWY76059.1\|1109598_1111281_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236097
CP019611.1\|AWY76072.1\|1129860_1131756_+\|type-VII-secretion-AAA-ATPase-EccA	unknown	unknown	gnl\|CDD\|188437
CP019611.1\|AWY76070.1\|1127094_1128705_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938
CP019611.1\|AWY76065.1\|1117739_1118168_-\|ribonuclease-VapC25	unknown	unknown	gnl\|CDD\|350245
CP019611.1\|AWY76062.1\|1114736_1115357_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019611.1\|AWY76058.1\|1108369_1109563_-\|DNA-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225823
CP019611.1\|AWY76069.1\|1126837_1127098_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY76060.1\|1111297_1113493_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP019611.1\|AWY76073.1\|1131752_1133369_+\|ESX-3-secretion-system-protein-eccB3	unknown	unknown	gnl\|CDD\|368288
CP019611.1\|AWY76074.1\|1133365_1137358_+\|type-VII-secretion-protein-EccC	unknown	unknown	gnl\|CDD\|274858
CP019611.1\|AWY76064.1\|1116779_1117700_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226188
CP019611.1\|AWY76063.1\|1115453_1116035_+\|glyoxalase	unknown	unknown	gnl\|CDD\|366361
CP019611.1\|AWY76061.1\|1113606_1114740_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378820
CP019611.1\|AWY76075.1\|1137354_1137663_+\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP019611.1\|AWY76071.1\|1128728_1129637_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
CP019611.1\|AWY76066.1\|1118191_1118365_-\|antitoxin	unknown	unknown	unknown
CP019611.1\|AWY76067.1\|1121539_1124143_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY76076.1\|1137665_1139207_+\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.09345e-59
CP019611.1\|AWY78939.1\|1115964_1116690_-\|transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.66172e-07
CP019611.1\|AWY76059.1\|1109598_1111281_+\|acyl-CoA-synthetase	gnl\|CDD\|236097	PRK07788, PRK07788, acyl-CoA synthetase; Validated.	0
CP019611.1\|AWY76072.1\|1129860_1131756_+\|type-VII-secretion-AAA-ATPase-EccA	gnl\|CDD\|188437	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA. This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking].	0
CP019611.1\|AWY76065.1\|1117739_1118168_-\|ribonuclease-VapC25	gnl\|CDD\|350245	cd18678, PIN_MtVapC25_VapC33-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC25, VapC33, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC25, VapC29, VapC33, VapC37, and VapC39 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.23805e-60
CP019611.1\|AWY76062.1\|1114736_1115357_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.87158e-12
CP019611.1\|AWY76058.1\|1108369_1109563_-\|DNA-polymerase-domain-containing-protein	gnl\|CDD\|225823	COG3285, COG3285, Predicted eukaryotic-type DNA primase [DNA replication, recombination, and repair].	2.78761e-127
CP019611.1\|AWY76070.1\|1127094_1128705_+\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.45056e-73
CP019611.1\|AWY76060.1\|1111297_1113493_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.76306e-158
CP019611.1\|AWY76073.1\|1131752_1133369_+\|ESX-3-secretion-system-protein-eccB3	gnl\|CDD\|368288	pfam05108, T7SS_ESX1_EccB, Type VII secretion system ESX-1, transport TM domain B. EccB is a family of largely Gram-positive bacterial transmembrane componenets of the type VII secretion system characterized in Mycobacterium tuberculosis, systems ESX1-5. Translocation of virulent peptides through the membranes is thought to be mediated via a complex that includes EccB, EccC, EccD, EccE, and MycP. EccB, EccC, EccD, and EccE form a stable complex in the mycobacterial cell envelope.	0
CP019611.1\|AWY76074.1\|1133365_1137358_+\|type-VII-secretion-protein-EccC	gnl\|CDD\|274858	TIGR03924, T7SS_EccC_a, type VII secretion protein EccCa. This model represents the N-terminal domain or EccCa subunit of the type VII secretion protein EccC as found in the Actinobacteria. Type VII secretion is defined more broadly as including secretion systems for ESAT-6-like proteins in the Firmicutes as well as in the Actinobacteria, but this family does not show close homologs in the Firmicutes. [Protein fate, Protein and peptide secretion and trafficking].	0
CP019611.1\|AWY76064.1\|1116779_1117700_+\|hypothetical-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	2.89836e-118
CP019611.1\|AWY76063.1\|1115453_1116035_+\|glyoxalase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	5.1808e-20
CP019611.1\|AWY76068.1\|1124392_1126804_-\|hypothetical-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.65415e-33
CP019611.1\|AWY76075.1\|1137354_1137663_+\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.41358e-11
CP019611.1\|AWY76071.1\|1128728_1129637_+\|SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.10201e-94
CP019611.1\|AWY76061.1\|1113606_1114740_-\|alpha/beta-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	0.00172554
CP019611.1\|AWY76067.1\|1121539_1124143_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	5.7502e-34

>CP019611.1|AWY76066.1|1118191_1118365_-|antitoxin
MIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSEVLDEGLELNSRK
>CP019611.1|AWY76065.1|1117739_1118168_-|ribonuclease-VapC25
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI
>CP019611.1|AWY76064.1|1116779_1117700_+|hypothetical-protein
MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMGVALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQKAAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEADHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRGIALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPRFVREFPFNLMLWDLDRRMRRGRPLV
>CP019611.1|AWY78939.1|1115964_1116690_-|transcriptional-regulator
MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIRTICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANIVRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVAHFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDPQPPEVAGQPPSSARPARRS
>CP019611.1|AWY76063.1|1115453_1116035_+|glyoxalase
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR
>CP019611.1|AWY76062.1|1114736_1115357_-|TetR-family-transcriptional-regulator
MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN
>CP019611.1|AWY76061.1|1113606_1114740_-|alpha/beta-hydrolase
MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPKVALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLREVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAHPGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTITDWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAHGIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLASSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR
>CP019611.1|AWY76060.1|1111297_1113493_-|acyl-CoA-dehydrogenase
MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQAAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQAKVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDEWVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDAGESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGWVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLLPPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
>CP019611.1|AWY76059.1|1109598_1111281_+|acyl-CoA-synthetase
MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLEPPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLLAKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVIIYDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRASIIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALAMFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIVFVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTVKILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVSGRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLDEDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL
>CP019611.1|AWY76058.1|1108369_1109563_-|DNA-polymerase-domain-containing-protein
MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYYLAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEAVIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVREVLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWKEEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRLADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWRDRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR
>CP019611.1|AWY76067.1|1121539_1124143_-|PE-family-protein
MSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTALIAAGADEVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLDPINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAGGAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGGNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGGQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGNGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLNVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGGAGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGNAGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLFGAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSLGASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGMLSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP
>CP019611.1|AWY76068.1|1124392_1126804_-|hypothetical-protein
MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLAPINEFFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGNGGAGGLIGNGGAGGAGGAGGNGGAGGLIGNGGAGGAGGRASTGTGGAGGAGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLFGAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSSPDGGGGAGGIGGDGGTLFGSGGAGGVGGLGFDAGGAGGAGGKAGLLSGAGGAGGAGGGSFAGAGGTGGAGGAPGLVGNAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLLGRDGFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSGGTGGSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFANGGAGGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSGGTFGGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGTGGSSGIGSSGGTGGDGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLIIGENGLNGL
>CP019611.1|AWY76069.1|1126837_1127098_+|hypothetical-protein
MPTRGTSPAKIGGLQNNSGPGKGFGISQNISHIYAVGASADGSWQHPWAGAERSLVSGWDLHCGAPWCGIVVMKIMFISPLWCLRL
>CP019611.1|AWY76070.1|1127094_1128705_+|PPE-family-protein
MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADELIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAAMPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAVASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGTMNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHIVQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLPAVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGFGSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDPDWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVPGSWDPDRDAPGSAEPGDRG
>CP019611.1|AWY76071.1|1128728_1129637_+|SAM-dependent-methyltransferase
MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFCRAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILAAGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQALRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYAAKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVPGPESEAGPMFARNTLVSAARV
>CP019611.1|AWY76072.1|1129860_1131756_+|type-VII-secretion-AAA-ATPase-EccA
MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCCRALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTATTAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHVVSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTALARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQLAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTSHELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA
>CP019611.1|AWY76073.1|1131752_1133369_+|ESX-3-secretion-system-protein-eccB3
MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR
>CP019611.1|AWY76074.1|1133365_1137358_+|type-VII-secretion-protein-EccC
MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPYLIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRHTVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARNLSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSRWDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKLIATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFGDARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS
>CP019611.1|AWY76075.1|1137354_1137663_+|PE-family-protein
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
>CP019611.1|AWY76076.1|1137665_1139207_+|PPE-family-protein
MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_9

1716110-1717057

Orphan

Consensus_repeat	Method
CGGGGCCGGCGGNNCCGGCGG	CRT

19 spacers

csa3

The CRISPR arrays of CP019611_9

>merge|CP019611|9|1716110-1717057|CRT
CGGCGGCGGAGGGACCGGCGGGTCCGGCGTCAGCGGCGGGGCGGGCGGAGATGGCGGGGCCGGCGGGATCTTGTTCGGCGCCGGCGGGGCCGGCGGCGCGGGCGGGGCCGTCACGGGAACCGGCGCCACCGGCGGGTCCGGTGGGGCCGGCGGTGGAGCCTTGCTGTTTGGGGCCGGTGGGGCCGGTGGAGCCGGCGGGTCCAGCGGGATTGGCGGGTTCGCCGCGGGCGGGGCCGGTGGGCCCGGAGGGGCCGGTGGGCTGTTCAACGGCGGCGGGGCCGGCGGGGCCGGCGGGTCCGGCGTCAGCGGCGGGGCTGGCGGGGAGGGCGGGGCCGGCGGGGCCGGTGGCCTGTTCGCCGGTGGCGGGGCCGGCGGGGCCGGCGGATCGGGCAACAACGTCGGGGGGGCCGGCGGGGCCGGTGGGGTCGGTGGGCTGTTCGGGGCCGGCGGGGCCGGCGGATCCGGCGGCGGCGGTAGCGTTGCTGGCGACGGTGGGGCCGGCGGCAACGCGGGCTTGCTCGCCCCCGGTCTCGCCGGCGGTGCCGGCGGTGGCGGCGGGCAGGGTTTTGACACCGGCGGGGCCGGCGGGCCCGGCGGCGACGCCGGCCTGCTGGTCGGCTCCGGCGGGGTCGGAGGTGCCGGCGGATTCGGCCTCACTACGGGTGGGCCTGGGGCGGCCGGCGGCGACGCCGGCCTGCTGTTCGGCTCCGGCGGCGCTGGCGGGGCCGGCGGCTCCGGCCGAACCGACCTCGGCGGCGCTGGCGGGGCCGGCGGCAAGGCCGGGCTGATCGGCAACGGCGGTAACGGCGGGGCCGGCGGGGCCGGCGGGAACGGCGGCGGGGACGGCGGGCCCGGTGGAGCCGCCTTCGGGCTCGGTAACGGCGGCAACGGCGGCAACGGGGGGACCGGCACGTCCGCGGGCAGCCCCGGTGCCGGCGGCGCCGGTGG

>CP019611|9|5|1716110-1717057|CRT
CGGCGGCGGAGGGACCGG	CGGGTCCGGCGTCAGCGGCGGGGCGGGCGGAGATGGCGGGGCCGGCGGGATCTTGTT
CGGCGCCGGCGGGGCCGG	CGGCGCGGGCGGGGCCGTCACGGGAACCGGCGCCACCGG
CGGGTCCGGTGGGGCCGG	CGGTGGAGCCTTGCTGTT
TGGGGCCGGTGGGGCCGG	TGGAGCCGGCGGGTCCAGCGGGATTGGCGGGTTCGCCGCGGG
CGGGGCCGGTGGGCCCGG	AGGGGCCGGTGGGCTGTTCAACGGCGG
CGGGGCCGGCGGGGCCGG	CGGGTCCGGCGTCAGCGGCGGGGCTGGCGGGGAGGG
CGGGGCCGGCGGGGCCGG	TGGCCTGTTCGCCGGTGG
CGGGGCCGGCGGGGCCGG	CGGATCGGGCAACAACGTCGG
GGGGGCCGGCGGGGCCGG	TGGGGTCGGTGGGCTGTT
CGGGGCCGGCGGGGCCGG	CGGATCCGGCGGCGGCGGTAGCGTTGC
TGGCGACGGTGGGGCCGG	CGGCAACGCGGGCTTGCTCGCCCCCGGTCTCGCCGGCGG
TGCCGGCGGTGGCGGCGG	GCAGGGTTTTGACACCGGCGG
GGCCGGCGGGCCCGGCGG	CGACGCCGGCCTGCTGGTCGGCTCCGGCGG
GGTCGGAGGTGCCGGCGG	ATTCGGCCTCACTACGGGTGGGCCTGGGGC
GGCCGGCGGCGACGCCGG	CCTGCTGTTCGGCTCCGGCGGCGCTGGCGG
GGCCGGCGGCTCCGGCCG	AACCGACCTCGGCGGCGCTGGCGG
GGCCGGCGGCAAGGCCGG	GCTGATCGGCAACGGCGGTAACGGCGGGGCCGGCGG
GGCCGGCGGGAACGGCGG	CGGGGACGGCGGGCCCGGTGGAGCCGCCTTCGGGCTCGG
TAACGGCGGCAACGGCGG	CAACGGGGGGACCGGCACGTCCGCGGGCAGCCCCGG
TGCCGGCGGCGCCGGTGG

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY76575.1\|1711459_1712365_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
CP019611.1\|AWY76580.1\|1722483_1723512_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227198
CP019611.1\|AWY76571.1\|1708401_1709043_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP019611.1\|AWY79015.1\|1720433_1721078_+\|sensor-domain-containing-protein	unknown	unknown	gnl\|CDD\|372884
CP019611.1\|AWY76584.1\|1725937_1726798_-\|proline-iminopeptidase	unknown	unknown	gnl\|CDD\|188121
CP019611.1\|AWY76574.1\|1711064_1711355_+\|transposase	unknown	unknown	gnl\|CDD\|223747
CP019611.1\|AWY76581.1\|1723773_1723962_-\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY76583.1\|1725057_1725870_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|316372
CP019611.1\|AWY76582.1\|1724200_1724971_+\|D-Ala-D-Ala-dipeptidase-VanX	unknown	unknown	gnl\|CDD\|279735
CP019611.1\|AWY76568.1\|1703746_1705801_-\|LytR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273029
CP019611.1\|AWY79016.1\|1721759_1722413_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227186
CP019611.1\|AWY76577.1\|1717118_1717298_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY76573.1\|1710680_1711103_-\|deaminase	unknown	unknown	gnl\|CDD\|223663
CP019611.1\|AWY76576.1\|1712383_1713199_-\|TIGR04255-family-protein	unknown	unknown	gnl\|CDD\|275082
CP019611.1\|AWY76569.1\|1705966_1707136_-\|tRNA-dihydrouridine-synthase	unknown	unknown	gnl\|CDD\|129820
CP019611.1\|AWY76578.1\|1717326_1719966_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
CP019611.1\|AWY76570.1\|1707223_1708240_-\|acyl-ACP-desaturase	unknown	unknown	gnl\|CDD\|153109
CP019611.1\|AWY76572.1\|1710230_1710623_-\|transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
CP019611.1\|AWY76579.1\|1721058_1721610_-\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY79014.1\|1709123_1710179_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226188

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY76575.1\|1711459_1712365_+\|SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	4.29544e-95
CP019611.1\|AWY76580.1\|1722483_1723512_-\|hypothetical-protein	gnl\|CDD\|227198	COG4861, COG4861, Uncharacterized protein conserved in bacteria [Function unknown].	5.33791e-171
CP019611.1\|AWY76571.1\|1708401_1709043_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	8.60489e-08
CP019611.1\|AWY79015.1\|1720433_1721078_+\|sensor-domain-containing-protein	gnl\|CDD\|372884	pfam14032, PknH_C, PknH-like extracellular domain. This domain is functionally uncharacterized. It is found as the periplasmic domain of the bacterial protein kinase PknH. The domain is also found in isolation in numerous proteins, for example the lipoproteins lpqQ, lprH, lppH and lpqA from M. tuberculosis. This family of proteins is found in bacteria. Proteins in this family are typically between 214 and 268 amino acids in length. There are two completely conserved C residues that are likely to form a disulphide bond. A second pair of cysteines are less well conserved probably form a second disulphide bond. It seems likely that this domain functions to bind some as yet unknown ligand.	1.2663e-18
CP019611.1\|AWY76584.1\|1725937_1726798_-\|proline-iminopeptidase	gnl\|CDD\|188121	TIGR01250, Proline_iminopeptidase, proline-specific peptidase, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase.	8.19399e-156
CP019611.1\|AWY76574.1\|1711064_1711355_+\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.02344e-12
CP019611.1\|AWY76583.1\|1725057_1725870_+\|SAM-dependent-methyltransferase	gnl\|CDD\|316372	pfam13847, Methyltransf_31, Methyltransferase domain. This family appears to have methyltransferase activity.	8.13208e-31
CP019611.1\|AWY76582.1\|1724200_1724971_+\|D-Ala-D-Ala-dipeptidase-VanX	gnl\|CDD\|279735	pfam01427, Peptidase_M15, D-ala-D-ala dipeptidase.	1.08627e-95
CP019611.1\|AWY76568.1\|1703746_1705801_-\|LytR-family-transcriptional-regulator	gnl\|CDD\|273029	TIGR00350, Transcriptional_regulator_LytR, cell envelope-related function transcriptional attenuator common domain. This model describes a domain of unknown function that is found in the predicted extracellular domain of a number of putative membrane-bound proteins. One of these is proteins psr, described as a penicillin binding protein 5 (PDP-5) synthesis repressor. Another is Bacillus subtilis LytR, described as a transcriptional attenuator of itself and the LytABC operon, where LytC is N-acetylmuramoyl-L-alanine amidase. A third is CpsA, a putative regulatory protein involved in exocellular polysaccharide biosynthesis. Besides the region of strong similarily represented by this model, these proteins share the property of having a short putative N-terminal cytoplasmic domain and transmembrane domain forming a signal-anchor. [Regulatory functions, Other].	3.89123e-67
CP019611.1\|AWY79016.1\|1721759_1722413_-\|hypothetical-protein	gnl\|CDD\|227186	COG4849, COG4849, Predicted nucleotidyltransferase [General function prediction only].	9.88702e-114
CP019611.1\|AWY76573.1\|1710680_1711103_-\|deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	8.91868e-24
CP019611.1\|AWY76576.1\|1712383_1713199_-\|TIGR04255-family-protein	gnl\|CDD\|275082	TIGR04255, hypothetical_protein, TIGR04255 family protein. Members of this uncharacterized protein family are found broadly but sporadically among bacteria and archaea, including members of the genera Mycobacterium, Nostoc, Acinetobacter, Planctomyces, Geobacter, Streptomyces, Methanospirillum, etc. The function is unknown.	1.96412e-45
CP019611.1\|AWY76569.1\|1705966_1707136_-\|tRNA-dihydrouridine-synthase	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	7.36004e-168
CP019611.1\|AWY76578.1\|1717326_1719966_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.26727e-28
CP019611.1\|AWY76570.1\|1707223_1708240_-\|acyl-ACP-desaturase	gnl\|CDD\|153109	cd01050, Acyl_ACP_Desat, Acyl ACP desaturase, ferritin-like diiron-binding domain. Acyl-Acyl Carrier Protein Desaturase (Acyl_ACP_Desat) is a mu-oxo-bridged diiron-carboxylate enzyme, which belongs to a broad superfamily of ferritin-like proteins and catalyzes the NADPH and O2-dependent formation of a cis-double bond in acyl-ACPs. Acyl-ACP desaturases are found in higher plants and a few bacterial species (Mycobacterium tuberculosis, M. leprae, M. avium and Streptomyces avermitilis, S. coelicolor). In plants, Acyl-ACP desaturase is a plastid-localized, covalently ACP linked, soluble desaturase that introduces the first double bound into saturated fatty acids, resulting in the corresponding monounsaturated fatty acid. Members of this class of soluble desaturases are specific for a particular substrate chain length and introduce the double bond between specific carbon atoms. For example, delta 9 stearoyl-ACP is specific for stearic acid and introduces a double bond between carbon 9 and 10 to yield oleic acid in the ACP-bound form. The enzymatic reaction requires molecular oxygen, NAD(P)H, NAD(P)H ferredoxin oxido-reductase and ferredoxin. The enzyme is active in the homodimeric form; the monomer consists mainly of alpha-helices with the catalytic diiron center buried within a four-helix bundle. Integral membrane fatty acid desaturases that introduce double bonds into fatty acid chains, acyl-CoA desaturases of animals, yeasts, and fungi, and acyl-lipid desaturases of cyanobacteria and higher plants, are distinct from soluble acyl-ACP desaturases, lack diiron centers, and are not included in this CD.	1.08695e-140
CP019611.1\|AWY76572.1\|1710230_1710623_-\|transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	9.15024e-22
CP019611.1\|AWY79014.1\|1709123_1710179_+\|hypothetical-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	7.60533e-137

>CP019611.1|AWY76576.1|1712383_1713199_-|TIGR04255-family-protein
MLPETNQDEVQPNAPVALVTVEIRHPTTDSLTESANRELKHLLINDLPIERQAQDVSWGMTAPGGAPTPVADRFVRYVNRDNTTAASLKNQAIVVETTAYRSFEAFTDVVMRVVDARAQVSSIVGLERIGLRFVLEIRVPAGVDGRITWSNWIDEQLLGPQRFTPGGLVLTEWQGAAVYRELQPGKSLIVRYGPGMGQALDPNYHLRRITPAQTGPFFLLDIDSFWTPSGGSIPEYNRDALVSTFQDLYGPAQVVFQEMITSRLKDELLRQ
>CP019611.1|AWY76575.1|1711459_1712365_+|SAM-dependent-methyltransferase
MVRADRDRWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGDSEFDPQRMATGMACRTRFFDQFFLDATHSGIGQFVILASGLDARAYRLAWPVGSIVYEVDMPEVIEFKTATLSDLGAEPATERRTVAVDLRDDWATALQTAGFDPKVPAAWSAEGLLVYLPVEAQDALFDNITALSAPGSRLAFEFVPDTAIFADERWRNYHNRMSELGFDIDLNELVYHGQRGHVLDYLTRDGWQTSALTVTQLYEANGFAYPDDELATAFADLTYSSATLMR
>CP019611.1|AWY76574.1|1711064_1711355_+|transposase
MGPSSKTCHACRHVQDIGWDEKWQCDGCSITHQRDDNAAINLARYEEPPSVVGPVGAAVKRGADRKTGPGPAGGREARKGTGHPAGEQPRDGVLVA
>CP019611.1|AWY76573.1|1710680_1711103_-|deaminase
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG
>CP019611.1|AWY76572.1|1710230_1710623_-|transcriptional-regulator
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG
>CP019611.1|AWY79014.1|1709123_1710179_+|hypothetical-protein
MTQDTSATCPLTSTVQDSSPVAGQLGRPIGFRGLAGGCPVSPLGYESPPLPLGPDSLTWRYFGDWRGMLQGPWAGSMQNMHPQLGAAVEDHSTFFRERWPRLLRSLYPIGGVVFDGDRAPVTGVQVRDYHITIKGVDGAGRRYHALNPDVFYWAHATFFVGTLHVAERFCGGLTEAQRRQLFDEHVQWYRMYGMSMRPVPATWEEFQDYWDHMCRNVLENNFAARAVLDLTELPKPPFAQRVPDWLWAAPRKLLARFFVWLTVGLYDPPVRELMGYRWLRRDEWLHRRFGDIVRLVFALVPFRFRKHPRARAGWDRATGRIPADAPLVQTPARNLPPPDERDNPTHYCPKV
>CP019611.1|AWY76571.1|1708401_1709043_-|TetR-family-transcriptional-regulator
MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYESFADREHFVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPALTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFIDYCVNMLLSTAATYAPHRERGESEHSIPAGPHN
>CP019611.1|AWY76570.1|1707223_1708240_-|acyl-ACP-desaturase
MSAKLTDLQLLHELEPVVEKYLNRHLSMHKPWNPHDYIPWSDGKNYYALGGQDWDPDQSKLSDVAQVAMVQNLVTEDNLPSYHREIAMNMGMDGAWGQWVNRWTAEENRHGIALRDYLVVTRSVDPVELEKLRLEVVNRGFSPGQNHQGHYFAESLTDSVLYVSFQELATRISHRNTGKACNDPVADQLMAKISADENLHMIFYRDVSEAAFDLVPNQAMKSLHLILSHFQMPGFQVPEFRRKAVVIAVGGVYDPRIHLDEVVMPVLKKWRIFEREDFTGEGAKLRDELALVIKDLELACDKFEVSKQRQLDREARTGKKVSAHELHKTAGKLAMSRR
>CP019611.1|AWY76569.1|1705966_1707136_-|tRNA-dihydrouridine-synthase
MSRRRAIQPSPALRIGPIELASPVVLAPMAGVTNVAFRALCRQLEQSKVGTVSGLYVCEMVTARALIERHPVTMHMTTFSADESPRSLQLYTVDPDTTYAAARMIAGEGLADHIDMNFGCPVPKVTKRGGGAALPFKRRLFGQIVAAAVRATEGTDIPVTVKFRIGIDDAHHTHLDAGRIAEAEGAAAVALHARTAAQRYSGTADWEQIARLKQHVRTIPVLGNGDIYDAGDALAMMSTTGCDGVVIGRGCLGRPWLFAELSAAFTGSPAPTPPTLGEVADIIRRHGTLLAAHFGEDKGMRDIRKHIAWYLHGFPAGSALRRALAMVKTFDELDCLLDRLDGTVPFPDSATGARGRQGSPARVALPDGWLTDPDDCRVPEGADAMGSGG
>CP019611.1|AWY76568.1|1703746_1705801_-|LytR-family-transcriptional-regulator
MSDGESAAPWARLSESAFPDGVDRWITVPPATWVAAQGPRDTQNVGCHATGAVSVADLIARLGPAFPDLPTHRHVAPEPEPSGRGPKVHDDADDQQDTEAIAIPAHSLEFLSELPDLRAANYPRADHARREPELPGKQLTGSARVRPLRIRRTSPAPAKPAPNSGRRPMVLAARSLAALFAALALALTGGAWQWSASKNSRLNMVSALDPHSGDIVNPSGQHGDENFLLVGMDSRAGANANIGAGDAEDAGGARSDTVMLVNIPASRERVVAVSFPRDLAITPIQCEAWNPETGKYGPIYDEKTGTMGPRLVYTETKLNSAFSFGGPKCLVKVIQKLSGLSINRFIAIDFVGFARMVEALGGVEVCSTTPLRDYELGTVLEHAGRQVIDGPTALNYVRARQVTTESNGDYGRIKRQQLFLSSLLRSMISTDTLFNLSRLNNVVNMFIGNSYVDNVKTKDLVELGRSLQHMAAGHVTFVTVPTGITDQNGDEPPRTSDMKALFTAIIDDDPLPLENDHNAQRLGNTPSTPPTTTKKAPQAGLTNEIQHQQVTTTSPKEVTVQVSNSTGQAGLATTATDQLKRNGFNVMAPDDYPSSLLATTVFFSPGNEQAAATVAAVFGQSKIERVTGIGQLVQVVLGQDFSAVRAPLPSGSTVSVQISRNSSSPPTKLPEDLTVTNAADTTCE
>CP019611.1|AWY76577.1|1717118_1717298_+|hypothetical-protein
MIDDRHKSTRRTCNHGGITWRVAATSARSARSLATTHPEAGHYGLATWFTRMDAMTAPT
>CP019611.1|AWY76578.1|1717326_1719966_-|PE-family-protein
MSFVIAAPDLVAMATEDLAGIGASLTAANAAAAVPTSGLLAAAGDEVSAAIAALFSSHGQQYQAMSAQAAAFHARFVQALAGAMGAYAAAEAANASPLQTLEQGLLGAINAPAAALSGRPFIGNGTNGAPGTGEAGGPGGWLLGNGGNGGSGAPGQTGGAGGAAGLLGHGGTGGAGGTGASGGKGGTGGWLWGSGGAGGAGGSGGGSGGAGGNALMFGIGGNGGAGGAASGVGNGGVGGAGGAGGALVAIGGAGGAGGAATTGTGGAGGAGSNALGLFLGLGGSGGQGGDSAMGSGGAGGAGGSGGAASPFGIDIGIGGAGGHGGAGTNGGAGGAGGAGGSSGTVFALDLSWGGAGGNGGAATTGTGGAGGTGGFAVAPDFIGFGAAYGGAGGLGGAATGAGGTGGTGGVGAGGFAALGVGVGGAGGAGGAATETGGIGGAGGLGVGLLGGAGGAGGPGGAASAGSGGHGGTGGDALGLIGAGIGGVGGVGGAATDTGGNGGAGGSGTGLLGGVGGAGGHGGGASVGTGGSGGAGGDGFGFVGAGGNGGNAGTGVGVNGANGGNGGSATGALAAVGGAGAAGGDATSGTGGFGGAGGSARGLIFALGGAGAAGGDASTGVGGPGGPGGTGTASSPFGIAIAIGGAGAQGGAGTSGATGGAGGDGVFEGIAVLGLGFGGAAGAGGAATGDGATGGAGGFGGAGAGIANFLGFSVLHGGAGGAGGTATGTGGNGGAGGGGGLSSPVILGIGIGGAGGDGGGALGVLGGMGGDGGEAVAVGIAVGGAGGAGGAAPTGNGGAGGNGGDALGLVGVGGNGGNAGTGFGANTGGNGGDTTIVVNGMLAPSTLGYGGNGGNGVNGGAGGTGGKAGVFGAPGQNGLP
>CP019611.1|AWY79015.1|1720433_1721078_+|sensor-domain-containing-protein
MCCSTAAKSAVIVCCAAIATTACSFQATSTQPSTAPPTSRVDSLIVSIEDVRRIANYEELAAHFQTDLREPPEADTNVPGPCRVVGSSDRTFGTDWSEFRSAGYHGVTDDLRPGGPVMVETVSQAIALYPDPSTARGVFHRLESSLAECAGLHDPYFDFILDRPDASTVRIGAAGWSHVYRLKSSVFISVGVLGIEPAEPIANVILQTISDRIQ
>CP019611.1|AWY76579.1|1721058_1721610_-|hypothetical-protein
MKAATSWMQQQVLATATVVRWRLAWLSKPETWRRRKRRQSQKIRRSVQKQRRSTVWDNQRKTFGVVISPARLTAWIAASALILLTGTELFGTALSWVKLSPIWHVFSFAVDTRPIATLLDYASHPIDPRSYSSVAVTAVGAEATLLAFFFATVGVVASTALNTLRSSPPLLLSSPRLTTGCDR
>CP019611.1|AWY79016.1|1721759_1722413_-|hypothetical-protein
MLVGAQCRDLLHWRFCRGVPPRATNDTDIAGTLNNWDHFEAIRATFRALGSTGHRFLIADRAVDALPFGEVESPTGTTRHPPGNQLMNVHGCTDAYLRADVLPLPGGLTVHLPQPPNYAVLKLHAWLDRSADHDYKDGPDLALVVHWYAGDLDRLYAKPDQWALRRHDFDLRTAAAALLGHDMRASVSAPEAAVLATRATQADHDLLAQHFAVGRPG
>CP019611.1|AWY76580.1|1722483_1723512_-|hypothetical-protein
MDQIGADLAEAVERHLTEYGVRVLGGLSALNSAHPESLDLEIDAHPLTITALYLPHLSATAALQAWDTAGAGSPLLVVGPRLHPSSAETLRARGLWYIDGAGNAYLRHQGGLLIDVRGRRSAVSAQPGTLGDGLHSDGPRNPFTPKRAQVVCVLLDAPQLVDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVRTDELLDLWAAAYPGGLGRANKLLVASGDIHTWSAPDGLAVAVSGEQALPDEIRNPESLMLYVDTPAPGLPADLLIHNRWHRDPHGSIVIRKLFWRNLPDEQPGLAPTALIYADLLASREPRQVEVAHLMRRQDERLARL
>CP019611.1|AWY76581.1|1723773_1723962_-|hypothetical-protein
MIGISYFVMTQLEAAVERRSRRSSRCGDRRPLDGANHHGLLGSSFLAPARPDLQAQRQALAQ
>CP019611.1|AWY76582.1|1724200_1724971_+|D-Ala-D-Ala-dipeptidase-VanX
MRLIGRLRLLMVGLVVICGACACDRVSAGRWSESPSATSWPVRPVNTTTPSGPVPPVSEAARAAGLVDVRGVVPDAAIDLRYATANNFTGTQLYPPGARCLVHESMAEGLAAAAAVLRPHGQVLVFWDCYRPHDVQVRMFDVVPNPAWVARPGKYAHSHEAGRSVDVTFASAQRQCPSVRRSGELCLADMGTDFDDFSSRATAFATQGVSAEAQANRAHLRAAMQAGGLTVYSGEWWHFDGPGAGVDRPILEVPVD
>CP019611.1|AWY76583.1|1725057_1725870_+|SAM-dependent-methyltransferase
MNDKRRAIYTHGYHESVLRSHRRRTAENSAGYLLPYLVPGLSVLDVGCGPGTITVDLAARVVPGSVTGVEPTDDALSLARAEAQLHRLSNISFTTSDVHKLDFPDDAFDVVHAHQVLQHVADPVRALQEMRRVCTPGGIVAARDADYSGFIWFPKLPALDRWLDLYERAARANGGEPDAGRRLLSWARAAGFDDVTPTASVWCFATASAREWWGLVWADRILQSDLAHQLVDSGLATAAQLEEISTAWREWAAAPDGWLAIPHGEILCRA
>CP019611.1|AWY76584.1|1725937_1726798_-|proline-iminopeptidase
MEGTIAVPGGRVWFQRIGGGPGRPLLVVHGGPGLPHNYLAPLRRLSDEREVIFWDQLGCGNSACPSDVDLWTMNRSVAEMATVAEALALTRFHIFSHSWGGMLAQQYVLDKAPDAVSLTIANSTASIPEFSASLVSLKSCLDVATRSAIDRHEAAGTTHSAEYQAAIRTWNETYLCRTRPWPRELTEAFANMGTEIFETMFGPSDFRIVGNVRDWDVVDRLADIAVPTLLVVGRFDECSPEHMREMQGRIAGSRLEFFESSSHMPFIEEPARFDRVMREFLRLHDI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_15

3898323-3899239

TypeIII

II-B,III-A

Consensus_repeat	Method
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRT

12 spacers

cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7

The CRISPR arrays of CP019611_15

>merge|CP019611|15|3898323-3899239|PILER-CR,CRISPRCasFinder,CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAAGTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGACTGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGACATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGACCCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACTTGCGCGCACAACGCATCCGCCATCCACGGGGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACTGA

>CP019611|15|3|3898323-3899168|PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|15|7|3898323-3899239|CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACTGA

>CP019611|15|7|3898323-3899239|CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGGGCACGGCCGAAACACCGCGCGAAGGGCGGTTCAA
GTTTCCGTCCCCTCTCGTGGTTTTGGGTCTGACGAC	TGGGAGGATGTCACTCGGACATAGCTGTCATCGGCGGTGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGAGGAC	ATGGAGCAGTAGCGTGGCTGTGGTGTGGCGGGCGATATGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGCTGCACCTCCCGCACCCGGTGCGATTCTGCGTCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCCGACGAC	CCCGATAGTCGCGCTCGTCCATGTCCCACCATGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TACCTGATAGAAGCCGGAAAGCTCCGTGCCGTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGGCACTGGACCTGTATGAGGCACAGATGGCGTACTA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGATCGGTTACCCACGCCGATTTACTGGCCATCGTCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACTTGCGCGCACAACGCATCCGCCATCCACGGGGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGAAAGGGGGACTGTGGACGAGTTCGCGCTCAAAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGAACACGCCGATACCTATTTGGTCGGGAGTGATAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACTGA

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY78407.1\|3891602_3891794_-\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	csm6	cd09699_csm6_CAS-III-A	gnl\|CDD\|187830
CP019611.1\|AWY78412.1\|3894545_3894857_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78409.1\|3892405_3892597_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY79265.1\|3892004_3892409_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG1343_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|224262
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	cas1	COG1518_cas1_CAS-I:CAS-II:CAS-III	gnl\|CDD\|272998
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225806
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	COG1332_csm5gr7_CAS-III-A	gnl\|CDD\|224251
CP019611.1\|AWY78411.1\|3894183_3894441_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78413.1\|3895276_3895885_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78408.1\|3891776_3891932_+\|histone-acetyltransferase	unknown	unknown	unknown
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|187830	cd09699, Csm6_III-A, CRISPR/Cas system-associated protein Csm6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Protein of this family often fused to HTH domain; loosely associated with CRISPR/Cas systems.	0
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.94329e-16
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.7433e-07
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|224262	COG1343, COG1343, CRISPR-associated protein Cas2 [Defense mechanisms].	3.66595e-25
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.37381e-109
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|272998	TIGR00287, CRISPR-associated_endonuclease_Cas1, CRISPR-associated endonuclease Cas1. This model identifies CRISPR-associated protein Cas1, the most universal CRISPR system protein. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Cas1 is a metal-dependent DNA-specific endonuclease.	2.72742e-113
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|224251	COG1332, COG1332, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.40728e-139
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.67948e-07
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28

>CP019611.1|AWY78415.1|3897361_3898174_+|AAA-family-ATPase
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP019611.1|AWY78414.1|3895955_3897365_+|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP019611.1|AWY78413.1|3895276_3895885_+|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP019611.1|AWY78412.1|3894545_3894857_+|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP019611.1|AWY78411.1|3894183_3894441_+|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP019611.1|AWY78410.1|3892795_3893950_+|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLVAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP019611.1|AWY78409.1|3892405_3892597_+|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>CP019611.1|AWY79265.1|3892004_3892409_+|hypothetical-protein
MGRGNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>CP019611.1|AWY78408.1|3891776_3891932_+|histone-acetyltransferase
MAGARHYGARALVVDAIDDRAAEFYGHHGFLPLEGRRLYRRISDIARALGV
>CP019611.1|AWY78407.1|3891602_3891794_-|hypothetical-protein
MPGTGHGSDEGIEEKIATETGALLLPVERQASEDEHWDRVGSGWPRPGRDGTRIRSMLPMASA
>CP019611.1|AWY79266.1|3899278_3900115_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78416.1|3900213_3900540_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKAASAFFAAELDRPAR
>CP019611.1|AWY79267.1|3901132_3901969_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78417.1|3902067_3902394_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
>CP019611.1|AWY78418.1|3904344_3904686_-|CRISPR-associated-endonuclease-Cas2
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF
>CP019611.1|AWY79268.1|3904686_3905703_-|CRISPR-associated-endonuclease-Cas1
MVQLYVSDSVSRISFADGRVIVWSEELGESQYPIETLDGITLFGRPTMTTPFIVEMLKRERDIQLFTTDGHYQGRISTPDVSYAPRLRQQVHRTDDPAFCLSLSKRIVSRKILNQQALIRAHTSGQDVAESIRTMKHSLAWVDRSGSLAELNGFEGNAAKAYFTALGHLVPQEFAFQGRSTRPPLDAFNSMVSLGYSLLYKNIIGAIERHSLNAYIGFLHQDSRGHATLASDLMEVWRAPIIDDTVLRLIADGVVDTRAFSKNSDTGAVFATREATRSIARAFGNRIARTATYIKGDPHRYTFQYALDLQLQSLVRVIEAGHPSRLVDIDITSEPSGA
>CP019611.1|AWY79269.1|3905715_3906864_-|type-III-A-CRISPR-associated-protein-Csm6
MLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSAEFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVSNLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPAITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDMAPLG
>CP019611.1|AWY78419.1|3906959_3908087_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE
>CP019611.1|AWY78420.1|3908083_3908992_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA
>CP019611.1|AWY78421.1|3908972_3909683_-|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_16

3900635-3901106

TypeIII

II-B,III-A

Consensus_repeat	Method
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRT

6 spacers

cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10

The CRISPR arrays of CP019611_16

>merge|CP019611|16|3900635-3901106|PILER-CR,CRISPRCasFinder,CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGAGTTTCCGTCCCCTCTCGGGGTGAACCGCCCCGGTGA

>CP019611|16|4|3900635-3901035|PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|16|8|3900635-3901035|CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|16|8|3900635-3901106|CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GGCTGGAAAAGGGCGCGGGGCAACCGCATCGTCAAGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GCGTTGTGGTCGTGTCGTGGAGCCTGTATTTCGCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CATTAGTTGGTGTTGTGATCGCTAAACGCCGGGGCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTATCCGCGGGAAGAGATCACGAATCCGGCGTCGAAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCTGAGCTGAGGCGCCGGATGATGGTGGTGCTGAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGACAGGGTGCGGTGGTCGCTGATCGGCTCCCCGA
GTTTCCGTCCCCTCTCGGGGTGAACCGCCCCGGTGA

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY78411.1\|3894183_3894441_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	csm6	cd09699_csm6_CAS-III-A	gnl\|CDD\|187830
CP019611.1\|AWY78409.1\|3892405_3892597_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY79265.1\|3892004_3892409_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG1343_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|224262
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	cas1	COG1518_cas1_CAS-I:CAS-II:CAS-III	gnl\|CDD\|272998
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78422.1\|3909692_3910067_-\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225806
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78423.1\|3910063_3912502_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	COG1332_csm5gr7_CAS-III-A	gnl\|CDD\|224251
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78412.1\|3894545_3894857_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
CP019611.1\|AWY78413.1\|3895276_3895885_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|187830	cd09699, Csm6_III-A, CRISPR/Cas system-associated protein Csm6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Protein of this family often fused to HTH domain; loosely associated with CRISPR/Cas systems.	0
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.94329e-16
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.7433e-07
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|224262	COG1343, COG1343, CRISPR-associated protein Cas2 [Defense mechanisms].	3.66595e-25
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.37381e-109
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|272998	TIGR00287, CRISPR-associated_endonuclease_Cas1, CRISPR-associated endonuclease Cas1. This model identifies CRISPR-associated protein Cas1, the most universal CRISPR system protein. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Cas1 is a metal-dependent DNA-specific endonuclease.	2.72742e-113
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY78422.1\|3909692_3910067_-\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP019611.1\|AWY78423.1\|3910063_3912502_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|224251	COG1332, COG1332, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.40728e-139
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.67948e-07
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28

>CP019611.1|AWY78416.1|3900213_3900540_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKAASAFFAAELDRPAR
>CP019611.1|AWY79266.1|3899278_3900115_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78415.1|3897361_3898174_+|AAA-family-ATPase
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP019611.1|AWY78414.1|3895955_3897365_+|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP019611.1|AWY78413.1|3895276_3895885_+|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP019611.1|AWY78412.1|3894545_3894857_+|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP019611.1|AWY78411.1|3894183_3894441_+|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP019611.1|AWY78410.1|3892795_3893950_+|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLVAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP019611.1|AWY78409.1|3892405_3892597_+|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>CP019611.1|AWY79265.1|3892004_3892409_+|hypothetical-protein
MGRGNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>CP019611.1|AWY79267.1|3901132_3901969_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78417.1|3902067_3902394_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
>CP019611.1|AWY78418.1|3904344_3904686_-|CRISPR-associated-endonuclease-Cas2
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF
>CP019611.1|AWY79268.1|3904686_3905703_-|CRISPR-associated-endonuclease-Cas1
MVQLYVSDSVSRISFADGRVIVWSEELGESQYPIETLDGITLFGRPTMTTPFIVEMLKRERDIQLFTTDGHYQGRISTPDVSYAPRLRQQVHRTDDPAFCLSLSKRIVSRKILNQQALIRAHTSGQDVAESIRTMKHSLAWVDRSGSLAELNGFEGNAAKAYFTALGHLVPQEFAFQGRSTRPPLDAFNSMVSLGYSLLYKNIIGAIERHSLNAYIGFLHQDSRGHATLASDLMEVWRAPIIDDTVLRLIADGVVDTRAFSKNSDTGAVFATREATRSIARAFGNRIARTATYIKGDPHRYTFQYALDLQLQSLVRVIEAGHPSRLVDIDITSEPSGA
>CP019611.1|AWY79269.1|3905715_3906864_-|type-III-A-CRISPR-associated-protein-Csm6
MLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSAEFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVSNLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPAITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDMAPLG
>CP019611.1|AWY78419.1|3906959_3908087_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE
>CP019611.1|AWY78420.1|3908083_3908992_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA
>CP019611.1|AWY78421.1|3908972_3909683_-|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>CP019611.1|AWY78422.1|3909692_3910067_-|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>CP019611.1|AWY78423.1|3910063_3912502_-|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYIADNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP019611_17

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP019611_17

3902429-3904296

TypeIII

II-B,III-A

Consensus_repeat	Method
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRISPRCasFinder
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CRT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	PILER-CR

25 spacers

cas2,cas1,csm6,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of CP019611_17

>merge|CP019611|17|3902429-3904296|CRISPRCasFinder,CRT,PILER-CR
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGACTCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTCGACGATTGGGACATCGACATCGACGCGATCGTCGACGAGTTTCCGTCCTCTCTCGGGGTTTTGGGTCTGACGACGTGATCTTCTCTCCTGGCGAGGTCAAGGAAATCGATGTGGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTGGCGATTTACGACGCTGACGGGAACTCGTGCGAATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCGCGAAATTCACTGCGCGTTATTCAAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCATGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGCGAATCCGCTGTCAGCACATGGGATTCCGAGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGCGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTTGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTAGAAGGCGATCACTGGAAGCACGGCGCTTGCGAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATGGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAAGTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|17|9|3902429-3904296|CRISPRCasFinder
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGAC	TCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGACGATTGGGACATCGACATCGACGCGATCGTCGACGA
GTTTCCGTCCTCTCTCGGGGTTTTGGGTCTGACGAC	GTGATCTTCTCTCCTGGCGAGGTCAAGGAAATCGATGTGGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCGAATCCGCTGTCAGCACATGGGATTCCGAGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TAGAAGGCGATCACTGGAAGCACGGCGCTTGCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|17|9|3902429-3904296|CRT
CATGCCGGGGCGGTTCAGGGTTTTGGGTCTGACGAC	TCGCGGCGAGCACGTCTCACCCAGCAGGCGGTGAGGTTGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGACGATTGGGACATCGACATCGACGCGATCGTCGACGA
GTTTCCGTCCTCTCTCGGGGTTTTGGGTCTGACGAC	GTGATCTTCTCTCCTGGCGAGGTCAAGGAAATCGATGTGGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGAGCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGTGGGGAGAGGGAATGGCAATGATGGTCGACGAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCGGACAGCATCTCCCCGGGCGGGCAGCAGATATCCCAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGACCCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CCGGAAGTCAACTAGAGCGGGTGTCGAACGCTGCCCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ATGCGAATCCGCTGTCAGCACATGGGATTCCGAGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAGGCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGC
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CAGCGCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	AGGCTGAAATTGAAGCCGGAAATGACGACGCATTGGT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTAAGCCCGCTAATCCCGCACAAGTGGTCAGAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTGATGATTGGTCGGCGTATGACGTGCTACTGAGGTGTT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TAGAAGGCGATCACTGGAAGCACGGCGCTTGCGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGGTCAAAAGCTGTCGCCCAAGCATGAGGCAAAAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGACTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	GTGCAAGAATTCCGGGTTGCAGTGCAACACGGTTTTAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

>CP019611|17|5|3902505-3904296|PILER-CR
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	ACGGACGAGCTGGACCGCATCAGCGATGCTGAGCTGAGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TTGTCTCAATCGTGCCGTCTGCGGTGACACGCTCCAA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TCGACGATTGGGACATCGACATCGACGCGATCGTCGACGA
GTTTCCGTCCTCTCTCGGGGTTTTGGGTCTGACGAC	GTGATCTTCTCTCCTGGCGAGGTCAAGGAAATCGATGTGGA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CACCAGGATCAGCGCCAAGCCAGTTAGCGCAATCCA
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CTCCCGGACCATCTGCAGCTCGCCCGGGTCCATGCG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	CGGAGTCATCCGCGCGGGCCGGCGCGATTGTTGCCGG
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC	TGGCGATTTACGACGCTGACGGGAACTCGTGCGAAT
GTTTCCGTCCCCTCTCGGGGTTTTGGGTCTGATCCG	CGAAATTCACTGCGCGTTATTCAAGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGA	GCCGACCATCCGCATCACACCGAAAGGGTTGGCGCAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGT	GGGGAGAGGGAATGGCAATGATGGTCGACGAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTCG	GACAGCATCTCCCCGGGCGGGCAGCAGATATCCCATGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCGAC	CCGTGGCCGCCAGGTTGCCGCCGCCGTTGCTCACCTGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCCGG	AAGTCAACTAGAGCGGGTGTCGAACGCTGCCCGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACATGC	GAATCCGCTGTCAGCACATGGGATTCCGAGTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAG	GCGGCCCCGGCGAGGCTGGGGGCGGTTTCACGCGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCAGC	GCAGACGGCAGCCCCGAGTACTCGCTCTCCTCAGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACAGGC	TGAAATTGAAGCCGGAAATGACGACGCATTGGTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTAA	GCCCGCTAATCCCGCACAAGTGGTCAGAAAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACCTGA	TGATTGGTCGGCGTATGACGTGCTACTGAGGTGTTGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTAGA	AGGCGATCACTGGAAGCACGGCGCTTGCGAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACTTGG	TCAAAAGCTGTCGCCCAAGCATGAGGCAAAAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACACGA	CTAGGGGAGCGTGATCCAGAGCCGGCGACCCTCTATGGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGACGTGC	AAGAATTCCGGGTTGCAGTGCAACACGGTTTTAAGTTT
CCGTCCCCTCTCGGGGTTTTGGGTCTGACGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP019611.1\|AWY78424.1\|3912498_3913443_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838
CP019611.1\|AWY78411.1\|3894183_3894441_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	csm6	cd09699_csm6_CAS-III-A	gnl\|CDD\|187830
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG1343_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|224262
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	COG1567_csm4gr5_CAS-III-A	gnl\|CDD\|224483
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	unknown	unknown	gnl\|CDD\|366234
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	cas1	COG1518_cas1_CAS-I:CAS-II:CAS-III	gnl\|CDD\|272998
CP019611.1\|AWY79270.1\|3913620_3914166_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226743
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	unknown	unknown	gnl\|CDD\|222853
CP019611.1\|AWY78422.1\|3909692_3910067_-\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225806
CP019611.1\|AWY78423.1\|3910063_3912502_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	COG1332_csm5gr7_CAS-III-A	gnl\|CDD\|224251
CP019611.1\|AWY78413.1\|3895276_3895885_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
CP019611.1\|AWY78412.1\|3894545_3894857_+\|hypothetical-protein	unknown	unknown	unknown
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815

Protein	Function_ID	Function_description	E-value
CP019611.1\|AWY78424.1\|3912498_3913443_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	4.02032e-78
CP019611.1\|AWY78421.1\|3908972_3909683_-\|CRISPR-type-III-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
CP019611.1\|AWY79269.1\|3905715_3906864_-\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|187830	cd09699, Csm6_III-A, CRISPR/Cas system-associated protein Csm6. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Protein of this family often fused to HTH domain; loosely associated with CRISPR/Cas systems.	0
CP019611.1\|AWY78410.1\|3892795_3893950_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.94329e-16
CP019611.1\|AWY78417.1\|3902067_3902394_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.7433e-07
CP019611.1\|AWY78418.1\|3904344_3904686_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|224262	COG1343, COG1343, CRISPR-associated protein Cas2 [Defense mechanisms].	3.66595e-25
CP019611.1\|AWY78420.1\|3908083_3908992_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|224483	COG1567, COG1567, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.37381e-109
CP019611.1\|AWY79266.1\|3899278_3900115_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY79268.1\|3904686_3905703_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|272998	TIGR00287, CRISPR-associated_endonuclease_Cas1, CRISPR-associated endonuclease Cas1. This model identifies CRISPR-associated protein Cas1, the most universal CRISPR system protein. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Cas1 is a metal-dependent DNA-specific endonuclease.	2.72742e-113
CP019611.1\|AWY79270.1\|3913620_3914166_-\|hypothetical-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	1.13775e-85
CP019611.1\|AWY79267.1\|3901132_3901969_-\|transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.66115e-105
CP019611.1\|AWY78422.1\|3909692_3910067_-\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
CP019611.1\|AWY78415.1\|3897361_3898174_+\|AAA-family-ATPase	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
CP019611.1\|AWY78423.1\|3910063_3912502_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
CP019611.1\|AWY78419.1\|3906959_3908087_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|224251	COG1332, COG1332, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.40728e-139
CP019611.1\|AWY78416.1\|3900213_3900540_-\|hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.67948e-07
CP019611.1\|AWY78414.1\|3895955_3897365_+\|transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28

>CP019611.1|AWY78417.1|3902067_3902394_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
>CP019611.1|AWY79267.1|3901132_3901969_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78416.1|3900213_3900540_-|hypothetical-protein
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKAASAFFAAELDRPAR
>CP019611.1|AWY79266.1|3899278_3900115_-|transposase
MPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>CP019611.1|AWY78415.1|3897361_3898174_+|AAA-family-ATPase
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>CP019611.1|AWY78414.1|3895955_3897365_+|transposase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>CP019611.1|AWY78413.1|3895276_3895885_+|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>CP019611.1|AWY78412.1|3894545_3894857_+|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>CP019611.1|AWY78411.1|3894183_3894441_+|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>CP019611.1|AWY78410.1|3892795_3893950_+|transposase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLVAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>CP019611.1|AWY78418.1|3904344_3904686_-|CRISPR-associated-endonuclease-Cas2
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF
>CP019611.1|AWY79268.1|3904686_3905703_-|CRISPR-associated-endonuclease-Cas1
MVQLYVSDSVSRISFADGRVIVWSEELGESQYPIETLDGITLFGRPTMTTPFIVEMLKRERDIQLFTTDGHYQGRISTPDVSYAPRLRQQVHRTDDPAFCLSLSKRIVSRKILNQQALIRAHTSGQDVAESIRTMKHSLAWVDRSGSLAELNGFEGNAAKAYFTALGHLVPQEFAFQGRSTRPPLDAFNSMVSLGYSLLYKNIIGAIERHSLNAYIGFLHQDSRGHATLASDLMEVWRAPIIDDTVLRLIADGVVDTRAFSKNSDTGAVFATREATRSIARAFGNRIARTATYIKGDPHRYTFQYALDLQLQSLVRVIEAGHPSRLVDIDITSEPSGA
>CP019611.1|AWY79269.1|3905715_3906864_-|type-III-A-CRISPR-associated-protein-Csm6
MLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSAEFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLELMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVSNLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPAITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLALLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGADLTLYDRLNDEIIRQIDMAPLG
>CP019611.1|AWY78419.1|3906959_3908087_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEAFVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTLNEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFERKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRECLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIVGPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNICYEMGQCELSIRRAE
>CP019611.1|AWY78420.1|3908083_3908992_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRLTDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAARQTKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGISALGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLVKRSGFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLALPESAA
>CP019611.1|AWY78421.1|3908972_3909683_-|CRISPR-type-III-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>CP019611.1|AWY78422.1|3909692_3910067_-|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>CP019611.1|AWY78423.1|3910063_3912502_-|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYIADNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE
>CP019611.1|AWY78424.1|3912498_3913443_-|CRISPR-associated-endoribonuclease-Cas6
MAARRGGIRRTDLLRRSGQPRGRHRASAAESGLTWISPTLILVGFSHRGDRRMTEHLSRLTLTLEVDAPLERARVATLGPHLHGVLMESIPADYVQTLHTVPVNPYSQYALARSTTSLEWKISTLTNEARQQIVGPINDAAFAGFRLRASGIATQVTSRSLEQNPLSQFARIFYARPETRKFRVEFLTPTAFKQSGEYVFWPDPRLVFQSLAQKYGAIVDGEEPDPGLIAEFGQSVRLSAFRVASAPFAVGAARVPGFTGSATFTVRGVDTFASYIAALLWFGEFSGCGIKASMGMGAIRVQPLAPREKCVPKP
>CP019611.1|AWY79270.1|3913620_3914166_-|hypothetical-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHKLAVLVVSAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	CP019611.1	318802-318836	0	1.0
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	CP019611.1	1123656-1123678	0	1.0
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP019611.1	1123683-1123714	0	1.0
CP019611_6	6.10\|1126398\|32\|CP019611\|CRT	1126398-1126429	32	CP019611.1	1123737-1123768	0	1.0
CP019611_11	11.8\|2003560\|16\|CP019611\|CRISPRCasFinder	2003560-2003575	16	CP019611.1	2875393-2875408	0	1.0
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	408541-408557	1	0.941
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	1631483-1631499	1	0.941
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	1980574-1980590	1	0.941
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	2004679-2004695	1	0.941
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	3213107-3213123	1	0.941
CP019611_5	5.2\|1119933\|17\|CP019611\|PILER-CR	1119933-1119949	17	CP019611.1	3586332-3586348	1	0.941
CP019611_10	10.2\|1754341\|56\|CP019611\|PILER-CR	1754341-1754396	56	CP019611.1	1754469-1754524	1	0.982
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1122023-1122041	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1465157-1465175	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2004658-2004676	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2008844-2008862	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2008916-2008934	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2417558-2417576	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2420411-2420429	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2776743-2776761	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2848430-2848448	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2848877-2848895	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2848976-2848994	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3583231-3583249	1	0.947
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3586759-3586777	1	0.947
CP019611_13	13.2\|2875159\|18\|CP019611\|CRT	2875159-2875176	18	CP019611.1	1188792-1188809	1	0.944
CP019611_13	13.2\|2875159\|18\|CP019611\|CRT	2875159-2875176	18	CP019611.1	1397720-1397737	1	0.944
CP019611_13	13.4\|2875249\|18\|CP019611\|CRT	2875249-2875266	18	CP019611.1	4230939-4230956	1	0.944
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	CP019611.1	303678-303712	2	0.943
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP019611.1	312668-312693	2	0.923
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP019611.1	313013-313038	2	0.923
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP019611.1	313358-313383	2	0.923
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP019611.1	313703-313728	2	0.923
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	CP019611.1	3833610-3833632	2	0.913
CP019611_7	7.5\|1154482\|42\|CP019611\|CRISPRCasFinder	1154482-1154523	42	CP019611.1	1162513-1162554	2	0.952
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	CP019611.1	1161328-1161360	2	0.939
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	CP019611.1	1465476-1465511	2	0.944
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	CP019611.1	2004976-2005011	2	0.944
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	CP019611.1	3213385-3213420	2	0.944
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	CP019611.1	3740824-3740845	2	0.909
CP019611_11	11.11\|2003698\|22\|CP019611\|CRISPRCasFinder	2003698-2003719	22	CP019611.1	1628464-1628485	2	0.909
CP019611_11	11.11\|2003698\|22\|CP019611\|CRISPRCasFinder	2003698-2003719	22	CP019611.1	2008871-2008892	2	0.909
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	72215-72233	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	106348-106366	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	106972-106990	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	107167-107185	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	107300-107318	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	169814-169832	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	169997-170015	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	170165-170183	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	301308-301326	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	303047-303065	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	303575-303593	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	312166-312184	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	403293-403311	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	465948-465966	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	466038-466056	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	466047-466065	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	466056-466074	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	935032-935050	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1120023-1120041	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1123130-1123148	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1123487-1123505	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1123538-1123556	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1123547-1123565	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1150766-1150784	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1231125-1231143	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1337185-1337203	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1414366-1414384	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1414588-1414606	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1464323-1464341	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1631066-1631084	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1881938-1881956	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1882586-1882604	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	1886639-1886657	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2004187-2004205	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2004577-2004595	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2004865-2004883	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2004883-2004901	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2009264-2009282	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2282152-2282170	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2405522-2405540	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2405975-2405993	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2423131-2423149	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2423140-2423158	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2643628-2643646	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2644156-2644174	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2776098-2776116	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2788356-2788374	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	2875588-2875606	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3096017-3096035	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3149533-3149551	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3209246-3209264	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3213315-3213333	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3350862-3350880	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3475979-3475997	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3576546-3576564	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3577128-3577146	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3833732-3833750	2	0.895
CP019611_11	11.13\|2003815\|19\|CP019611\|CRISPRCasFinder	2003815-2003833	19	CP019611.1	3833831-3833849	2	0.895
CP019611_2	2.5\|319474\|110\|CP019611\|CRT	319474-319583	110	CP019611.1	318718-318827	50	0.545

1. spacer 2.16|320527|35|CP019611|CRT matches to position: 318802-318836, mismatch: 0, identity: 1.0

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
agcagcggtgccggcggcaccaacggctccggcgg	Protospacer
***********************************

2. spacer 6.8|1126299|23|CP019611|CRT matches to position: 1123656-1123678, mismatch: 0, identity: 1.0

atgagcccgccggcgccgccgtt	CRISPR spacer
atgagcccgccggcgccgccgtt	Protospacer
***********************

3. spacer 6.9|1126344|32|CP019611|CRT matches to position: 1123683-1123714, mismatch: 0, identity: 1.0

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgccgttgacgccggccgcgccgga	Protospacer
********************************

4. spacer 6.10|1126398|32|CP019611|CRT matches to position: 1123737-1123768, mismatch: 0, identity: 1.0

attaaccagccgccgtccccgccattggcccc	CRISPR spacer
attaaccagccgccgtccccgccattggcccc	Protospacer
********************************

5. spacer 11.8|2003560|16|CP019611|CRISPRCasFinder matches to position: 2875393-2875408, mismatch: 0, identity: 1.0

gtggctgtacggcgac	CRISPR spacer
gtggctgtacggcgac	Protospacer
****************

6. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 408541-408557, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgccggcgccgccgtca	Protospacer
***.*************

7. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 1631483-1631499, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgccggcgccgccgtca	Protospacer
***.*************

8. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 1980574-1980590, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgccggcgccgccgtca	Protospacer
***.*************

9. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 2004679-2004695, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgctggcgccgccgcca	Protospacer
**************.**

10. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 3213107-3213123, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgccggcgccgccgtca	Protospacer
***.*************

11. spacer 5.2|1119933|17|CP019611|PILER-CR matches to position: 3586332-3586348, mismatch: 1, identity: 0.941

cgctggcgccgccgtca	CRISPR spacer
cgccggcgccgccgtca	Protospacer
***.*************

12. spacer 10.2|1754341|56|CP019611|PILER-CR matches to position: 1754469-1754524, mismatch: 1, identity: 0.982

agctgccgggaggggttcacccagcggcgcgggcaggtcgtttacggcaagttcca	CRISPR spacer
agctgccgggaggggttcacccagcggtgcgggcaggtcgtttacggcaagttcca	Protospacer
***************************.****************************

13. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1122023-1122041, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

14. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1465157-1465175, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggtggggccggtggc	Protospacer
******.************

15. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2004658-2004676, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

16. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2008844-2008862, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggaggc	Protospacer
*************** ***

17. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2008916-2008934, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

18. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2417558-2417576, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggtggc	Protospacer
********* *********

19. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2420411-2420429, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggaggc	Protospacer
*************** ***

20. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2776743-2776761, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

21. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2848430-2848448, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

22. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2848877-2848895, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

23. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2848976-2848994, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccggcggc	Protospacer
***************.***

24. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3583231-3583249, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgacggcggggccggtggc	Protospacer
** ****************

25. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3586759-3586777, mismatch: 1, identity: 0.947

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggcgggtggc	Protospacer
************ ******

26. spacer 13.2|2875159|18|CP019611|CRT matches to position: 1188792-1188809, mismatch: 1, identity: 0.944

gatcagcccgacggcgtt	CRISPR spacer
gatcagcccgtcggcgtt	Protospacer
********** *******

27. spacer 13.2|2875159|18|CP019611|CRT matches to position: 1397720-1397737, mismatch: 1, identity: 0.944

gatcagcccgacggcgtt	CRISPR spacer
gatcagcccgtcggcgtt	Protospacer
********** *******

28. spacer 13.4|2875249|18|CP019611|CRT matches to position: 4230939-4230956, mismatch: 1, identity: 0.944

gatcagcgtcccgccggt	CRISPR spacer
gatcagcgtcccgctggt	Protospacer
**************.***

29. spacer 2.16|320527|35|CP019611|CRT matches to position: 303678-303712, mismatch: 2, identity: 0.943

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
agcagcggtgccggcggcaccaacggctctggtgg	Protospacer
*****************************.**.**

30. spacer 2.27|321424|26|CP019611|CRT matches to position: 312668-312693, mismatch: 2, identity: 0.923

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaccggcgg	Protospacer
*******************. *****

31. spacer 2.27|321424|26|CP019611|CRT matches to position: 313013-313038, mismatch: 2, identity: 0.923

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaccggcgg	Protospacer
*******************. *****

32. spacer 2.27|321424|26|CP019611|CRT matches to position: 313358-313383, mismatch: 2, identity: 0.923

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaccggcgg	Protospacer
*******************. *****

33. spacer 2.27|321424|26|CP019611|CRT matches to position: 313703-313728, mismatch: 2, identity: 0.923

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaccggcgg	Protospacer
*******************. *****

34. spacer 6.8|1126299|23|CP019611|CRT matches to position: 3833610-3833632, mismatch: 2, identity: 0.913

atgagcccgccggcgccgccgtt	CRISPR spacer
atcagcccaccggcgccgccgtt	Protospacer
** *****.**************

35. spacer 7.5|1154482|42|CP019611|CRISPRCasFinder matches to position: 1162513-1162554, mismatch: 2, identity: 0.952

ccggtgcccgagttgaagaacccgatgtttccgctgccggag	CRISPR spacer
ccggtgcccgagttgaacaacccgacgtttccgctgccggag	Protospacer
***************** *******.****************

36. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to position: 1161328-1161360, mismatch: 2, identity: 0.939

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
aggctgccgaacccgatctggccgctgccggtg	Protospacer
********** *************.********

37. spacer 9.17|1716893|36|CP019611|CRT matches to position: 1465476-1465511, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatgggcaacggcggcaacggcggggccggcgg	Protospacer
****** ***********.*****************

38. spacer 9.17|1716893|36|CP019611|CRT matches to position: 2004976-2005011, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatcggcaacggcggccacggcggggccggcgg	Protospacer
******************. ****************

39. spacer 9.17|1716893|36|CP019611|CRT matches to position: 3213385-3213420, mismatch: 2, identity: 0.944

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gctgatcggcaacggcggcaacggcggtgccggcgg	Protospacer
******************.******** ********

40. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to position: 3740824-3740845, mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tggcgggggtgccggcggtgtc	Protospacer
** *** ***************

41. spacer 11.11|2003698|22|CP019611|CRISPRCasFinder matches to position: 1628464-1628485, mismatch: 2, identity: 0.909

gctgtggggcggcggtggtgcc	CRISPR spacer
gctgtggggcgccggtggggcc	Protospacer
*********** ****** ***

42. spacer 11.11|2003698|22|CP019611|CRISPRCasFinder matches to position: 2008871-2008892, mismatch: 2, identity: 0.909

gctgtggggcggcggtggtgcc	CRISPR spacer
gctgtggggcgtcggtggcgcc	Protospacer
*********** ******.***

43. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 72215-72233, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccgtcgggcccggtggc	Protospacer
***** **** ********

44. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 106348-106366, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

45. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 106972-106990, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgcaggtggc	Protospacer
********* ** ******

46. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 107167-107185, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggtgccggtggc	Protospacer
******.** *********

47. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 107300-107318, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgcggccggcggc	Protospacer
******** ******.***

48. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 169814-169832, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggggccggcggc	Protospacer
** ************.***

49. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 169997-170015, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

50. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 170165-170183, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

51. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 301308-301326, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccagcggggccggcggc	Protospacer
****.**********.***

52. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 303047-303065, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

53. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 303575-303593, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgcgggtggc	Protospacer
********* ** ******

54. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 312166-312184, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgggcacggtggc	Protospacer
**********  *******

55. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 403293-403311, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

56. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 465948-465966, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

57. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 466038-466056, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

58. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 466047-466065, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

59. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 466056-466074, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

60. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 935032-935050, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcggcggtggc	Protospacer
********* * *******

61. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1120023-1120041, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

62. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1123130-1123148, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

63. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1123487-1123505, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggctggcggc	Protospacer
************.**.***

64. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1123538-1123556, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

65. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1123547-1123565, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

66. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1150766-1150784, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccgtcggcgccggtggc	Protospacer
***** *** *********

67. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1231125-1231143, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cggcggcggggacggtggc	Protospacer
** ******** *******

68. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1337185-1337203, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggccgggccggtggc	Protospacer
** **** ***********

69. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1414366-1414384, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggcgccggtggc	Protospacer
** ****** *********

70. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1414588-1414606, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

71. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1464323-1464341, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

72. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1631066-1631084, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggcgggcggc	Protospacer
************ **.***

73. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1881938-1881956, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

74. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1882586-1882604, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggaggggccggcggc	Protospacer
****** ********.***

75. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 1886639-1886657, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

76. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2004187-2004205, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggggccggaggc	Protospacer
******.******** ***

77. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2004577-2004595, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cggcggcggggccggcggc	Protospacer
** ************.***

78. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2004865-2004883, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgacggcggcgccggtggc	Protospacer
** ****** *********

79. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2004883-2004901, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cggcggcggggccggcggc	Protospacer
** ************.***

80. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2009264-2009282, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

81. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2282152-2282170, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

82. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2405522-2405540, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

83. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2405975-2405993, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggagccggtggc	Protospacer
******.**.*********

84. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2423131-2423149, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggtggcgccggtggc	Protospacer
******.** *********

85. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2423140-2423158, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

86. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2643628-2643646, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

87. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2644156-2644174, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgctggcggggccggcggc	Protospacer
***.***********.***

88. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2776098-2776116, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

89. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2788356-2788374, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgtcggcggtgccggtggc	Protospacer
**.****** *********

90. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 2875588-2875606, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggggccggcggc	Protospacer
*** ***********.***

91. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3096017-3096035, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccgtcggc	Protospacer
************** .***

92. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3149533-3149551, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggccgccggc	Protospacer
************** .***

93. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3209246-3209264, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggggtcgatggc	Protospacer
***********.**.****

94. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3213315-3213333, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgcggccggcggc	Protospacer
******** ******.***

95. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3350862-3350880, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggcgccggtggc	Protospacer
*** ***** *********

96. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3475979-3475997, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggcgccggcggc	Protospacer
********* *****.***

97. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3576546-3576564, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcaggcggtgccggtggc	Protospacer
*** ***** *********

98. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3577128-3577146, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcgggaccggcggc	Protospacer
**********.****.***

99. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3833732-3833750, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgcgggcggggccggcggc	Protospacer
*** ***********.***

100. spacer 11.13|2003815|19|CP019611|CRISPRCasFinder matches to position: 3833831-3833849, mismatch: 2, identity: 0.895

cgccggcggggccggtggc	CRISPR spacer
cgccggcggtgccggcggc	Protospacer
********* *****.***

101. spacer 2.5|319474|110|CP019611|CRT matches to position: 318718-318827, mismatch: 50, identity: 0.545

gccggcgccgacgccgaccagcccggcgccaccggcggcaccgggttcgccggtggagcc	CRISPR spacer
gccggcgccgacgccgaccagcccggcgccaccggcggcaccgggttcgccggtggagcc	Protospacer
************************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	136890-136911	1	0.955
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1975819-1975840	1	0.955
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1109892-1109913	1	0.955
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP016457	Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence	87869-87890	1	0.955
CP019611_12	12.15\|2360055\|22\|CP019611\|CRISPRCasFinder	2360055-2360076	22	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	362668-362689	1	0.955
CP019611_12	12.15\|2360055\|22\|CP019611\|CRISPRCasFinder	2360055-2360076	22	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2289382-2289403	1	0.955
CP019611_12	12.15\|2360055\|22\|CP019611\|CRISPRCasFinder	2360055-2360076	22	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	81656-81677	1	0.955
CP019611_12	12.15\|2360055\|22\|CP019611\|CRISPRCasFinder	2360055-2360076	22	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	56160-56181	1	0.955
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_023695	Mycobacterium phage Violet, complete genome	29125-29150	2	0.923
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2294260-2294282	2	0.913
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	MN010758	Gordonia phage Dardanus, complete genome	17672-17694	2	0.913
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	1001256-1001278	2	0.913
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	297226-297248	2	0.913
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	794580-794601	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	75477-75498	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	713470-713491	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_021056	Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence	29437-29458	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	56975-56996	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	458462-458483	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1354617-1354638	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	881389-881410	2	0.909
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_047977	Microbacterium phage Hendrix, complete genome	3065-3086	2	0.909
CP019611_11	11.15\|2003899\|22\|CP019611\|CRISPRCasFinder	2003899-2003920	22	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	917429-917450	2	0.909
CP019611_12	12.2\|2359128\|22\|CP019611\|CRISPRCasFinder	2359128-2359149	22	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	881140-881161	2	0.909
CP019611_12	12.2\|2359128\|22\|CP019611\|CRISPRCasFinder	2359128-2359149	22	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	225972-225993	2	0.909
CP019611_12	12.2\|2359128\|22\|CP019611\|CRISPRCasFinder	2359128-2359149	22	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	451168-451189	2	0.909
CP019611_12	12.2\|2359128\|22\|CP019611\|CRISPRCasFinder	2359128-2359149	22	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	234992-235013	2	0.909
CP019611_12	12.2\|2359128\|22\|CP019611\|CRISPRCasFinder	2359128-2359149	22	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	597449-597470	2	0.909
CP019611_12	12.3\|2359182\|22\|CP019611\|CRISPRCasFinder	2359182-2359203	22	NZ_CP025510	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvD, complete sequence	117076-117097	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP021032	Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence	448838-448859	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	160471-160492	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	175264-175285	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	457593-457614	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	166709-166730	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	166709-166730	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	166709-166730	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	166709-166730	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	164465-164486	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	97458-97479	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP012698	Microbacterium sp. No. 7 plasmid A, complete sequence	53118-53139	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	100830-100851	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	307854-307875	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	23841-23862	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	279961-279982	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	359201-359222	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	606826-606847	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	411558-411579	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	300111-300132	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	483830-483851	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP024312	Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence	68146-68167	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	175112-175133	2	0.909
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	314082-314103	2	0.909
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	402883-402907	2	0.92
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	416172-416196	2	0.92
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	472935-472959	2	0.92
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	338431-338456	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP022541	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence	184795-184820	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP014276	Martelella sp. AD-3 plasmid unnamed1, complete sequence	27959-27984	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN585973	Mycobacterium phage StAnnes, complete genome	24900-24925	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MG944221	Mycobacterium phage Scowl, complete genome	29099-29124	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KT309034	Mycobacterium phage Dante, complete genome	24873-24898	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_021538	Mycobacterium phage Job42, complete genome	26541-26566	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_026584	Mycobacterium phage Minerva, complete genome	38752-38777	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KJ409696	Mycobacterium phage Lamina13, complete genome	28214-28239	3	0.885
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_028784	Mycobacterium phage Tasp14, complete genome	28838-28863	3	0.885
CP019611_4	4.11\|1119250\|27\|CP019611\|CRT	1119250-1119276	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5507414-5507440	3	0.889
CP019611_4	4.11\|1119250\|27\|CP019611\|CRT	1119250-1119276	27	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	756232-756258	3	0.889
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NZ_CP025550	Mycobacterium paragordonae strain 49061 plasmid unnamed4, complete sequence	12981-13003	3	0.87
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	MT740740	Ralstonia phage Gervaise, complete genome	7571-7593	3	0.87
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	986913-986935	3	0.87
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1018620-1018642	3	0.87
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	MT740732	Ralstonia phage Darius, complete genome	41819-41841	3	0.87
CP019611_6	6.8\|1126299\|23\|CP019611\|CRT	1126299-1126321	23	MH638294	Ralstonia phage GP4, complete genome	1905-1927	3	0.87
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4024254-4024277	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4460576-4460599	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP034768	Enterobacter sp. N18-03635 plasmid pFRI-6, complete sequence	122201-122224	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	37773-37796	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_AP019631	Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence	116652-116675	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_AP019631	Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence	72348-72371	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	KU716094	Mycobacterium phage Eidsmoe, complete genome	5649-5672	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MH371122	Mycobacterium phage Priya, complete genome	5650-5673	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MK016502	Mycobacterium phage Pat3, complete genome	22827-22850	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MK937593	Mycobacterium phage Flypotenuse, complete genome	23717-23740	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MG872835	Mycobacterium phage Conquerage, complete genome	5649-5672	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MH536820	Mycobacterium phage Glexan, complete genome	23717-23740	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	91001-91024	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	44795-44818	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1701753-1701776	3	0.875
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MH271298	Microbacterium phage Floof, complete genome	37939-37962	3	0.875
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	MN703413	Arthrobacter phage Powerpuff, complete genome	38834-38858	3	0.88
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	MT024871	Arthrobacter phage YesChef, complete genome	37693-37717	3	0.88
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	355111-355132	3	0.864
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP040721	Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence	58695-58716	3	0.864
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP040721	Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence	90623-90644	3	0.864
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1457966-1457987	3	0.864
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	422944-422965	3	0.864
CP019611_11	11.7\|2003515\|22\|CP019611\|CRISPRCasFinder	2003515-2003536	22	KT381864	Thiobacimonas phage vB_ThpS-P1, complete genome	3900-3921	3	0.864
CP019611_11	11.11\|2003698\|22\|CP019611\|CRISPRCasFinder	2003698-2003719	22	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	4076-4097	3	0.864
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	9264-9285	3	0.864
CP019611_12	12.4\|2359236\|22\|CP019611\|CRISPRCasFinder	2359236-2359257	22	NZ_CP021649	Acidovorax sp. T1 plasmid p1-T1, complete sequence	13233-13254	3	0.864
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	937294-937318	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1470762-1470786	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	MN586053	Arthrobacter phage BeatusComedenti, complete genome	26689-26713	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NC_031254	Arthrobacter phage Kitkat, complete genome	26809-26833	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NC_031231	Arthrobacter phage KellEzio, complete genome	26691-26715	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	633177-633201	3	0.88
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	74124-74148	3	0.88
CP019611_12	12.15\|2360055\|22\|CP019611\|CRISPRCasFinder	2360055-2360076	22	NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	380879-380900	3	0.864
CP019611_13	13.5\|2875288\|24\|CP019611\|CRT	2875288-2875311	24	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1555522-1555545	3	0.875
CP019611_13	13.5\|2875288\|24\|CP019611\|CRT	2875288-2875311	24	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1560190-1560213	3	0.875
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013224	Salmonella enterica subsp. enterica serovar Anatum strain GT-38 plasmid PDM04, complete sequence	31668-31693	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KX470734	Escherichia coli strain Ecoli14-55 plasmid pEC55-NDM4, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KY296103	Enterobacter cloacae strain 13E169 plasmid pHN84NDM, complete sequence	2266-2291	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KY978629	Cronobacter sakazakii strain 505108 plasmid p505108-NDM, complete sequence	13374-13399	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF072961	Citrobacter freundii strain P10159 plasmid pP10159-1, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042356	Enterobacter cloacae strain 20ES plasmid pNDM_20ES, complete sequence	34140-34165	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042359	Serratia marcescens strain 7209 plasmid pNDM_7209, complete sequence	21406-21431	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KU726616	Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence	24123-24148	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KU314941	Klebsiella pneumoniae isolate KP04 plasmid pKP04NDM, complete sequence	13271-13296	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KX094555	Escherichia coli strain ZHDC33 plasmid pZHDC33, complete sequence	47455-47480	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	32263-32288	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KR059864	Klebsiella pneumoniae strain KP-YQ13450 plasmid pYQ12450, complete sequence	2286-2311	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KP987216	Citrobacter freundii strain 112298 plasmid p112298-NDM, complete sequence	12726-12751	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP022126	Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence	136378-136403	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	3544-3569	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	179432-179457	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	188444-188469	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP028588	Escherichia coli strain WCHEC4533 plasmid pNDM4_000533, complete sequence	33846-33871	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041930	Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374C, complete sequence	29605-29630	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP048296	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence	87780-87805	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP028560	Acinetobacter sp. WCHA45 plasmid pNDM1_010045, complete sequence	52815-52840	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_018994	Escherichia coli plasmid pNDM-1_Dok01, complete sequence	135270-135295	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	68922-68947	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019153	Klebsiella pneumoniae plasmid pNDM-KN, complete sequence	103553-103578	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019162	Klebsiella pneumoniae strain CRE380 plasmid pNDM-HN380, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032878	Escherichia coli strain WCHEC000837 plasmid pNDM4_000837, complete sequence	33327-33352	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP018817	Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence	42648-42673	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	495552-495577	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	551870-551895	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1292791-1292816	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	310424-310449	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041642	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-NDM4, complete sequence	56767-56792	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP048828	Acinetobacter baumannii strain ABF9692 plasmid pABF9692, complete sequence	197048-197073	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021206	Escherichia coli strain Z1002 plasmid p1002-NDM1, complete sequence	7496-7521	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP050416	Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence	53320-53345	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032284	Acinetobacter sp. WCHA55 plasmid pNDM1_010055, complete sequence	50298-50323	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_020811	Klebsiella pneumoniae strain KPN5047 plasmid pKPN5047, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP030191	Salmonella enterica strain SA20104250 plasmid pSA20104250.1, complete sequence	10321-10346	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP050426	Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence	53320-53345	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_023914	Enterobacter cloacae strain CRE727 plasmid pNDM-HF727, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP044035	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed1, complete sequence	12359-12384	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP029118	Escherichia coli strain AR435 plasmid unnamed5, complete sequence	105092-105117	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019123	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH1148_107, complete sequence	14493-14518	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	248919-248944	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN178638	Kluyvera cryocrescens strain SCW13 plasmid pNDM1_SCW13, complete sequence	13049-13074	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP038280	Raoultella ornithinolytica strain WLK218 plasmid pWLK-NDM, complete sequence	29501-29526	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	163996-164021	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP050158	Enterobacter cloacae plasmid Carbapenemase(NDM-1)_IncX3, complete sequence	23151-23176	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	47983-48008	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP050161	Escherichia coli plasmid Carbapenemase(NDM-1)_IncX3, complete sequence	51656-51681	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	226890-226915	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_021501	Klebsiella michiganensis E718 plasmid pKOX_NDM1, complete sequence	34134-34159	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP017672	Providencia rettgeri strain RB151 plasmid pRB151-NDM, complete sequence	49428-49453	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP023914	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed3, complete sequence	80289-80314	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP029386	Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pNDM6_040074, complete sequence	24220-24245	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	65696-65721	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP022226	Escherichia coli strain WCHEC96200 plasmid pNDM4_WCHEC96200, complete sequence	33319-33344	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	168895-168920	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	105230-105255	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	299551-299576	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_020552	Citrobacter freundii plasmid pYE315203, complete sequence	13275-13300	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP040598	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15_NDM-1, complete sequence	87825-87850	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP014297	Klebsiella pneumoniae strain KP38731 plasmid unnamed13 sequence	47173-47198	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	651243-651268	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020056	Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence	35229-35254	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP031884	Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence	53720-53745	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	111083-111108	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	217269-217294	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP031297	Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence	122282-122307	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041229	Acinetobacter haemolyticus strain AN54 plasmid pAhaeAN54e, complete sequence	39040-39065	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_LT985293	Escherichia coli strain 4410-1 plasmid RCS79_p, complete sequence	17773-17798	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_LT985268	Escherichia coli strain 699 plasmid RCS58_p, complete sequence	20078-20103	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN604267	Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence	208327-208352	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK372385	Morganella morganii strain ABC140 plasmid pABC140-NDM-1, complete sequence	12840-12865	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK372381	Klebsiella pneumoniae strain ABC52 plasmid pABC52-NDM-1, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053899	Proteus mirabilis strain YPM35 plasmid pJPM35-1, complete sequence	127861-127886	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657249	Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence	116167-116192	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657250	Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence	116203-116228	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909333	Klebsiella pneumoniae strain 7-SP plasmid p7SP-NDM, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909346	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-NDM, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909335	Klebsiella pneumoniae strain 11-SP plasmid p11SP-NDM, complete sequence	13271-13296	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH234505	Escherichia coli strain CRE3694 plasmid pNDM-HK3694, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH917282	Klebsiella pneumoniae strain A457 plasmid pA457-NDA, complete sequence	13269-13294	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH349095	Escherichia coli strain 948 plasmid pMTC948, complete sequence	2266-2291	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK372386	Klebsiella pneumoniae strain BC700 plasmid pBC700-NDM-1, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK372380	Enterobacter cloacae strain ABC40 plasmid pABC40-NDM-1, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK372382	Escherichia coli strain ABC54 plasmid pABC54-NDM-1, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657241	Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence	137520-137545	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657242	Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence	49557-49582	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657243	Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence	109132-109157	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657244	Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence	76292-76317	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657247	Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence	55946-55971	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MG462728	Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence	107928-107953	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH457126	Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence	118250-118275	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH105052	Escherichia coli strain EC600 plasmid pSL131T_IncX3, complete sequence	11302-11327	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP044464	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-1, complete sequence	94334-94359	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042350	Klebsiella pneumoniae strain 18ES plasmid pNDM_18ES, complete sequence	33810-33835	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042354	Klebsiella pneumoniae strain 6TM plasmid pNDM_6TM, complete sequence	34092-34117	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042353	Klebsiella pneumoniae strain 1TM plasmid pNDM_1TM, complete sequence	33557-33582	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042351	Serratia marcescens strain 12TM plasmid pNDM_12TM, complete sequence	33543-33568	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042358	Enterobacter cloacae strain 22ES plasmid pNDM_22ES, complete sequence	23756-23781	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF415608	Enterobacter cloacae strain hhy03 plasmid pNDM-BJ03, complete sequence	13272-13297	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042352	Serratia marcescens strain 4TM plasmid pNDM_4TM, complete sequence	33557-33582	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF042357	Serratia marcescens strain 9580 plasmid pNDM_9580, complete sequence	28922-28947	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MG252893	Raoultella ornithinolytica strain pRor-30818cz plasmid Ror-30818cz, complete sequence	46124-46149	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041048	Citrobacter sp. CF971 plasmid pBM527-2, complete sequence	23671-23696	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KX832927	Providencia rettgeri strain 16pre36 plasmid p16Pre36-NDM, complete sequence	78775-78800	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KX786648	Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence	116362-116387	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KY399975	Enterobacter cloacae strain EClY2403 plasmid pNDM1_EClY2403, complete sequence	106588-106613	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KY399974	Enterobacter cloacae strain EClY2402 plasmid pNDM1_EClY2402, complete sequence	106624-106649	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053895	Proteus mirabilis strain JPM24 plasmid pJPM24, complete sequence	61495-61520	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP023051	Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence	125781-125806	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP034756	Enterobacter hormaechei subsp. hoffmannii strain Eh1 plasmid p2, complete sequence	86197-86222	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KX636095	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence	7182-7207	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	61266-61291	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	61266-61291	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KJ588779	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence	113434-113459	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KR351290	Klebsiella pneumoniae subsp. pneumoniae strain K351 plasmid pK351, complete sequence	102254-102279	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KJ802405	Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence	122601-122626	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KJ812998	Enterobacter cloacae isolate GN574 plasmid pNDM-Ec1GN574, complete sequence	106279-106304	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KP900016	Leclercia adecarboxylata strain P10164 plasmid pP10164-NDM, complete sequence	16155-16180	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KP765744	Enterobacter cloacae strain ECN49 plasmid pNDM-ECN49, complete sequence	51111-51136	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KP868647	Enterobacter cloacae strain WCHECl-14653 plasmid pNDM1_EC14653, complete sequence	106616-106641	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KJ802404	Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence	122581-122606	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KT965092	Acinetobacter towneri strain G165 plasmid pNDM-GJ01, complete sequence	19595-19620	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KT965093	Acinetobacter towneri strain G295 plasmid pNDM-GJ02, complete sequence	10571-10596	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053729	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence	70397-70422	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_023322	Acinetobacter bereziniae strain CHI-40-1 plasmid pNDM-40-1, complete sequence	12854-12879	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP029731	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed3, complete sequence	103665-103690	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053737	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence	7088-7113	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KC887916	Escherichia coli strain ARL10/167 isolate EC4 plasmid pEC4-NDM-6, complete sequence	106279-106304	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_KC887917	Enterobacter cloacae isolate ECL3 plasmid pECL3-NDM-1, complete sequence	16381-16406	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020524	Escherichia coli strain 190 plasmid unnamed1, complete sequence	57698-57723	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MT077883	Escherichia coli plasmid p23, complete sequence	17925-17950	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_009838	Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence	100659-100684	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010370	Acinetobacter nosocomialis strain 6411 plasmid p6411-9.012kb, complete sequence	21772-21797	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013221	Salmonella enterica subsp. enterica serovar Anatum strain GT-01 plasmid PDM02, complete sequence	80484-80509	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP024285	Escherichia albertii strain 2014C-4356 plasmid unnamed3, complete sequence	63442-63467	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN061454	Enterobacter cloacae strain EC-14-60 plasmid pECL-14-60-NDM-1, complete sequence	15892-15917	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032278	Acinetobacter sp. WCHAc010034 plasmid pNDM1_010034, complete sequence	32490-32515	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP045561	Acinetobacter nosocomialis strain AC1530 plasmid pAC1530, complete sequence	76077-76102	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019045	Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence	122942-122967	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_025130	Raoultella planticola strain RJA274 plasmid NDM-1, complete sequence	47557-47582	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019158	Klebsiella pneumoniae plasmid pNDM10469, complete sequence	113657-113682	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN310375	Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence	107122-107147	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN310377	Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence	64967-64992	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	13112-13137	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	68888-68913	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP037965	Klebsiella pneumoniae strain SCKP020135 plasmid pNDM1_020135, complete sequence	32643-32668	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_025184	Klebsiella pneumoniae strain RJF866 plasmid pRJF866, complete sequence	76626-76651	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP011518	Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence	469282-469307	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	44666-44691	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021962	Klebsiella pneumoniae strain AR_0139 plasmid tig00000008, complete sequence	109287-109312	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP022350	Klebsiella michiganensis strain K516 plasmid pK516_NDM1, complete sequence	44828-44853	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP046274	Enterobacter hormaechei strain E70 plasmid pE70-NDM1, complete sequence	34563-34588	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP039811	Klebsiella pneumoniae strain C2660 plasmid pC2660-4-NDM, complete sequence	25490-25515	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	190887-190912	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	452131-452156	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_025000	Acinetobacter lwoffii strain Iz4b plasmid pNDM-Iz4b, complete sequence	14410-14435	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_024959	Acinetobacter calcoaceticus strain NDM-WS2 plasmid pNDM-WS2, complete sequence	13847-13872	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	130143-130168	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	148534-148559	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021536	Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence	31201-31226	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010399	Acinetobacter baumannii strain 6200 plasmid p6200-47.274kb, complete sequence	4577-4602	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP035935	Acinetobacter cumulans strain WCHAc060092 plasmid pNDM1_060092, complete sequence	39093-39118	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP006661	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence	127533-127558	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1809834-1809859	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_012690	Escherichia coli plasmid peH4H, complete sequence	95724-95749	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP050164	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	112308-112333	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MK933278	Enterobacter hormaechei strain SCNJ07 plasmid pNDM-SCNJ07, complete sequence	76626-76651	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	142738-142763	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	865255-865280	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP048298	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-1, complete sequence	86450-86475	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019066	Escherichia coli plasmid pAPEC1990_61, complete sequence	114749-114774	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019069	Escherichia coli plasmid pNDM10505, complete sequence	123719-123744	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	AMXH01000087	Acinetobacter pittii strain XM1570 plasmid pXM1, complete sequence, whole genome shotgun sequence	14410-14435	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_JQ739158	Acinetobacter lwoffii strain ABZ78 plasmid pABZ78, complete sequence	4498-4523	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP043383	Enterobacter hormaechei subsp. xiangfangensis strain WCHEX045001 plasmid pNDM1_045001, complete sequence	15206-15231	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019985	Acinetobacter baumannii ZW85-1 plasmid pAbNDM-1, complete sequence	14410-14435	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	79690-79715	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP018366	Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-2, complete sequence	72161-72186	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP023187	Klebsiella michiganensis strain K518 plasmid pK518_NDM1, complete sequence	83389-83414	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_021813	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_01, complete sequence	86573-86598	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP028786	Klebsiella pneumoniae strain SCKP020049 plasmid pNDM1_020049, complete sequence	16816-16841	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021936	Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence	63971-63996	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	13112-13137	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP023948	Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence	191374-191399	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041938	Klebsiella pneumoniae strain KP14003 plasmid pNDM-KP14003, complete sequence	29965-29990	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_022589	Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence	69941-69966	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	120199-120224	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP015835	Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence	112278-112303	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	39160-39185	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP014478	Acinetobacter pittii strain AP_882 plasmid pNDM-AP_882, complete sequence	75133-75158	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_023908	Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence	113391-113416	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	44921-44946	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019268	Acinetobacter lwoffii plasmid pNDM-BJ01, complete sequence	14410-14435	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_019281	Acinetobacter lwoffii plasmid pNDM-BJ02, complete sequence	14410-14435	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_025116	Acinetobacter sp. M131 plasmid pM131_NDM1, complete sequence	23011-23036	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP040884	Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence	92179-92204	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP026015	Klebsiella variicola strain 13450 plasmid p13450-3, complete sequence	53096-53121	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP018143	Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence	138569-138594	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	625395-625420	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP048797	Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence	112268-112293	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN937240	Enterobacter cloacae strain BSI034 plasmid pBSI034-NDM1, complete sequence	32345-32370	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP037904	Escherichia coli strain LHM10-1 plasmid unnamed1, complete sequence	31973-31998	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN603981	Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence	111617-111642	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN604268	Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence	25310-25335	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_LN833432	Acinetobacter baumannii isolate CHI-32 plasmid pNDM-32, complete sequence	52028-52053	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK123268	Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence	114850-114875	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP053897	Providencia rettgeri strain YPR31 plasmid pYPR31, complete sequence	64737-64762	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032132	Acinetobacter chinensis strain WCHAc010005 plasmid pNDM1_010005, complete sequence	26235-26260	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH995508	Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence	114851-114876	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH995506	Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence	114851-114876	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH917283	Klebsiella pneumoniae strain A575 plasmid pA575-NDM, complete sequence	48496-48521	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909345	Klebsiella pneumoniae strain N201205880 plasmid p205880-NDM, complete sequence	27419-27444	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH105050	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence	214658-214683	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909343	Klebsiella pneumoniae strain 1012018 plasmid p12018-NDM, complete sequence	47650-47675	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH909347	Klebsiella pneumoniae strain 362713 plasmid p362713-NDM, complete sequence	45514-45539	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH263652	Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence	109517-109542	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MH917281	Klebsiella pneumoniae strain 14504 plasmid p14504-NDM, complete sequence	30628-30653	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK101346	Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence	104044-104069	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MK757441	Alcaligenes faecalis strain AN70 plasmid pAN70-1, complete sequence	49778-49803	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP020090	Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-1, complete sequence	36147-36172	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657245	Enterobacteriaceae bacterium strain 23-16 plasmid pEC6332-T6, complete sequence	20014-20039	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN657246	Enterobacteriaceae bacterium strain 23-17 plasmid pEC6332-T7, complete sequence	25006-25031	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MF344560	Enterobacter hormaechei strain 128379 plasmid p128379-NDM, complete sequence	51238-51263	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MG462729	Escherichia coli strain AMA1742 plasmid pAMA1742, complete sequence	106280-106305	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP035537	Klebsiella pneumoniae subsp. pneumoniae strain CCRI-22199 plasmid pKp199-2, complete sequence	103993-104018	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	229930-229955	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	229961-229986	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	255319-255344	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MH001451	Mycobacterium phage Nairb, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MK994522	Methanobacterium virus PhiF1, complete genome	30764-30789	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MF155936	Mycobacterium phage ZenTime222, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MK494089	Mycobacterium phage Ibrahim, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_024135	Mycobacterium phage Bernal13, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KM591905	Mycobacterium phage RonRayGun, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN735432	Mycobacteriophage Whitty, complete genome	13342-13367	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	39713-39738	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	809205-809230	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	422918-422943	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	339366-339391	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1118329-1118354	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	369099-369124	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP046705	Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence	292867-292892	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	928968-928993	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP011481	Hoeflea sp. IMCC20628 plasmid, complete sequence	91925-91950	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP023072	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence	181402-181427	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	530728-530753	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	187984-188009	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	1018659-1018684	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2133261-2133286	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	JN698993	Mycobacterium phage Firecracker, complete genome	29207-29232	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN694268	Marine virus AFVG_250M110, complete genome	12879-12904	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN694268	Marine virus AFVG_250M110, complete genome	12888-12913	4	0.846
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN694268	Marine virus AFVG_250M110, complete genome	12897-12922	4	0.846
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	166457-166485	4	0.862
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	445002-445030	4	0.862
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	444985-445013	4	0.862
CP019611_7	7.1\|1154227\|27\|CP019611\|CRISPRCasFinder	1154227-1154253	27	NC_023591	Mycobacterium phage Adler, complete genome	61249-61275	4	0.852
CP019611_7	7.1\|1154227\|27\|CP019611\|CRISPRCasFinder	1154227-1154253	27	KF981876	UNVERIFIED: Mycobacterium phage ADLER F1725, complete genome	61247-61273	4	0.852
CP019611_7	7.7\|1154623\|27\|CP019611\|CRISPRCasFinder	1154623-1154649	27	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	10066-10092	4	0.852
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	460464-460490	4	0.852
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NC_016652	Rhodococcus phage REQ2, complete genome	36035-36061	4	0.852
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	KY945355	Mycobacterium phage Shandong1, complete genome	25634-25660	4	0.852
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	106725-106751	4	0.852
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NC_041888	Mycobacterium phage Tortellini, complete genome	37216-37242	4	0.852
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1096460-1096489	4	0.867
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1898211-1898234	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	261506-261529	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	673134-673157	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP016822	Rhodococcus sp. p52 plasmid pDF03, complete sequence	60076-60099	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MN582086	Siphoviridae sp. ctdEk19, complete genome	33324-33347	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	21980-22003	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MT889380	Mycobacterium phage Coco12, complete genome	22623-22646	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NC_023698	Mycobacterium phage Avani, complete genome	21987-22010	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MT114167	Mycobacterium phage Phanphagia, complete genome	22278-22301	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	558871-558894	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1500559-1500582	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	295932-295955	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	1116335-1116358	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MN096355	Mycobacterium phage Purky, complete genome	48975-48998	4	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	MK279853	Gordonia phage Gray, complete genome	68404-68427	4	0.833
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	9745-9769	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1906386-1906410	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	794756-794780	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	CP003956	Rhodococcus opacus PD630 plasmid 7, complete sequence	34847-34871	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1665271-1665295	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NC_012723	Burkholderia glumae BGR1 plasmid bglu_1p, complete sequence	15832-15856	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	348896-348920	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	406425-406449	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	26065-26089	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	450297-450321	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NC_022437	Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence	16147-16171	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1382131-1382155	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1418915-1418939	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP051294	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence	118938-118962	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1711697-1711721	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	722328-722352	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	67000-67024	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP033363	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence	118938-118962	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1149411-1149435	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	438623-438647	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP014580	Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence	243636-243660	4	0.84
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1410063-1410087	4	0.84
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	818773-818800	4	0.857
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	420542-420569	4	0.857
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	77799-77826	4	0.857
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP021372	Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence	176640-176664	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	29428-29452	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	38191-38215	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	MT553342	Microbacterium phage Kelcole, complete genome	51573-51597	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NC_048068	Microbacterium phage OneinaGillian, complete genome	50894-50918	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	MT310894	Microbacterium phage Tempo, complete genome	51697-51721	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	42080-42104	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	67777-67801	4	0.84
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	MN034284	Leviviridae sp. isolate H2_Rhizo_Litter_49_scaffold_25938 sequence	624-648	4	0.84
CP019611_12	12.14\|2359998\|25\|CP019611\|CRISPRCasFinder	2359998-2360022	25	MN582064	Podoviridae sp. ctka020, complete genome	29274-29298	4	0.84
CP019611_13	13.5\|2875288\|24\|CP019611\|CRT	2875288-2875311	24	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	680430-680453	4	0.833
CP019611_13	13.5\|2875288\|24\|CP019611\|CRT	2875288-2875311	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5913119-5913142	4	0.833
CP019611_13	13.5\|2875288\|24\|CP019611\|CRT	2875288-2875311	24	NZ_CP015007	Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence	143186-143209	4	0.833
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NC_010850	Rhodococcus sp. NS1 plasmid pNSL1, complete sequence	92901-92931	5	0.839
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	56815-56846	5	0.844
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP054842	Acidovorax sp. 16-35-5 plasmid unnamed2, complete sequence	107094-107128	5	0.857
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	56815-56846	5	0.844
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	246478-246503	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	CP047389	Agrobacterium sp. CGMCC 11546 plasmid pA	17058-17083	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010957	Sphingobium sp. YBL2 plasmid 3pYBL2-3, complete sequence	302850-302875	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_007713	Sodalis glossinidius str. 'morsitans' plasmid pSG1, complete sequence	40332-40357	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_014840	Pantoea sp. At-9b plasmid pPAT9B03, complete sequence	185222-185247	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	273411-273436	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1105172-1105197	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_LN854558	Sodalis glossinidius str. 'morsitans' isolate B4 plasmid pSG1, complete sequence	47773-47798	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	107625-107650	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1814495-1814520	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	534058-534083	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_007182	Sodalis glossinidius pSG1 plasmid from Glossina austeni	10951-10976	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_007183	Sodalis glossinidius pSG1 plasmid from Glossina palpalis palpalis	10951-10976	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	132825-132850	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_AP022338	Mameliella alba strain KU6B plasmid pKUB257, complete sequence	78756-78781	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	382698-382723	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_042098	Erwinia phage vB_EamM_Desertfox, complete genome	125763-125788	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MG655267	Erwinia phage vB_EamM_Bosolaphorus, complete genome	125662-125687	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MG655269	Erwinia phage vB_EamM_MadMel, complete genome	125987-126012	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KF806589	Erwinia phage Ea35-70, complete genome	124060-124085	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KU886223	Erwinia phage vB_EamM_Simmy50, complete genome	124357-124382	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	261363-261388	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	508038-508063	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	258385-258410	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	413351-413376	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	97021-97046	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP010860	Marinovum algicola DG 898 plasmid pMaD5, complete sequence	5769-5794	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	595763-595788	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	AY129335	Mycobacterium virus Corndog, complete genome	30054-30079	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_004685	Mycobacterium phage Corndog, complete genome	30054-30079	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MG099943	Mycobacterium phage Familton, complete genome	28996-29021	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN585964	Mycobacterium phage Blessica, complete genome	29303-29328	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	KJ829260	Mycobacterium phage YungJamal, complete genome	29902-29927	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_022057	Mycobacterium phage Catdawg, complete genome	28992-29017	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	MN428052	Mycobacterium phage Smooch, complete genome	30725-30750	5	0.808
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_048047	Caulobacter phage CcrBL9, complete genome	102705-102730	5	0.808
CP019611_4	4.2\|1118770\|27\|CP019611\|CRT	1118770-1118796	27	MN103533	Mycobacterium phage Weirdo19, complete genome	26901-26927	5	0.815
CP019611_4	4.11\|1119250\|27\|CP019611\|CRT	1119250-1119276	27	MK415400	Phage apr34_1784, complete genome	5470-5496	5	0.815
CP019611_4	4.11\|1119250\|27\|CP019611\|CRT	1119250-1119276	27	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	161455-161481	5	0.815
CP019611_4	4.11\|1119250\|27\|CP019611\|CRT	1119250-1119276	27	NC_011987	Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence	35634-35660	5	0.815
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	201261-201290	5	0.833
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	195-224	5	0.833
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	519541-519570	5	0.833
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	734-763	5	0.833
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	295647-295676	5	0.833
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	416946-416975	5	0.833
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NZ_KM017071	Sphingomonas sp. JE1 plasmid pJE1, complete sequence	25406-25434	5	0.828
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1238001-1238032	5	0.844
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1242682-1242713	5	0.844
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	214915-214946	5	0.844
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	206654-206685	5	0.844
CP019611_7	7.1\|1154227\|27\|CP019611\|CRISPRCasFinder	1154227-1154253	27	LR794124	Vibrio phage vB_Vc_SrVc9 genome assembly, chromosome: 1	34861-34887	5	0.815
CP019611_7	7.1\|1154227\|27\|CP019611\|CRISPRCasFinder	1154227-1154253	27	NC_012662	Vibrio phage VP93, complete genome	35301-35327	5	0.815
CP019611_7	7.7\|1154623\|27\|CP019611\|CRISPRCasFinder	1154623-1154649	27	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	2189-2215	5	0.815
CP019611_7	7.7\|1154623\|27\|CP019611\|CRISPRCasFinder	1154623-1154649	27	MN693945	Marine virus AFVG_250M952, complete genome	34909-34935	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	369429-369455	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	338832-338858	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	363377-363403	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP015368	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p1, complete sequence	104717-104743	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	338543-338569	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	340811-340837	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	342690-342716	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	343060-343086	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	355714-355740	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	343060-343086	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	348335-348361	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	343052-343078	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP020444	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence	69464-69490	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	363377-363403	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	355714-355740	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	342690-342716	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP044078	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence	10340-10366	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP031081	Paracoccus yeei strain CCUG 32053 plasmid pYEE3, complete sequence	19365-19391	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MN586031	Gordonia phage Gambino, complete genome	3053-3079	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	KU998236	Gordonia phage Blueberry, complete genome	3053-3079	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MN062704	Gordonia phage JuJu, complete genome	3063-3089	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MK501729	Gordonia phage Walrus, complete genome	3053-3079	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NC_031226	Gordonia phage BaxterFox, complete genome	2982-3008	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MK967393	Rhodococcus phage Whack, complete genome	3063-3089	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MT723935	Gordonia phage Azula, complete genome	3053-3079	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	KU963249	Gordonia phage Yeezy, complete genome	2982-3008	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MH153808	Gordonia phage Petra, complete genome	3053-3079	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MT639650	Gordonia phage Ohgeesy, complete genome	2982-3008	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MH536818	Gordonia phage Frokostdame, complete genome	3055-3081	5	0.815
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	KX557275	Gordonia phage CarolAnn, complete genome	3052-3078	5	0.815
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	KX683875	Mycobacterium phage Baehexic, complete genome	12181-12207	5	0.815
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	KM197169	Mycobacterium phage Piro94, complete genome	12178-12204	5	0.815
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MF668269	Mycobacterium phage Drake55, complete genome	12177-12203	5	0.815
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MK284522	Mycobacterium phage Malec, complete genome	11950-11976	5	0.815
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	KM677210	Mycobacterium phage Larenn, complete genome	11945-11971	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	1800-1826	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	136919-136945	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	658056-658082	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1514868-1514894	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5852040-5852066	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP049908	Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence	235006-235032	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_CP049700	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence	263243-263269	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	MH576962	Streptomyces phage Satis, complete genome	95306-95332	5	0.815
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	MK620894	Streptomyces phage Kradal, complete genome	95310-95336	5	0.815
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1068923-1068952	5	0.833
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1739900-1739929	5	0.833
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	233389-233418	5	0.833
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP031193	Humibacter sp. BT305 plasmid unnamed1	44938-44967	5	0.833
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	137673-137702	5	0.833
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	984252-984281	5	0.833
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1598936-1598965	5	0.833
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	233398-233427	5	0.833
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP046705	Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence	292905-292934	5	0.833
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	AY950802	Haloarcula phage SH1, complete genome	16104-16133	5	0.833
CP019611_9	9.16\|1716851\|24\|CP019611\|CRT	1716851-1716874	24	NC_006911	Streptomyces sp. F11 plasmid pFP11, complete sequence	11649-11672	5	0.792
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MG925349	Mycobacterium phage Mendokysei, complete genome	21052-21085	5	0.853
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3841167-3841191	5	0.8
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NC_015178	Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence	157500-157524	5	0.8
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	179155-179179	5	0.8
CP019611_11	11.4\|2003335\|25\|CP019611\|CRISPRCasFinder	2003335-2003359	25	NC_009469	Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence	67026-67050	5	0.8
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_LN907828	Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence	94483-94510	5	0.821
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	KU728633	Mycobacterium phage Bipper, complete genome	41992-42019	5	0.821
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	MK977701	Mycobacterium phage Cracklewink, complete genome	41985-42012	5	0.821
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	100320-100347	5	0.821
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	614111-614135	5	0.8
CP019611_12	12.5\|2359290\|25\|CP019611\|CRISPRCasFinder	2359290-2359314	25	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	92705-92729	5	0.8
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_018746	Pseudomonas putida ND6 plasmid pND6-2, complete sequence	45440-45470	5	0.839
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	MN961671	Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence	123562-123592	5	0.839
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	MN961672	Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence	72551-72581	5	0.839
CP019611_12	12.13\|2359932\|34\|CP019611\|CRISPRCasFinder	2359932-2359965	34	NC_006362	Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence	89410-89443	5	0.853
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NC_009478	Clavibacter michiganensis subsp. michiganensis NCPPB 382 plasmid pCM1, complete sequence	8328-8358	6	0.806
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	258107-258138	6	0.812
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	258107-258138	6	0.812
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NC_008271	Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence	99581-99606	6	0.769
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	262599-262624	6	0.769
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	328914-328939	6	0.769
CP019611_2	2.27\|321424\|26\|CP019611\|CRT	321424-321449	26	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	328917-328942	6	0.769
CP019611_4	4.3\|1118815\|30\|CP019611\|CRT	1118815-1118844	30	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	57659-57688	6	0.8
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	586980-587009	6	0.8
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	453093-453122	6	0.8
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	236156-236185	6	0.8
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1247285-1247316	6	0.812
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	449570-449601	6	0.812
CP019611_7	7.1\|1154227\|27\|CP019611\|CRISPRCasFinder	1154227-1154253	27	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	207335-207361	6	0.778
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	435770-435802	6	0.818
CP019611_7	7.7\|1154623\|27\|CP019611\|CRISPRCasFinder	1154623-1154649	27	NZ_CP022542	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence	32942-32968	6	0.778
CP019611_7	7.9\|1154773\|27\|CP019611\|CRISPRCasFinder	1154773-1154799	27	NC_009959	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence	50750-50776	6	0.778
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	179708-179734	6	0.778
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4846911-4846937	6	0.778
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	78863-78889	6	0.778
CP019611_7	7.10\|1154833\|27\|CP019611\|CRISPRCasFinder	1154833-1154859	27	MK494099	Mycobacterium phage Typha, complete genome	33831-33857	6	0.778
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	GQ141189	Bifidobacterium phage Bbif-1, complete sequence	38062-38092	6	0.806
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	658647-658673	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	NC_023606	Mycobacterium phage CRB1, complete genome	11649-11675	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MK524491	Mycobacterium phage Whabigail7, complete genome	12139-12165	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	KX619650	Mycobacterium phage Jerm, complete genome	12089-12115	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MN585998	Mycobacterium phage Bugsy, complete genome	12128-12154	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	JN408460	Mycobacterium phage Turbido, complete genome	12151-12177	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MH077576	Mycobacterium phage AbbyPaige, complete genome	12129-12155	6	0.778
CP019611_9	9.5\|1716356\|27\|CP019611\|CRT	1716356-1716382	27	MH825704	Mycobacterium phage LilTurb, complete genome	12148-12174	6	0.778
CP019611_9	9.10\|1716566\|27\|CP019611\|CRT	1716566-1716592	27	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	147990-148016	6	0.778
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	508-537	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	280809-280838	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	561652-561681	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	554428-554457	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	542116-542145	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	610786-610815	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	571170-571199	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1563589-1563618	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	421135-421164	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1217050-1217079	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1265979-1266008	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1135414-1135443	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP037868	Hydrogenophaga pseudoflava strain DSM 1084 plasmid pDSM1084, complete sequence	5790-5819	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1195134-1195163	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1134511-1134540	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	762260-762289	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1168711-1168740	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1168700-1168729	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1135406-1135435	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1134762-1134791	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1135397-1135426	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1217165-1217194	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1217149-1217178	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1217142-1217171	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_019408	Caulobacter phage CcrRogue, complete genome	180466-180495	6	0.8
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	174181-174210	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP017941	Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence	270228-270257	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	MK937608	Microbacterium phage Cressida, complete genome	54022-54051	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	554437-554466	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	542125-542154	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP017592	Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence	7337-7366	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP008898	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-576, complete sequence	43955-43984	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP023489	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence	73653-73682	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP043515	Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed4, complete sequence	36331-36360	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	571179-571208	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_LT984809	Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence	317155-317184	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP026371	Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence	116386-116415	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP050069	Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence	79588-79617	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP039425	Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence	132572-132601	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP009856	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-784, complete sequence	26128-26157	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP039430	Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence	132570-132599	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	32030-32059	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	14031-14060	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	17715-17744	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP006588	Hymenobacter sp. APR13 plasmid pHA, complete sequence	19031-19060	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1930897-1930926	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190353-190382	6	0.8
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	MH029534	Myoviridae environmental samples clone NHS-Seq2, complete sequence	34123-34152	6	0.8
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	MT723940	Mycobacterium phage Ellie, complete genome	24126-24161	6	0.833
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466597-3466630	6	0.824
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210883-2210916	6	0.824
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283764-283797	6	0.824
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445248-445281	6	0.824
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	39276-39303	6	0.786
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	76834-76861	6	0.786
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NZ_LR594663	Variovorax sp. RA8 plasmid 2	131793-131820	6	0.786
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	27764-27794	6	0.806
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	438646-438676	6	0.806
CP019611_12	12.13\|2359932\|34\|CP019611\|CRISPRCasFinder	2359932-2359965	34	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	28989-29022	6	0.824
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	147567-147597	7	0.774
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	36995-37025	7	0.774
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP042263	Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence	372247-372277	7	0.774
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261174-261208	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306649-306683	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1085516-1085550	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1151738-1151772	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	373508-373542	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1085521-1085555	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	634105-634139	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1302033-1302067	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	895529-895563	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1422896-1422930	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	794837-794871	7	0.8
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	382780-382814	7	0.8
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	506990-507021	7	0.781
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	64257-64288	7	0.781
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP026546	Cupriavidus metallidurans strain Ni-2 plasmid unnamed2	51548-51582	7	0.8
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	506990-507021	7	0.781
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	64257-64288	7	0.781
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261174-261208	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306649-306683	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1085516-1085550	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1151738-1151772	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	373508-373542	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1085521-1085555	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	634105-634139	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1302033-1302067	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	895529-895563	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1422896-1422930	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	794837-794871	7	0.8
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	382780-382814	7	0.8
CP019611_4	4.3\|1118815\|30\|CP019611\|CRT	1118815-1118844	30	MK460246	Mycobacterium phage Nibb, complete genome	5349-5378	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	401811-401840	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	191003-191032	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	130127-130156	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	282765-282794	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1675975-1676004	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	988804-988833	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	1096-1125	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	98302-98331	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	258318-258347	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	52934-52963	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	944807-944836	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1187570-1187599	7	0.767
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	36879-36908	7	0.767
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	120426-120454	7	0.759
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MG925349	Mycobacterium phage Mendokysei, complete genome	21044-21075	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	117029-117060	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	178231-178262	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	646878-646909	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	240411-240442	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	117029-117060	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	36596-36627	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	177107-177138	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_008712	Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence	15152-15183	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	168069-168100	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	383420-383451	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	313183-313214	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	229939-229970	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	382783-382814	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	268642-268673	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	871713-871744	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	464957-464988	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY555145	Caulobacter phage Ccr29, complete genome	44716-44747	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY092483	Streptomyces phage Bioscum, complete genome	32042-32073	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY555143	Caulobacter phage Ccr2, complete genome	42549-42580	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MT711975	Streptomyces phage Alderaan, complete genome	962-993	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK305888	Streptomyces phage Austintatious, complete genome	29569-29600	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	AY369265	Burkholderia cenocepacia phage Bcep1, complete genome	23297-23328	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK524485	Mycobacterium phage MissDaisy, complete genome	6564-6595	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	32034-32065	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH926058	Mycobacterium phage Reptar3000, complete genome	6539-6570	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY092481	Streptomyces phage PapayaSalad, complete genome	32166-32197	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK524488	Mycobacterium phage Patt, complete genome	6540-6571	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_005263	Burkholderia phage Bcep1, complete genome	23297-23328	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY555142	Caulobacter phage Ccr10, complete genome	42074-42105	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	178484-178515	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	525681-525712	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	117071-117102	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	619568-619599	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	997280-997311	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	301155-301186	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	373957-373988	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH271296	Gordonia phage Emperor, complete genome	13015-13046	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_KR997898	Mycobacterium avium subsp. hominissuis strain 88Br plasmid pMA100, complete sequence	76770-76801	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	461674-461705	7	0.781
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	311719-311750	7	0.781
CP019611_6	6.10\|1126398\|32\|CP019611\|CRT	1126398-1126429	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	470162-470193	7	0.781
CP019611_6	6.10\|1126398\|32\|CP019611\|CRT	1126398-1126429	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	427957-427988	7	0.781
CP019611_6	6.10\|1126398\|32\|CP019611\|CRT	1126398-1126429	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	300237-300268	7	0.781
CP019611_7	7.4\|1154422\|27\|CP019611\|CRISPRCasFinder	1154422-1154448	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	48081-48107	7	0.741
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MK977708	Mycobacterium phage Fulbright, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MG099948	Mycobacterium phage Philonius, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MH926055	Mycobacterium phage Chewbacca, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MT723932	Mycobacterium phage Schnauzer, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	KU935726	Mycobacterium phage Xerxes, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	KU935730	Mycobacterium phage Pipsqueaks, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MH316570	Mycobacterium phage Silvafighter, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MK524518	Mycobacterium phage Smurph, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MK524515	Mycobacterium phage Parmesanjohn, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MH697585	Mycobacterium phage Gex, complete genome	10280-10310	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	KM588359	Mycobacterium phage Carcharodon, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MH697576	Mycobacterium phage Aggie, complete genome	10282-10312	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MH697593	Mycobacterium phage Tapioca, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	MG099936	Mycobacterium phage Andies, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	NC_031243	Mycobacterium phage Xeno, complete genome	10281-10311	7	0.774
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	JN256079	Mycobacterium phage Charlie, complete genome	10281-10311	7	0.774
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	943873-943902	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	392100-392129	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1838430-1838459	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	616186-616215	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	397449-397478	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1703655-1703684	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	212329-212358	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	679499-679528	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1744018-1744047	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1760732-1760761	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	178925-178954	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	75369-75398	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	153012-153041	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	589998-590027	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	81538-81567	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	845884-845913	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	258296-258325	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1723933-1723962	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1859622-1859651	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1841724-1841753	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1841724-1841753	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	137321-137350	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	258496-258525	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	257917-257946	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	234345-234374	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	461507-461536	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	254201-254230	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	236985-237014	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	298368-298397	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	258487-258516	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	461579-461608	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	390422-390451	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1964821-1964850	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	461516-461545	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	237930-237959	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	849014-849043	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1227007-1227036	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	238244-238273	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	245279-245308	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	235437-235466	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	126762-126791	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	234570-234599	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	258309-258338	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	231309-231338	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	235690-235719	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	238261-238290	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	251052-251081	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	298440-298469	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	230351-230380	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	461938-461967	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	438995-439024	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	245262-245291	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	245236-245265	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	241864-241893	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	240004-240033	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	235466-235495	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	252665-252694	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	280525-280554	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	251050-251079	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	230352-230381	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	236955-236984	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	251053-251082	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	HM560026	Uncultured bacterium plasmid pTRACA45, complete sequence	1764-1793	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_010867	Neisseria lactamica plasmid pNL3.1, complete sequence	3216-3245	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	121720-121749	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	535160-535189	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	326858-326887	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	121664-121693	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	KT997827	Uncultured Mediterranean phage uvDeep-CGR0-KM15-C219, complete genome	28429-28458	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	235977-236006	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1424992-1425021	7	0.767
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	KT997829	Uncultured Mediterranean phage uvDeep-CGR0-KM22-C158, complete genome	24686-24715	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	278785-278814	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	113824-113853	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	158849-158878	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	384914-384943	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	317121-317150	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	385410-385439	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	260932-260961	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	329309-329338	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	391416-391445	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	243975-244004	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	301676-301705	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	201076-201105	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	635292-635321	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	422833-422862	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	494408-494437	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	MN582086	Siphoviridae sp. ctdEk19, complete genome	33318-33347	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	864583-864612	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP022700	Acetobacter tropicalis strain BDGP1 plasmid pAtBDGP1A, complete sequence	61493-61522	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1238691-1238720	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1484042-1484071	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1466967-1466996	7	0.767
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	119508-119537	7	0.767
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	NC_022087	Mycobacterium phage AnnaL29, complete genome	5558-5593	7	0.806
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210628-2210661	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2209827-2209860	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	24930-24963	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2133215-2133248	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT889380	Mycobacterium phage Coco12, complete genome	22836-22869	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT114167	Mycobacterium phage Phanphagia, complete genome	22491-22524	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	531146-531179	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	117310-117343	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	254574-254607	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP039641	Azospirillum sp. TSH100 plasmid p2, complete sequence	30914-30947	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH697583	Mycobacterium phage EricMillard, complete genome	32257-32290	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH727551	Mycobacterium phage Kalah2, complete genome	32307-32340	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH077579	Mycobacterium phage Halley, complete genome	31970-32003	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH669017	Mycobacterium phage Zelink, complete genome	33051-33084	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN062701	Mycobacterium phage Dallas, complete genome	31496-31529	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK524527	Mycobacterium phage ThreeRngTarjay, complete genome	32107-32140	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK524529	Mycobacterium phage Phoebus, complete genome	32257-32290	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MF919512	Mycobacterium phage Klein, complete genome	31531-31564	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KF114875	Mycobacterium phage Redno2, complete genome	31720-31753	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK967379	Mycobacterium phage HokkenD, complete genome	31519-31552	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	307986-308019	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	178492-178525	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	275379-275412	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445383-445416	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	275378-275411	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN813686	Mycobacterium phage BirdsNest, complete genome	30327-30360	7	0.794
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_042035	Mycobacterium phage Zemanar, complete sequence	31516-31549	7	0.794
CP019611_11	11.9\|2003599\|37\|CP019611\|CRISPRCasFinder	2003599-2003635	37	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	136890-136926	7	0.811
CP019611_12	12.1\|2359068\|28\|CP019611\|CRISPRCasFinder	2359068-2359095	28	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	259627-259654	7	0.75
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	281800-281830	7	0.774
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	CP017041	Propionibacterium sp. oral taxon 193 strain F0672 plasmid unnamed1, complete sequence	68407-68437	7	0.774
CP019611_13	13.3\|2875198\|30\|CP019611\|CRT	2875198-2875227	30	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	52187-52216	7	0.767
CP019611_13	13.3\|2875198\|30\|CP019611\|CRT	2875198-2875227	30	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	75140-75169	7	0.767
CP019611_13	13.3\|2875198\|30\|CP019611\|CRT	2875198-2875227	30	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	376489-376518	7	0.767
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	CP033373	Lactobacillus fermentum strain DR9 plasmid unnamed2, complete sequence	12237-12267	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1260343-1260373	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1009358-1009388	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1260501-1260531	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1009351-1009381	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	756669-756699	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1137767-1137797	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1009365-1009395	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1260057-1260087	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1260001-1260031	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	981946-981976	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	938267-938297	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	748414-748444	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	896022-896052	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	215713-215743	8	0.742
CP019611_1	1.7\|109916\|31\|CP019611\|CRT	109916-109946	31	NC_014213	Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence	111748-111778	8	0.742
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	39373-39404	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP053714	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed7, complete sequence	10207-10238	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	288012-288043	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1651410-1651441	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	15179-15210	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	122115-122146	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	350558-350589	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP033508	Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence	6416-6447	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP033369	Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence	6416-6447	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	604747-604778	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	356076-356107	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	477588-477619	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	1112548-1112579	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	250921-250952	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP032053	Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence	2483-2514	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	947778-947809	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	797689-797720	8	0.75
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MN234185	Mycobacterium phage Lemuria, complete genome	22699-22730	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	39373-39404	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP053714	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed7, complete sequence	10207-10238	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	288012-288043	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1651410-1651441	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	15179-15210	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	122115-122146	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	350558-350589	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP033508	Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence	6416-6447	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP033369	Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence	6416-6447	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	604747-604778	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	356076-356107	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	477588-477619	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	1112548-1112579	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	250921-250952	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP032053	Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence	2483-2514	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	947778-947809	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	797689-797720	8	0.75
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MN234185	Mycobacterium phage Lemuria, complete genome	22699-22730	8	0.75
CP019611_4	4.3\|1118815\|30\|CP019611\|CRT	1118815-1118844	30	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	475069-475098	8	0.733
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_019847	Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence	101111-101140	8	0.733
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	730591-730620	8	0.733
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	480868-480897	8	0.733
CP019611_4	4.12\|1119295\|30\|CP019611\|CRT	1119295-1119324	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	61392-61421	8	0.733
CP019611_6	6.6\|1126185\|29\|CP019611\|CRT	1126185-1126213	29	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	816244-816272	8	0.724
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1355252-1355283	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	553963-553994	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1945949-1945980	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_010399	Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence	30940-30971	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	19751-19782	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	158254-158285	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	1509215-1509246	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1848044-1848075	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1848046-1848077	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	231466-231497	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	65849-65880	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1075453-1075484	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MN369761	Mycobacterium phage Malthus, complete genome	6608-6639	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK224497	Mycobacterium phage Henu3, complete genome	52357-52388	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KJ944841	Mycobacterium phage Cheetobro, complete genome	6618-6649	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	AP018469	Mycobacterium phage Y10 DNA, complete genome, note: sample1	6608-6639	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY087992	Mycobacterium phage Mitti, complete genome	6621-6652	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	EF602154	Burkholderia phage BcepNY3, complete genome	21515-21546	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MF140402	Mycobacterium phage Chancellor, complete genome	6618-6649	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	AP018470	Mycobacterium phage Y2 DNA, complete genome	6608-6639	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KT361920	Mycobacterium phage Slarp, complete genome	6618-6649	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MT310882	Mycobacterium phage JF1, complete genome	6608-6639	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	AP018471	Mycobacterium phage Y10 DNA, complete genome, note: sample2	6608-6639	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KX621007	Mycobacterium phage Taquito, complete genome	6219-6250	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH051258	Mycobacterium phage SamScheppers, complete genome	6215-6246	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP036221	Mycobacterium avium subsp. hominissuis strain mc2 2500 plasmid unnamed1, complete sequence	13426-13457	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP040251	Mycobacterium avium subsp. hominissuis strain 101115 plasmid unnamed1	19842-19873	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP040252	Mycobacterium avium subsp. hominissuis strain 101115 plasmid unnamed2	9842-9873	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP026546	Cupriavidus metallidurans strain Ni-2 plasmid unnamed2	154234-154265	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	989188-989219	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP029334	Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109b, complete sequence	8781-8812	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	443817-443848	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	596371-596402	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	284377-284408	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY555147	Caulobacter phage Ccr34, complete genome	42047-42078	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KY555146	Caulobacter phage Ccr32, complete genome	42081-42112	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_047975	Microbacterium phage Squash, complete genome	20718-20749	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	JX163858	Caulobacter phage phiCbK, complete genome	165745-165776	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1618852-1618883	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1401911-1401942	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1018857-1018888	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1007548-1007579	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1664299-1664330	8	0.75
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	934056-934087	8	0.75
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1386736-1386768	8	0.758
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	35126-35158	8	0.758
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1241611-1241643	8	0.758
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	275839-275871	8	0.758
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	310597-310629	8	0.758
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2714450-2714479	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	837910-837939	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	424702-424731	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	975216-975245	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1013021-1013050	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_KY126370	Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence	93253-93282	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	22400-22429	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1889334-1889363	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	21202-21231	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	30108-30137	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	32856-32885	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP032156	Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence	111116-111145	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	KY555144	Caulobacter phage Ccr5, complete genome	178242-178271	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_KP873172	Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence	21059-21088	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	159096-159125	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NC_021492	Enterobacter sp. R4-368 plasmid pENT01, complete sequence	50097-50126	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	15249-15278	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP024682	Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence	41943-41972	8	0.733
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	242723-242752	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	28649-28678	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	310870-310899	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	462801-462830	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	292109-292138	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	287383-287412	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	292305-292334	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	292675-292704	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	306458-306487	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	292675-292704	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	295900-295929	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	292670-292699	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	306458-306487	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	292305-292334	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	298287-298316	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1682210-1682239	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	294530-294559	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	375826-375855	8	0.733
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	112972-113001	8	0.733
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	MG770216	Mycobacterium phage Rem711, complete genome	26292-26327	8	0.778
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	KY087993	Mycobacterium phage Hammy, complete genome	24359-24394	8	0.778
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	MF140406	Mycobacterium phage DarthP, complete genome	24368-24403	8	0.778
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466471-3466504	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350662-350695	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350530-350563	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051061-3051094	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	36586-36619	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_047958	Burkholderia phage vB_BmuP_KL4, complete genome	28566-28599	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	117037-117070	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	928385-928418	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	131278-131311	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	117079-117112	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	117037-117070	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	670302-670335	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1123064-1123097	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	530145-530178	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	187401-187434	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN234223	Mycobacterium phage Philly, complete genome	30948-30981	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KJ194581	Mycobacterium phage Audrey, complete genome	31094-31127	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH051265	Mycobacterium phage Yahalom, complete genome	31107-31140	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH316565	Mycobacterium phage Mortcellus, complete genome	31732-31765	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT310871	Mycobacterium phage Jackstina, complete genome	31017-31050	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	EU816589	Mycobacterium phage Phaedrus, complete genome	31013-31046	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT952851	Mycobacterium phage Gervas, complete genome	31075-31108	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MG920059	Mycobacterium phage Baloo, complete genome	31097-31130	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_023686	Mycobacterium phage Gadjet, complete genome	31104-31137	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_041965	Mycobacterium phage Athena, complete genome	31845-31878	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	DQ398049	Mycobacterium phage Pipefish, complete genome	32489-32522	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT310892	Mycobacterium phage Compostia, complete genome	31524-31557	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN699018	Mycobacterium phage Kamiyu, complete genome	31063-31096	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687345-687378	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	118498-118531	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	539300-539333	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK814754	Mycobacterium phage Sumter, complete genome	28141-28174	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK814754	Mycobacterium phage Sumter, complete genome	28639-28672	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN369739	Mycobacterium phage Kenuha5, complete genome	22588-22621	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK967397	Mycobacterium phage Mahavrat, complete genome	24814-24847	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT522000	Mycobacterium phage Soul22, complete genome	22192-22225	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KY348865	Mycobacterium phage Bubbles123, complete genome	25540-25573	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN428047	Mycobacterium phage Doomphist, complete genome	24962-24995	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22190-22223	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AY129336	Mycobacteriophage Che9d, complete genome	22205-22238	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT771340	Mycobacterium phage Jorgensen, complete genome	28476-28509	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK359343	Mycobacterium phage Pollywog, complete genome	23655-23688	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_042030	Mycobacterium phage Yoshi, complete sequence	22193-22226	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_048729	Mycobacterium phage Renaud18, complete genome	22865-22898	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_026585	Mycobacteriophage Estave1, complete genome	22558-22591	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK305886	Mycobacterium phage Poenanya, complete genome	24962-24995	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN859129	Mycobacterium virus DotProduct, complete genome	24829-24862	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MG925354	Mycobacterium phage Ogopogo, complete genome	22785-22818	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN698995	Mycobacterium phage Dori, complete genome	28163-28196	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_023698	Mycobacterium phage Avani, complete genome	22197-22230	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_011054	Mycobacterium phage Boomer, complete genome	24637-24670	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN234184	Mycobacterium phage IdentityCrisis, complete genome	19984-20017	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH077585	Mycobacterium phage TChen, complete genome	22970-23003	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_048788	Mycobacterium phage ThetaBob, complete genome	22783-22816	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	125963-125996	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	138036-138069	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN096355	Mycobacterium phage Purky, complete genome	13505-13538	8	0.765
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN234183	Mycobacterium phage Antsirabe, complete genome	23060-23093	8	0.765
CP019611_11	11.9\|2003599\|37\|CP019611\|CRISPRCasFinder	2003599-2003635	37	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	683728-683764	8	0.784
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	349053-349083	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP039899	Agrobacterium tumefaciens strain CFBP5877 plasmid pAtCFBP5877a, complete sequence	336247-336277	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP039913	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence	262996-263026	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP039890	Agrobacterium tumefaciens strain CFBP5499 plasmid pAtCFBP5499a, complete sequence	336247-336277	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	264529-264559	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	458177-458207	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	311056-311086	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	88587-88617	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	CP036360	Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence	284157-284187	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP021914	Sagittula sp. P11 plasmid unnamed1, complete sequence	300067-300097	8	0.742
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1510497-1510527	8	0.742
CP019611_13	13.3\|2875198\|30\|CP019611\|CRT	2875198-2875227	30	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	9194-9223	8	0.733
CP019611_13	13.3\|2875198\|30\|CP019611\|CRT	2875198-2875227	30	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	983284-983313	8	0.733
CP019611_17	17.26\|3903131\|29\|CP019611\|PILER-CR	3903131-3903159	29	MK599315	Pseudomonas phage PA1C, complete genome	299172-299200	8	0.724
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	922290-922323	9	0.735
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	MG812496	Gordonia phage SallySpecial, complete genome	7675-7708	9	0.735
CP019611_1	1.9\|110048\|37\|CP019611\|CRT	110048-110084	37	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	975062-975098	9	0.757
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	182019-182053	9	0.743
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	61961-61995	9	0.743
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NC_028791	Mycobacterium phage MOOREtheMARYer, complete genome	22782-22816	9	0.743
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	232975-233006	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	580621-580652	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	569017-569048	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_LR594668	Variovorax sp. SRS16 plasmid 3	37759-37790	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	466176-466207	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	535557-535588	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	466176-466207	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	472220-472251	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	472210-472241	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	315511-315542	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	466188-466219	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	466208-466239	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	466162-466193	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	580664-580695	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	580664-580695	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	1233-1264	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	207744-207775	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	580655-580686	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	251423-251454	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	66790-66821	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP023524	Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence	61961-61992	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	196202-196233	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	682094-682125	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP017564	Paraburkholderia sprentiae WSM5005 plasmid pl3WSM5005, complete sequence	52981-53012	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP033429	Burkholderia gladioli strain Burkholderia gladioli Co14 plasmid p1, complete sequence	47823-47854	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	550227-550258	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	362074-362105	9	0.719
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MN234219	Mycobacterium phage Mercurio, complete genome	23309-23340	9	0.719
CP019611_2	2.17\|320599\|35\|CP019611\|CRT	320599-320633	35	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	366236-366270	9	0.743
CP019611_2	2.19\|320755\|35\|CP019611\|CRT	320755-320789	35	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2357907-2357941	9	0.743
CP019611_2	2.19\|320755\|35\|CP019611\|CRT	320755-320789	35	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1269394-1269428	9	0.743
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	232975-233006	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	580621-580652	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	569017-569048	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_LR594668	Variovorax sp. SRS16 plasmid 3	37759-37790	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	466176-466207	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	535557-535588	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	466176-466207	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	472220-472251	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	472210-472241	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	315511-315542	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	466188-466219	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	466208-466239	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	466162-466193	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	580664-580695	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	580664-580695	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	1233-1264	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	207744-207775	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	580655-580686	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	251423-251454	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	66790-66821	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP023524	Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence	61961-61992	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	196202-196233	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	682094-682125	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP017564	Paraburkholderia sprentiae WSM5005 plasmid pl3WSM5005, complete sequence	52981-53012	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP033429	Burkholderia gladioli strain Burkholderia gladioli Co14 plasmid p1, complete sequence	47823-47854	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	550227-550258	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	362074-362105	9	0.719
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MN234219	Mycobacterium phage Mercurio, complete genome	23309-23340	9	0.719
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	182019-182053	9	0.743
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	61961-61995	9	0.743
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NC_028791	Mycobacterium phage MOOREtheMARYer, complete genome	22782-22816	9	0.743
CP019611_4	4.13\|1119343\|39\|CP019611\|CRT	1119343-1119381	39	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	24079-24117	9	0.769
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	24931-24971	9	0.78
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1014338-1014378	9	0.78
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1681015-1681046	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP018080	Sulfitobacter sp. AM1-D1 plasmid unnamed4, complete sequence	103034-103065	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	369703-369734	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1241952-1241983	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	677216-677247	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1982061-1982092	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH371116	Mycobacterium phage DMoney, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH045569	Mycobacterium phage Schiebel, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH371119	Mycobacterium phage OctaviousRex, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MF919497	Mycobacterium phage Chance64, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH001456	Mycobacterium phage CLED96, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	GQ303261	Mycobacterium phage Hope, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MG099946	Mycobacterium phage LouisV14, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787112	Mycobacterium phage Clark, partial genome	6594-6625	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH779513	Mycobacterium phage Olga, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK919475	Mycobacterium phage Camri, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK310146	Mycobacterium phage Crespo, complete genome	6590-6621	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK524493	Mycobacterium phage Darionha, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH779505	Mycobacterium phage Grizzly, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	EU568876	Mycobacterium phage BPs, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787107	Mycobacterium phage Bo4, complete genome	32703-32734	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MF668268	Mycobacterium phage Aroostook, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK524494	Mycobacterium phage Rabbs, complete genome	6590-6621	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KX588251	Mycobacterium phage Jane, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787103	Mycobacterium phage Chy2, partial genome	5354-5385	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH001455	Mycobacterium phage Remy19, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KT355472	Mycobacterium phage Cedasite, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KX664455	Mycobacterium phage Zombie, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH077584	Mycobacterium phage Phish, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787108	Mycobacterium phage DNAIII, complete genome	6598-6629	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MN444875	Mycobacterium phage Jonghyun, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK433279	Mycobacterium phage Kareem, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KJ725374	Mycobacterium phage Guo1, complete genome	27230-27261	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_031102	Mycobacterium phage Sneeze, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MT818422	Mycobacterium phage Periodt, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK305884	Mycobacterium phage BQuat, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MF668272	Mycobacterium phage Gideon, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787111	Mycobacterium phage Sedge, partial genome	6529-6560	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787104	Mycobacterium phage Chy3, partial genome	6969-7000	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_012788	Mycobacterium phage Angel, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KX443326	Mycobacterium phage BruceB, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MK433277	Mycobacterium phage Renaissance, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH590605	Mycobacterium phage Cherrybomb426, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH779509	Mycobacterium phage Kasen3, complete genome	6590-6621	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	JN699002	Mycobacterium phage Avrafan, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KT355474	Mycobacterium phage Frosty24, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787109	Mycobacterium phage Legendre, partial genome	34119-34150	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	JN412593	Mycobacterium phage Liefie, complete genome	6588-6619	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH479920	Mycobacterium phage Mowgli, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KM923970	Mycobacterium phage Gomashi, complete genome	6590-6621	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	MH450127	Mycobacterium phage Plagueis, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KT347314	Mycobacterium phage Phreak, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KT365399	Mycobacterium phage Annihilator, complete genome	6589-6620	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	KC787110	Mycobacterium phage Leo, complete genome	6606-6637	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	97692-97723	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_019958	Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence	126653-126684	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1006214-1006245	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1169636-1169667	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	885631-885662	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1786216-1786247	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	648892-648923	9	0.719
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	132357-132388	9	0.719
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	91175-91207	9	0.727
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	668963-668995	9	0.727
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	789706-789738	9	0.727
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	625853-625885	9	0.727
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	NZ_CP014964	Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence	13698-13728	9	0.71
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	20960-20990	9	0.71
CP019611_8	8.1\|1482437\|31\|CP019611\|CRISPRCasFinder	1482437-1482467	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	15390-15420	9	0.71
CP019611_9	9.13\|1716707\|30\|CP019611\|CRT	1716707-1716736	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5046041-5046070	9	0.7
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	65937-65966	9	0.7
CP019611_9	9.15\|1716803\|30\|CP019611\|CRT	1716803-1716832	30	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	65937-65966	9	0.7
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	MF140398	Mycobacterium phage Amohnition, complete genome	24446-24481	9	0.75
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350101-350134	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210928-2210961	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	231456-231489	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306612-306645	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283233-283266	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	EF602154	Burkholderia phage BcepNY3, complete genome	21505-21538	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AY369265	Burkholderia cenocepacia phage Bcep1, complete genome	23287-23320	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_005263	Burkholderia phage Bcep1, complete genome	23287-23320	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	307143-307176	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	298112-298145	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	723127-723160	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP053906	Hymenobacter sp. BRD67 plasmid unnamed2, complete sequence	19270-19303	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KC170279	Uncultured bacterium plasmid pMBUI8, complete sequence	15929-15962	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	652970-653003	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	490801-490834	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	637964-637997	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	235008-235041	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	646029-646062	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	635838-635871	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684904-684937	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1303766-1303799	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	897262-897295	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233325-233358	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	560015-560048	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1424629-1424662	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	796570-796603	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	659643-659676	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1083784-1083817	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1052610-1052643	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1150006-1150039	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	654523-654556	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	771404-771437	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	290861-290894	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	371773-371806	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1224363-1224396	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	997046-997079	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1083789-1083822	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH001451	Mycobacterium phage Nairb, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MF155936	Mycobacterium phage ZenTime222, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH588544	Caulobacter phage CcrBL10, complete genome	39042-39075	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK494089	Mycobacterium phage Ibrahim, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_024135	Mycobacterium phage Bernal13, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KM591905	Mycobacterium phage RonRayGun, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN735432	Mycobacteriophage Whitty, complete genome	21242-21275	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KX443399	Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence	82507-82540	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KX443400	Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence	82532-82565	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KX443398	Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence	82528-82561	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	CP054922	Streptomyces sp. NA03103 plasmid unnamed2, complete sequence	90688-90721	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KP851975	Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence	82645-82678	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	55533-55566	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	318448-318481	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KF439868	Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence	81659-81692	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	84861-84894	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	135548-135581	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	498515-498548	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	927230-927263	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	241368-241401	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	455289-455322	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	241368-241401	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	239809-239842	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	244056-244089	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	238174-238207	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013512	Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence	131481-131514	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	241368-241401	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	747004-747037	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KC736071	Mycobacterium phage WIVsmall, complete genome	29683-29716	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	171949-171982	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	52095-52128	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP041653	Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence	129601-129634	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	301604-301637	9	0.735
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	779027-779060	9	0.735
CP019611_11	11.9\|2003599\|37\|CP019611\|CRISPRCasFinder	2003599-2003635	37	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	686592-686628	9	0.757
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	345043-345073	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	245050-245080	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	194387-194417	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	MN234199	Mycobacterium phage Ekdilam, complete genome	24235-24265	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1145162-1145192	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	453136-453166	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP013740	Streptomyces globisporus C-1027 plasmid pSGL1, complete sequence	2806-2836	9	0.71
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1908459-1908489	9	0.71
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	470079-470112	10	0.706
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	68774-68807	10	0.706
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	172270-172303	10	0.706
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	172270-172303	10	0.706
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	MN908687	Gordonia phage Skog, complete genome	113878-113912	10	0.714
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	NC_019917	Burkholderia phage BcepMigl, complete genome	36779-36813	10	0.714
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	90162-90193	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	197505-197536	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	138828-138859	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	17911-17942	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	438073-438104	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	164795-164826	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	697939-697970	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054026	Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence	263759-263790	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP054036	Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence	105092-105123	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MK279887	Mycobacterium phage Timmi, complete genome	30988-31019	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	KX683293	Mycobacterium phage Daffy, complete genome	30997-31028	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	JN006063	Mycobacterium phage Serendipity, complete genome	31296-31327	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MH576970	Mycobacterium phage DonSanchon, complete genome	30970-31001	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MK279881	Mycobacterium phage Solosis, complete genome	30987-31018	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	JN638753	Mycobacterium phage Morgushi, complete genome	30980-31011	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	JF704103	Mycobacterium phage Vortex, complete sequence	30983-31014	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MK112536	Mycobacterium phage Cannibal, complete genome	31255-31286	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	JN699010	Mycobacterium phage TallGrassMM, complete genome	30902-30933	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MT952849	Mycobacterium phage Windsor, complete genome	30973-31004	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NC_028803	Mycobacterium phage OSmaximus, complete genome	31312-31343	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MH450122	Mycobacterium phage KingTut, complete genome	26651-26682	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MK112544	Mycobacterium phage Keitherie, complete genome	31327-31358	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MT310867	Mycobacterium phage Chaelin, complete genome	30969-31000	10	0.688
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	MH590594	Mycobacterium phage PinheadLarry, complete genome	30991-31022	10	0.688
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	MH142220	UNVERIFIED: Acidithiobacillus phage AcaML1 strain BC13 genomic sequence	35773-35807	10	0.714
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	MH142219	UNVERIFIED: Acidithiobacillus phage AcaML1 strain F genomic sequence	35771-35805	10	0.714
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	JX507079	Acidithiobacillus phage AcaML1, complete genome	35773-35807	10	0.714
CP019611_2	2.17\|320599\|35\|CP019611\|CRT	320599-320633	35	MK310141	Mycobacterium phage Fenn, complete genome	30314-30348	10	0.714
CP019611_2	2.17\|320599\|35\|CP019611\|CRT	320599-320633	35	MK524523	Mycobacterium phage Naira, complete genome	30361-30395	10	0.714
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	90162-90193	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	197505-197536	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	138828-138859	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	17911-17942	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	438073-438104	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	164795-164826	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	697939-697970	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054026	Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence	263759-263790	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP054036	Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence	105092-105123	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MK279887	Mycobacterium phage Timmi, complete genome	30988-31019	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	KX683293	Mycobacterium phage Daffy, complete genome	30997-31028	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	JN006063	Mycobacterium phage Serendipity, complete genome	31296-31327	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MH576970	Mycobacterium phage DonSanchon, complete genome	30970-31001	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MK279881	Mycobacterium phage Solosis, complete genome	30987-31018	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	JN638753	Mycobacterium phage Morgushi, complete genome	30980-31011	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	JF704103	Mycobacterium phage Vortex, complete sequence	30983-31014	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MK112536	Mycobacterium phage Cannibal, complete genome	31255-31286	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	JN699010	Mycobacterium phage TallGrassMM, complete genome	30902-30933	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MT952849	Mycobacterium phage Windsor, complete genome	30973-31004	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NC_028803	Mycobacterium phage OSmaximus, complete genome	31312-31343	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MH450122	Mycobacterium phage KingTut, complete genome	26651-26682	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MK112544	Mycobacterium phage Keitherie, complete genome	31327-31358	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MT310867	Mycobacterium phage Chaelin, complete genome	30969-31000	10	0.688
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	MH590594	Mycobacterium phage PinheadLarry, complete genome	30991-31022	10	0.688
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	MN908687	Gordonia phage Skog, complete genome	113878-113912	10	0.714
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	NC_019917	Burkholderia phage BcepMigl, complete genome	36779-36813	10	0.714
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	MG925349	Mycobacterium phage Mendokysei, complete genome	21044-21084	10	0.756
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	396842-396882	10	0.756
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	576172-576203	10	0.688
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	49370-49401	10	0.688
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	384747-384778	10	0.688
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NZ_CP032692	Rhizobium sp. CCGE532 plasmid pRCCGE532b, complete sequence	218155-218186	10	0.688
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	91179-91211	10	0.697
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	90245-90277	10	0.697
CP019611_7	7.6\|1154557\|33\|CP019611\|CRISPRCasFinder	1154557-1154589	33	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	99166-99198	10	0.697
CP019611_9	9.2\|1716203\|39\|CP019611\|CRT	1716203-1716241	39	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	107058-107096	10	0.744
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	MN369764	Mycobacterium phage Rahalelujah, complete genome	24340-24375	10	0.722
CP019611_9	9.17\|1716893\|36\|CP019611\|CRT	1716893-1716928	36	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	25147-25182	10	0.722
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210946-2210979	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1732364-1732397	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	21676-21709	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	CP000620	Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence	96060-96093	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP020810	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed1, complete sequence	93944-93977	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	98684-98717	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK524490	Mycobacterium phage Donny, complete genome	33811-33844	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MK494095	Mycobacterium phage Daegal, complete genome	5959-5992	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN699007	Mycobacterium phage Acadian, complete genome	33806-33839	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MT889381	Mycobacterium phage Suigeneris, complete genome	33811-33844	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	47518-47551	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AP018709	Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence	27460-27493	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	194712-194745	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	362178-362211	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_008766	Acidovorax sp. JS42 plasmid pAOVO02, complete sequence	10252-10285	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	677361-677394	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	8446-8479	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	65893-65926	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	640930-640963	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	104485-104518	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_024998	Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83	31366-31399	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_008385	Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence	29995-30028	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP018471	Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence	16577-16610	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_MN366359	Bacterium plasmid pALTS31, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP027024	Streptomyces sp. WAC00288 plasmid p2, complete sequence	100724-100757	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_001735	Enterobacter aerogenes plasmid R751, complete sequence	31148-31181	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AGRM01000006	Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence	12357-12390	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AJ863570	Uncultured bacterium IncP-1beta multiresistance plasmid pB8	25168-25201	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	17683-17716	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1350942-1350975	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	136497-136530	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_021492	Enterobacter sp. R4-368 plasmid pENT01, complete sequence	46815-46848	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JX469828	Uncultured bacterium plasmid pRSB223, complete sequence	25131-25164	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JX469829	Uncultured bacterium plasmid pB1, complete sequence	16215-16248	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	15931-15964	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	15932-15965	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	15939-15972	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	15929-15962	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN386974	Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence	16066-16099	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_001381	Mycobacterium fortuitum plasmid pAL5000, complete sequence	2682-2715	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	31441-31474	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP021650	Acidovorax sp. T1 plasmid p2-T1, complete sequence	40579-40612	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	JX486125	Uncultured bacterium plasmid pRWC72a, complete sequence	15940-15973	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP038640	Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence	50284-50317	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	AJ639924	Uncultured bacterium plasmid pB3 complete genome	17431-17464	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KU356987	Variovorax paradoxus plasmid pBS64, complete sequence	15928-15961	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	KU356988	Variovorax paradoxus plasmid pHB44, complete sequence	15930-15963	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	155712-155745	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP009797	Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence	16433-16466	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	10533-10566	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_019320	Variovorax sp. DB1 plasmid pDB1, complete sequence	49358-49391	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP017455	Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence	23524-23557	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	71777-71810	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_MN366358	Bacterium plasmid pALTS29, complete sequence	15940-15973	10	0.706
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MN234219	Mycobacterium phage Mercurio, complete genome	23308-23341	10	0.706
CP019611_11	11.9\|2003599\|37\|CP019611\|CRISPRCasFinder	2003599-2003635	37	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	331923-331959	10	0.73
CP019611_11	11.9\|2003599\|37\|CP019611\|CRISPRCasFinder	2003599-2003635	37	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	716620-716656	10	0.73
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	425898-425928	10	0.677
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	344090-344120	10	0.677
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	68383-68413	10	0.677
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	16322-16352	10	0.677
CP019611_12	12.10\|2359683\|31\|CP019611\|CRISPRCasFinder	2359683-2359713	31	NZ_AP014581	Burkholderia sp. RPE67 plasmid p3, complete sequence	131907-131937	10	0.677
CP019611_12	12.13\|2359932\|34\|CP019611\|CRISPRCasFinder	2359932-2359965	34	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	1081518-1081551	10	0.706
CP019611_15	15.9\|3898951\|35\|CP019611\|PILER-CR,CRISPRCasFinder,CRT	3898951-3898985	35	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	414652-414686	10	0.714
CP019611_17	17.22\|3904004\|34\|CP019611\|CRISPRCasFinder,CRT	3904004-3904037	34	NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	171698-171731	10	0.706
CP019611_17	17.38\|3904008\|34\|CP019611\|PILER-CR	3904008-3904041	34	NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	171698-171731	10	0.706
CP019611_1	1.5\|109775\|34\|CP019611\|CRT	109775-109808	34	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	326578-326611	11	0.676
CP019611_1	1.9\|110048\|37\|CP019611\|CRT	110048-110084	37	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	232224-232260	11	0.703
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	MT498048	Mycobacterium phage Raymond7, complete genome	21147-21181	11	0.686
CP019611_2	2.11\|320137\|35\|CP019611\|CRT	320137-320171	35	KF986246	Mycobacterium phage MichelleMyBell, complete genome	20761-20795	11	0.686
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	193164-193195	11	0.656
CP019611_2	2.13\|320290\|32\|CP019611\|CRT	320290-320321	32	NZ_CP022194	Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence	105351-105382	11	0.656
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1503797-1503831	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1345383-1345417	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	371884-371918	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	76978-77012	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1603718-1603752	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	496850-496884	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1417593-1417627	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1520701-1520735	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1494873-1494907	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1494873-1494907	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	558181-558215	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	570323-570357	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1168047-1168081	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	573450-573484	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	672629-672663	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	732713-732747	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	229829-229863	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	949523-949557	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1661767-1661801	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	814009-814043	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	575904-575938	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	586173-586207	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	571850-571884	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	488799-488833	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	570933-570967	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	574782-574816	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	575909-575943	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	634903-634937	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	580526-580560	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	591718-591752	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	569719-569753	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	634903-634937	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	580526-580560	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	634903-634937	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	569747-569781	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	634907-634941	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	580526-580560	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	580526-580560	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	580526-580560	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	569747-569781	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	586156-586190	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	586106-586140	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	622986-623020	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	577921-577955	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	580513-580547	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	569747-569781	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	634903-634937	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	668121-668155	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	591717-591751	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	569747-569781	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	569747-569781	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	580528-580562	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.16\|320527\|35\|CP019611\|CRT	320527-320561	35	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	591720-591754	11	0.686
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	193164-193195	11	0.656
CP019611_2	2.21\|320899\|32\|CP019611\|CRT	320899-320930	32	NZ_CP022194	Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence	105351-105382	11	0.656
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	MT498048	Mycobacterium phage Raymond7, complete genome	21147-21181	11	0.686
CP019611_2	2.26\|321352\|35\|CP019611\|CRT	321352-321386	35	KF986246	Mycobacterium phage MichelleMyBell, complete genome	20761-20795	11	0.686
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NC_015147	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE302, complete sequence	59682-59722	11	0.732
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	99993-100033	11	0.732
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	324417-324448	11	0.656
CP019611_6	6.9\|1126344\|32\|CP019611\|CRT	1126344-1126375	32	NC_023067	Streptomyces sp. F2 plasmid pFP3, complete sequence	3866-3897	11	0.656
CP019611_6	6.10\|1126398\|32\|CP019611\|CRT	1126398-1126429	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	309981-310012	11	0.656
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350092-350125	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	239254-239287	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MH051334	Escherichia phage vB_EcoS-Ro145c2YLVW, complete genome	23136-23169	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	MG852086	Escherichia phage vB_EcoS-Ro145clw, complete genome	41310-41343	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261086-261119	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	584732-584765	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	70292-70325	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	507461-507494	11	0.676
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	155836-155869	11	0.676
CP019611_11	11.5\|2003383\|40\|CP019611\|CRISPRCasFinder	2003383-2003422	40	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261884-261923	11	0.725
CP019611_6	6.7\|1126236\|41\|CP019611\|CRT	1126236-1126276	41	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283756-283796	12	0.707
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190139-190172	12	0.647
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_CP026703	Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence	14966-14999	12	0.647
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	302491-302524	14	0.588
CP019611_11	11.3\|2003278\|34\|CP019611\|CRISPRCasFinder	2003278-2003311	34	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	282346-282379	15	0.559

1. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 1, identity: 0.955

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggcggtgcc	Protospacer
********************.*

2. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcggcc	Protospacer
*********************

3. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcggcc	Protospacer
*********************

4. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP016457 (Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence) position: , mismatch: 1, identity: 0.955

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcgggccggcggca	Protospacer
**********.***********

5. spacer 12.15|2360055|22|CP019611|CRISPRCasFinder matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

6. spacer 12.15|2360055|22|CP019611|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

7. spacer 12.15|2360055|22|CP019611|CRISPRCasFinder matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

8. spacer 12.15|2360055|22|CP019611|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 1, identity: 0.955

caatccggcggcgccgccggca	CRISPR spacer
caattcggcggcgccgccggca	Protospacer
****.*****************

9. spacer 2.27|321424|26|CP019611|CRT matches to NC_023695 (Mycobacterium phage Violet, complete genome) position: , mismatch: 2, identity: 0.923

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaacggcgg	Protospacer
*******************  *****

10. spacer 6.8|1126299|23|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

atgagcccgccggcgccgccgtt	CRISPR spacer
ttgagccagccggcgccgccgtt	Protospacer
 ****** ***************

11. spacer 6.8|1126299|23|CP019611|CRT matches to MN010758 (Gordonia phage Dardanus, complete genome) position: , mismatch: 2, identity: 0.913

atgagcccgccggcgccgccgtt	CRISPR spacer
gtgaacccgccggcgccgccgtt	Protospacer
.***.******************

12. spacer 6.8|1126299|23|CP019611|CRT matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

atgagcccgccggcgccgccgtt	CRISPR spacer
atgaggacgccggcgccgccgtt	Protospacer
*****  ****************

13. spacer 6.8|1126299|23|CP019611|CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 2, identity: 0.913

atgagcccgccggcgccgccgtt	CRISPR spacer
aagagcacgccggcgccgccgtt	Protospacer
* **** ****************

14. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggcggtggg	Protospacer
********************

15. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
agtcggcggtgccgacggtgtc	Protospacer
 *************.*******

16. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggcgtc	Protospacer
.*****************.***

17. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_021056 (Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgtcggcggtgtc	Protospacer
.**********.**********

18. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
ggtcggcggtgccggcggcgtc	Protospacer
 *****************.***

19. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggccgtgta	Protospacer
**************** ****

20. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgtcggcggtgccggccgtgta	Protospacer
**************** ****

21. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
ggtcggcggtgccggccgtgtc	Protospacer
 *************** *****

22. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_047977 (Microbacterium phage Hendrix, complete genome) position: , mismatch: 2, identity: 0.909

tgtcggcggtgccggcggtgtc	CRISPR spacer
tgacggcggtgccggcggtgtg	Protospacer
** ******************

23. spacer 11.15|2003899|22|CP019611|CRISPRCasFinder matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 2, identity: 0.909

ggacggtggtaccggcggtcag	CRISPR spacer
tgacggtggtgccggcggtcag	Protospacer
 *********.***********

24. spacer 12.2|2359128|22|CP019611|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

25. spacer 12.2|2359128|22|CP019611|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

26. spacer 12.2|2359128|22|CP019611|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

27. spacer 12.2|2359128|22|CP019611|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

28. spacer 12.2|2359128|22|CP019611|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gttgccgattaggacggcggcc	CRISPR spacer
cttgccgatcaggacggcggcc	Protospacer
 ********.************

29. spacer 12.3|2359182|22|CP019611|CRISPRCasFinder matches to NZ_CP025510 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvD, complete sequence) position: , mismatch: 2, identity: 0.909

ggtaccgtcctcgccggcggtg	CRISPR spacer
ggcaccgtcctcgccggcggtt	Protospacer
**.******************

30. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP021032 (Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcc	Protospacer
.********************

31. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

32. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

33. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcc	Protospacer
.********************

34. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

35. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

36. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

37. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

38. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
atcgccgatcaggccggcggcg	Protospacer
.********************.

39. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgggg	Protospacer
******************** .

40. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP012698 (Microbacterium sp. No. 7 plasmid A, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
accgccgatcaggccggcggca	Protospacer
..********************

41. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
ctcggcgatcaggccggcggca	Protospacer
 *** *****************

42. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

43. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

44. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

45. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

46. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcg	Protospacer
***************** ***.

47. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
ggcgccgatcaggccggcggcc	Protospacer
* *******************

48. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggcctgcggcg	Protospacer
*************** *****.

49. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatccggccggcggct	Protospacer
********** **********

50. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP024312 (Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgccg	Protospacer
******************* *.

51. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgagcaggccggcggcc	Protospacer
******** ************

52. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.909

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccgggggcc	Protospacer
***************** ***

53. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

54. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

55. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacccgccgaacccgtcg	Protospacer
********** ******* ******

56. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ctcggcggcaaaggcggcattggcgg	Protospacer
 .****************** *****

57. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP022541 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cccggcggcaaaggcgcaatgggcgg	Protospacer
 ***************  ********

58. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP014276 (Martelella sp. AD-3 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atcggcggcaagggcggcatggccgg	Protospacer
*.*********.********** ***

59. spacer 2.27|321424|26|CP019611|CRT matches to MN585973 (Mycobacterium phage StAnnes, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaagggcgg	Protospacer
* ********* ******* ******

60. spacer 2.27|321424|26|CP019611|CRT matches to MG944221 (Mycobacterium phage Scowl, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaagggcgg	Protospacer
* ********* ******* ******

61. spacer 2.27|321424|26|CP019611|CRT matches to KT309034 (Mycobacterium phage Dante, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaagggcgg	Protospacer
* ********* ******* ******

62. spacer 2.27|321424|26|CP019611|CRT matches to NC_021538 (Mycobacterium phage Job42, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaagggcgg	Protospacer
* ********* ******* ******

63. spacer 2.27|321424|26|CP019611|CRT matches to NC_026584 (Mycobacterium phage Minerva, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaagggcgg	Protospacer
* ********* ******* ******

64. spacer 2.27|321424|26|CP019611|CRT matches to KJ409696 (Mycobacterium phage Lamina13, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaggggcgg	Protospacer
* ********* ******* ******

65. spacer 2.27|321424|26|CP019611|CRT matches to NC_028784 (Mycobacterium phage Tasp14, complete genome) position: , mismatch: 3, identity: 0.885

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aacggcggcaacggcggcaggggcgg	Protospacer
* ********* ******* ******

66. spacer 4.11|1119250|27|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.889

ccgccgttggcgaacagtccgccgttg	CRISPR spacer
tcgccgttggcgatcagtccgccgtcg	Protospacer
.************ ***********.*

67. spacer 4.11|1119250|27|CP019611|CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 3, identity: 0.889

ccgccgttggcgaacagtccgccgttg	CRISPR spacer
tcgccgttggcgatcagtccgccgtcg	Protospacer
.************ ***********.*

68. spacer 6.8|1126299|23|CP019611|CRT matches to NZ_CP025550 (Mycobacterium paragordonae strain 49061 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
atgagcccgccagcgccgccgcg	Protospacer
***********.*********.

69. spacer 6.8|1126299|23|CP019611|CRT matches to MT740740 (Ralstonia phage Gervaise, complete genome) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
ctgagcccgccggcgccgccata	Protospacer
 *******************.*

70. spacer 6.8|1126299|23|CP019611|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
atcagcccgccggcgccgccgaa	Protospacer
** ******************

71. spacer 6.8|1126299|23|CP019611|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
tcgagcccgccggcgccgccatt	Protospacer
 .******************.**

72. spacer 6.8|1126299|23|CP019611|CRT matches to MT740732 (Ralstonia phage Darius, complete genome) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
ctgagcccgccggcgccgccata	Protospacer
 *******************.*

73. spacer 6.8|1126299|23|CP019611|CRT matches to MH638294 (Ralstonia phage GP4, complete genome) position: , mismatch: 3, identity: 0.87

atgagcccgccggcgccgccgtt	CRISPR spacer
ctgagcccgccggcgccgccata	Protospacer
 *******************.*

74. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgacctcggcggcgcgggcga	Protospacer
.***************** ****.

75. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccggcctgggcggcgctggcgg	Protospacer
 ****.*** **************

76. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP034768 (Enterobacter sp. N18-03635 plasmid pFRI-6, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

77. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
agccgacctcggcggcgatggcgc	Protospacer
*.*************** *****

78. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_AP019631 (Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

79. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_AP019631 (Enterobacter asburiae strain 17Nkhm-UP2 plasmid pEAS17Nkhm-UP2-1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
taacgtcctcggcggcgctggcgg	Protospacer
 * ** ******************

80. spacer 9.16|1716851|24|CP019611|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

81. spacer 9.16|1716851|24|CP019611|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

82. spacer 9.16|1716851|24|CP019611|CRT matches to MK016502 (Mycobacterium phage Pat3, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

83. spacer 9.16|1716851|24|CP019611|CRT matches to MK937593 (Mycobacterium phage Flypotenuse, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

84. spacer 9.16|1716851|24|CP019611|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
gaccgcgctcggcggcgctggcgg	Protospacer
.****  *****************

85. spacer 9.16|1716851|24|CP019611|CRT matches to MH536820 (Mycobacterium phage Glexan, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
catcggcctcggcggcgctggcgg	Protospacer
 *.**.******************

86. spacer 9.16|1716851|24|CP019611|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
aaccggcctcggcggcgctgccgc	Protospacer
*****.************** **

87. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccgagctcggcggcgctgccgg	Protospacer
 ***** ************* ***

88. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
caccggcctcggcggcgcgggcgg	Protospacer
 ****.************ *****

89. spacer 9.16|1716851|24|CP019611|CRT matches to MH271298 (Microbacterium phage Floof, complete genome) position: , mismatch: 3, identity: 0.875

aaccgacctcggcggcgctggcgg	CRISPR spacer
aacccacctcggcggcgatggcgc	Protospacer
**** ************ *****

90. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to MN703413 (Arthrobacter phage Powerpuff, complete genome) position: , mismatch: 3, identity: 0.88

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgcgggcggcctcggcgtagcgctt	Protospacer
*** *******************..

91. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to MT024871 (Arthrobacter phage YesChef, complete genome) position: , mismatch: 3, identity: 0.88

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgcgggcggcctcggcgtagcgctt	Protospacer
*** *******************..

92. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtgag	Protospacer
.*******************

93. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP040721 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
gtgcggcggtgccggcggtgtc	Protospacer
   *******************

94. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP040721 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
gtgcggcggtgccggcggtgtc	Protospacer
   *******************

95. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtgag	Protospacer
.*******************

96. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
cgtcggcggtgccggcggtggt	Protospacer
.******************* .

97. spacer 11.7|2003515|22|CP019611|CRISPRCasFinder matches to KT381864 (Thiobacimonas phage vB_ThpS-P1, complete genome) position: , mismatch: 3, identity: 0.864

tgtcggcggtgccggcggtgtc	CRISPR spacer
catcggcggtgccggcggtgtg	Protospacer
..*******************

98. spacer 11.11|2003698|22|CP019611|CRISPRCasFinder matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.864

gctgtggggcggcggtggtgcc	CRISPR spacer
cgtgtggggcggcggtggtgca	Protospacer
  *******************

99. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 3, identity: 0.864

gtcgccgatcaggccggcggca	CRISPR spacer
gtcgccgatcaggccggcgcgg	Protospacer
*******************  .

100. spacer 12.4|2359236|22|CP019611|CRISPRCasFinder matches to NZ_CP021649 (Acidovorax sp. T1 plasmid p1-T1, complete sequence) position: , mismatch: 3, identity: 0.864

gtcgccgatcaggccggcggca	CRISPR spacer
ttcgccgatcaggccggcggtg	Protospacer
 *******************..

101. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
ctcgccgaacacgcggaagccgtct	Protospacer
**.*********** *********

102. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
attgtcgaacacgcggaagccgtcg	Protospacer
 ***.********* **********

103. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

104. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NC_031254 (Arthrobacter phage Kitkat, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

105. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaactcgccgaagccgttg	Protospacer
 ********* ************.*

106. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
catgcggaacacgccgaatccgtcg	Protospacer
* *** ************ ******

107. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgatcacgccgtagccgttg	Protospacer
******** ******* ******.*

108. spacer 12.15|2360055|22|CP019611|CRISPRCasFinder matches to NC_008270 (Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence) position: , mismatch: 3, identity: 0.864

caatccggcggcgccgccggca	CRISPR spacer
gaatccggcggcgccgccgggc	Protospacer
 *******************

109. spacer 13.5|2875288|24|CP019611|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 3, identity: 0.875

atcgaagaagctgaacccgccgtt	CRISPR spacer
cgcgaagaagctgaagccgccgtt	Protospacer
  ************* ********

110. spacer 13.5|2875288|24|CP019611|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 3, identity: 0.875

atcgaagaagctgaacccgccgtt	CRISPR spacer
cgcgaagaagctgaagccgccgtt	Protospacer
  ************* ********

111. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013224 (Salmonella enterica subsp. enterica serovar Anatum strain GT-38 plasmid PDM04, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

112. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KX470734 (Escherichia coli strain Ecoli14-55 plasmid pEC55-NDM4, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

113. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KY296103 (Enterobacter cloacae strain 13E169 plasmid pHN84NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

114. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KY978629 (Cronobacter sakazakii strain 505108 plasmid p505108-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

115. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF072961 (Citrobacter freundii strain P10159 plasmid pP10159-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

116. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042356 (Enterobacter cloacae strain 20ES plasmid pNDM_20ES, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

117. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042359 (Serratia marcescens strain 7209 plasmid pNDM_7209, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

118. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KU726616 (Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

119. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KU314941 (Klebsiella pneumoniae isolate KP04 plasmid pKP04NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

120. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KX094555 (Escherichia coli strain ZHDC33 plasmid pZHDC33, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

121. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

122. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KR059864 (Klebsiella pneumoniae strain KP-YQ13450 plasmid pYQ12450, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

123. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KP987216 (Citrobacter freundii strain 112298 plasmid p112298-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

124. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP022126 (Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

125. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

126. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

127. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

128. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP028588 (Escherichia coli strain WCHEC4533 plasmid pNDM4_000533, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

129. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041930 (Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374C, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

130. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP048296 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

131. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP028560 (Acinetobacter sp. WCHA45 plasmid pNDM1_010045, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

132. spacer 2.27|321424|26|CP019611|CRT matches to NC_018994 (Escherichia coli plasmid pNDM-1_Dok01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

133. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

134. spacer 2.27|321424|26|CP019611|CRT matches to NC_019153 (Klebsiella pneumoniae plasmid pNDM-KN, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

135. spacer 2.27|321424|26|CP019611|CRT matches to NC_019162 (Klebsiella pneumoniae strain CRE380 plasmid pNDM-HN380, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

136. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032878 (Escherichia coli strain WCHEC000837 plasmid pNDM4_000837, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

137. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP018817 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

138. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ctcggccgcaaaggcggcattggcgg	Protospacer
 .**** ************* *****

139. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ctcggccgcaaaggcggcattggcgg	Protospacer
 .**** ************* *****

140. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggccggaaaggcggcatgggcgg	Protospacer
 * *** * *****************

141. spacer 2.27|321424|26|CP019611|CRT matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

142. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041642 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-NDM4, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

143. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP048828 (Acinetobacter baumannii strain ABF9692 plasmid pABF9692, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

144. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021206 (Escherichia coli strain Z1002 plasmid p1002-NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

145. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP050416 (Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

146. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032284 (Acinetobacter sp. WCHA55 plasmid pNDM1_010055, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

147. spacer 2.27|321424|26|CP019611|CRT matches to NC_020811 (Klebsiella pneumoniae strain KPN5047 plasmid pKPN5047, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

148. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP030191 (Salmonella enterica strain SA20104250 plasmid pSA20104250.1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

149. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP050426 (Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

150. spacer 2.27|321424|26|CP019611|CRT matches to NC_023914 (Enterobacter cloacae strain CRE727 plasmid pNDM-HF727, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

151. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP044035 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

152. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP029118 (Escherichia coli strain AR435 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

153. spacer 2.27|321424|26|CP019611|CRT matches to NC_019123 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH1148_107, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

154. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

155. spacer 2.27|321424|26|CP019611|CRT matches to MN178638 (Kluyvera cryocrescens strain SCW13 plasmid pNDM1_SCW13, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

156. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP038280 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

157. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

158. spacer 2.27|321424|26|CP019611|CRT matches to CP050158 (Enterobacter cloacae plasmid Carbapenemase(NDM-1)_IncX3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

159. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

160. spacer 2.27|321424|26|CP019611|CRT matches to CP050161 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncX3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

161. spacer 2.27|321424|26|CP019611|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

162. spacer 2.27|321424|26|CP019611|CRT matches to NC_021501 (Klebsiella michiganensis E718 plasmid pKOX_NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

163. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP017672 (Providencia rettgeri strain RB151 plasmid pRB151-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

164. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP023914 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

165. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP029386 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pNDM6_040074, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

166. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaaagcggcctgggcgg	Protospacer
. **********.***** *******

167. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP022226 (Escherichia coli strain WCHEC96200 plasmid pNDM4_WCHEC96200, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

168. spacer 2.27|321424|26|CP019611|CRT matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

169. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

170. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtcggcggcaatggcggcgtgggcgg	Protospacer
..********* ******.*******

171. spacer 2.27|321424|26|CP019611|CRT matches to NC_020552 (Citrobacter freundii plasmid pYE315203, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

172. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP040598 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15_NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

173. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP014297 (Klebsiella pneumoniae strain KP38731 plasmid unnamed13 sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

174. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaatggcggcattggcct	Protospacer
*********** ******** ***

175. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020056 (Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

176. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP031884 (Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

177. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

178. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

179. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP031297 (Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

180. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041229 (Acinetobacter haemolyticus strain AN54 plasmid pAhaeAN54e, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

181. spacer 2.27|321424|26|CP019611|CRT matches to NZ_LT985293 (Escherichia coli strain 4410-1 plasmid RCS79_p, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

182. spacer 2.27|321424|26|CP019611|CRT matches to NZ_LT985268 (Escherichia coli strain 699 plasmid RCS58_p, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

183. spacer 2.27|321424|26|CP019611|CRT matches to MN604267 (Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

184. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK372385 (Morganella morganii strain ABC140 plasmid pABC140-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

185. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK372381 (Klebsiella pneumoniae strain ABC52 plasmid pABC52-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

186. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053899 (Proteus mirabilis strain YPM35 plasmid pJPM35-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

187. spacer 2.27|321424|26|CP019611|CRT matches to MN657249 (Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

188. spacer 2.27|321424|26|CP019611|CRT matches to MN657250 (Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

189. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909333 (Klebsiella pneumoniae strain 7-SP plasmid p7SP-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

190. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909346 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

191. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909335 (Klebsiella pneumoniae strain 11-SP plasmid p11SP-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

192. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH234505 (Escherichia coli strain CRE3694 plasmid pNDM-HK3694, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

193. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH917282 (Klebsiella pneumoniae strain A457 plasmid pA457-NDA, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

194. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH349095 (Escherichia coli strain 948 plasmid pMTC948, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

195. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK372386 (Klebsiella pneumoniae strain BC700 plasmid pBC700-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

196. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK372380 (Enterobacter cloacae strain ABC40 plasmid pABC40-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

197. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK372382 (Escherichia coli strain ABC54 plasmid pABC54-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

198. spacer 2.27|321424|26|CP019611|CRT matches to MN657241 (Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

199. spacer 2.27|321424|26|CP019611|CRT matches to MN657242 (Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

200. spacer 2.27|321424|26|CP019611|CRT matches to MN657243 (Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

201. spacer 2.27|321424|26|CP019611|CRT matches to MN657244 (Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

202. spacer 2.27|321424|26|CP019611|CRT matches to MN657247 (Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

203. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MG462728 (Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

204. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH457126 (Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

205. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH105052 (Escherichia coli strain EC600 plasmid pSL131T_IncX3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

206. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP044464 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

207. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042350 (Klebsiella pneumoniae strain 18ES plasmid pNDM_18ES, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

208. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042354 (Klebsiella pneumoniae strain 6TM plasmid pNDM_6TM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

209. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042353 (Klebsiella pneumoniae strain 1TM plasmid pNDM_1TM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

210. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042351 (Serratia marcescens strain 12TM plasmid pNDM_12TM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

211. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042358 (Enterobacter cloacae strain 22ES plasmid pNDM_22ES, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

212. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF415608 (Enterobacter cloacae strain hhy03 plasmid pNDM-BJ03, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

213. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042352 (Serratia marcescens strain 4TM plasmid pNDM_4TM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

214. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF042357 (Serratia marcescens strain 9580 plasmid pNDM_9580, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

215. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MG252893 (Raoultella ornithinolytica strain pRor-30818cz plasmid Ror-30818cz, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

216. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041048 (Citrobacter sp. CF971 plasmid pBM527-2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

217. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KX832927 (Providencia rettgeri strain 16pre36 plasmid p16Pre36-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

218. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KX786648 (Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

219. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KY399975 (Enterobacter cloacae strain EClY2403 plasmid pNDM1_EClY2403, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

220. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KY399974 (Enterobacter cloacae strain EClY2402 plasmid pNDM1_EClY2402, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

221. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053895 (Proteus mirabilis strain JPM24 plasmid pJPM24, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

222. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP023051 (Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

223. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP034756 (Enterobacter hormaechei subsp. hoffmannii strain Eh1 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

224. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KX636095 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

225. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

226. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

227. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KJ588779 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

228. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KR351290 (Klebsiella pneumoniae subsp. pneumoniae strain K351 plasmid pK351, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

229. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KJ802405 (Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

230. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KJ812998 (Enterobacter cloacae isolate GN574 plasmid pNDM-Ec1GN574, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

231. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KP900016 (Leclercia adecarboxylata strain P10164 plasmid pP10164-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

232. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KP765744 (Enterobacter cloacae strain ECN49 plasmid pNDM-ECN49, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

233. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KP868647 (Enterobacter cloacae strain WCHECl-14653 plasmid pNDM1_EC14653, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

234. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KJ802404 (Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

235. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KT965092 (Acinetobacter towneri strain G165 plasmid pNDM-GJ01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

236. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KT965093 (Acinetobacter towneri strain G295 plasmid pNDM-GJ02, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

237. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053729 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

238. spacer 2.27|321424|26|CP019611|CRT matches to NC_023322 (Acinetobacter bereziniae strain CHI-40-1 plasmid pNDM-40-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

239. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP029731 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

240. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053737 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

241. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KC887916 (Escherichia coli strain ARL10/167 isolate EC4 plasmid pEC4-NDM-6, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

242. spacer 2.27|321424|26|CP019611|CRT matches to NZ_KC887917 (Enterobacter cloacae isolate ECL3 plasmid pECL3-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

243. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020524 (Escherichia coli strain 190 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

244. spacer 2.27|321424|26|CP019611|CRT matches to MT077883 (Escherichia coli plasmid p23, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

245. spacer 2.27|321424|26|CP019611|CRT matches to NC_009838 (Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

246. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010370 (Acinetobacter nosocomialis strain 6411 plasmid p6411-9.012kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

247. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013221 (Salmonella enterica subsp. enterica serovar Anatum strain GT-01 plasmid PDM02, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

248. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP024285 (Escherichia albertii strain 2014C-4356 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

249. spacer 2.27|321424|26|CP019611|CRT matches to MN061454 (Enterobacter cloacae strain EC-14-60 plasmid pECL-14-60-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

250. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032278 (Acinetobacter sp. WCHAc010034 plasmid pNDM1_010034, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

251. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP045561 (Acinetobacter nosocomialis strain AC1530 plasmid pAC1530, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

252. spacer 2.27|321424|26|CP019611|CRT matches to NC_019045 (Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

253. spacer 2.27|321424|26|CP019611|CRT matches to NC_025130 (Raoultella planticola strain RJA274 plasmid NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

254. spacer 2.27|321424|26|CP019611|CRT matches to NC_019158 (Klebsiella pneumoniae plasmid pNDM10469, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

255. spacer 2.27|321424|26|CP019611|CRT matches to MN310375 (Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

256. spacer 2.27|321424|26|CP019611|CRT matches to MN310377 (Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

257. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

258. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

259. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP037965 (Klebsiella pneumoniae strain SCKP020135 plasmid pNDM1_020135, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

260. spacer 2.27|321424|26|CP019611|CRT matches to NC_025184 (Klebsiella pneumoniae strain RJF866 plasmid pRJF866, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

261. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP011518 (Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcagaggcggcaagggcgg	Protospacer
. ********.******** ******

262. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

263. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021962 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000008, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

264. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP022350 (Klebsiella michiganensis strain K516 plasmid pK516_NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

265. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP046274 (Enterobacter hormaechei strain E70 plasmid pE70-NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

266. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP039811 (Klebsiella pneumoniae strain C2660 plasmid pC2660-4-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

267. spacer 2.27|321424|26|CP019611|CRT matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

268. spacer 2.27|321424|26|CP019611|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ctcggccgcaaaggcggcattggcgg	Protospacer
 .**** ************* *****

269. spacer 2.27|321424|26|CP019611|CRT matches to NC_025000 (Acinetobacter lwoffii strain Iz4b plasmid pNDM-Iz4b, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

270. spacer 2.27|321424|26|CP019611|CRT matches to NC_024959 (Acinetobacter calcoaceticus strain NDM-WS2 plasmid pNDM-WS2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

271. spacer 2.27|321424|26|CP019611|CRT matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

272. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

273. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021536 (Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

274. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010399 (Acinetobacter baumannii strain 6200 plasmid p6200-47.274kb, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

275. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP035935 (Acinetobacter cumulans strain WCHAc060092 plasmid pNDM1_060092, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

276. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP006661 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

277. spacer 2.27|321424|26|CP019611|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaaggcggcaagagcgg	Protospacer
. ***************** *.****

278. spacer 2.27|321424|26|CP019611|CRT matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

279. spacer 2.27|321424|26|CP019611|CRT matches to CP050164 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

280. spacer 2.27|321424|26|CP019611|CRT matches to MK933278 (Enterobacter hormaechei strain SCNJ07 plasmid pNDM-SCNJ07, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

281. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

282. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaacgcggcctgggcgg	Protospacer
. ********** ***** *******

283. spacer 2.27|321424|26|CP019611|CRT matches to CP048298 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

284. spacer 2.27|321424|26|CP019611|CRT matches to NC_019066 (Escherichia coli plasmid pAPEC1990_61, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

285. spacer 2.27|321424|26|CP019611|CRT matches to NC_019069 (Escherichia coli plasmid pNDM10505, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

286. spacer 2.27|321424|26|CP019611|CRT matches to AMXH01000087 (Acinetobacter pittii strain XM1570 plasmid pXM1, complete sequence, whole genome shotgun sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

287. spacer 2.27|321424|26|CP019611|CRT matches to NZ_JQ739158 (Acinetobacter lwoffii strain ABZ78 plasmid pABZ78, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

288. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP043383 (Enterobacter hormaechei subsp. xiangfangensis strain WCHEX045001 plasmid pNDM1_045001, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

289. spacer 2.27|321424|26|CP019611|CRT matches to NC_019985 (Acinetobacter baumannii ZW85-1 plasmid pAbNDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

290. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

291. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP018366 (Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

292. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP023187 (Klebsiella michiganensis strain K518 plasmid pK518_NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

293. spacer 2.27|321424|26|CP019611|CRT matches to NC_021813 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

294. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP028786 (Klebsiella pneumoniae strain SCKP020049 plasmid pNDM1_020049, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

295. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021936 (Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

296. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

297. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP023948 (Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

298. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041938 (Klebsiella pneumoniae strain KP14003 plasmid pNDM-KP14003, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

299. spacer 2.27|321424|26|CP019611|CRT matches to NC_022589 (Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

300. spacer 2.27|321424|26|CP019611|CRT matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

301. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP015835 (Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

302. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

303. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP014478 (Acinetobacter pittii strain AP_882 plasmid pNDM-AP_882, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

304. spacer 2.27|321424|26|CP019611|CRT matches to NC_023908 (Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

305. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

306. spacer 2.27|321424|26|CP019611|CRT matches to NC_019268 (Acinetobacter lwoffii plasmid pNDM-BJ01, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

307. spacer 2.27|321424|26|CP019611|CRT matches to NC_019281 (Acinetobacter lwoffii plasmid pNDM-BJ02, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

308. spacer 2.27|321424|26|CP019611|CRT matches to NC_025116 (Acinetobacter sp. M131 plasmid pM131_NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

309. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP040884 (Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

310. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP026015 (Klebsiella variicola strain 13450 plasmid p13450-3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

311. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP018143 (Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

312. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ctcggccgcaaaggcggcattggcgg	Protospacer
 .**** ************* *****

313. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP048797 (Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

314. spacer 2.27|321424|26|CP019611|CRT matches to MN937240 (Enterobacter cloacae strain BSI034 plasmid pBSI034-NDM1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

315. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP037904 (Escherichia coli strain LHM10-1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

316. spacer 2.27|321424|26|CP019611|CRT matches to MN603981 (Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

317. spacer 2.27|321424|26|CP019611|CRT matches to MN604268 (Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

318. spacer 2.27|321424|26|CP019611|CRT matches to NZ_LN833432 (Acinetobacter baumannii isolate CHI-32 plasmid pNDM-32, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

319. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK123268 (Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

320. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP053897 (Providencia rettgeri strain YPR31 plasmid pYPR31, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

321. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032132 (Acinetobacter chinensis strain WCHAc010005 plasmid pNDM1_010005, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

322. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH995508 (Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

323. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH995506 (Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

324. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH917283 (Klebsiella pneumoniae strain A575 plasmid pA575-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

325. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909345 (Klebsiella pneumoniae strain N201205880 plasmid p205880-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

326. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH105050 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

327. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909343 (Klebsiella pneumoniae strain 1012018 plasmid p12018-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

328. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH909347 (Klebsiella pneumoniae strain 362713 plasmid p362713-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

329. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH263652 (Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

330. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MH917281 (Klebsiella pneumoniae strain 14504 plasmid p14504-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

331. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK101346 (Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

332. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MK757441 (Alcaligenes faecalis strain AN70 plasmid pAN70-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

333. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP020090 (Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

334. spacer 2.27|321424|26|CP019611|CRT matches to MN657245 (Enterobacteriaceae bacterium strain 23-16 plasmid pEC6332-T6, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

335. spacer 2.27|321424|26|CP019611|CRT matches to MN657246 (Enterobacteriaceae bacterium strain 23-17 plasmid pEC6332-T7, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

336. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MF344560 (Enterobacter hormaechei strain 128379 plasmid p128379-NDM, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

337. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MG462729 (Escherichia coli strain AMA1742 plasmid pAMA1742, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

338. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP035537 (Klebsiella pneumoniae subsp. pneumoniae strain CCRI-22199 plasmid pKp199-2, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

339. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

340. spacer 2.27|321424|26|CP019611|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

341. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcatgggcggcatgggcgg	Protospacer
. ******** .**************

342. spacer 2.27|321424|26|CP019611|CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

343. spacer 2.27|321424|26|CP019611|CRT matches to MK994522 (Methanobacterium virus PhiF1, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaaggcggcaagggagg	Protospacer
. ***************** *** **

344. spacer 2.27|321424|26|CP019611|CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

345. spacer 2.27|321424|26|CP019611|CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

346. spacer 2.27|321424|26|CP019611|CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

347. spacer 2.27|321424|26|CP019611|CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

348. spacer 2.27|321424|26|CP019611|CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcaagggcggcaagggcgg	Protospacer
 * ********.******* ******

349. spacer 2.27|321424|26|CP019611|CRT matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcatgggcggcatgggcgg	Protospacer
*. ******* .**************

350. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggccggaaaggcggcatgggcgg	Protospacer
 * *** * *****************

351. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aagggcggcaagggcggcatcggcgg	Protospacer
*  ********.******** *****

352. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cctggcggcatgggcggcatgggcgg	Protospacer
 *.******* .**************

353. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggccggaaaggcggcatgggcgg	Protospacer
 * *** * *****************

354. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcatgggcggcatgggcgg	Protospacer
*. ******* .**************

355. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP046705 (Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
aagggcggcaatggcggcatcggcgg	Protospacer
*  ******** ******** *****

356. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tcaggcggcaaaggcggcagcggcgg	Protospacer
 * ****************  *****

357. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP011481 (Hoeflea sp. IMCC20628 plasmid, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gcgggcggcacagccggcatgggcgg	Protospacer
.* ******* ** ************

358. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP023072 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ccgggcggcatgggcggcatgggcgg	Protospacer
 * ******* .**************

359. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tcaggcggcaaaggcggcagcggcgg	Protospacer
 * ****************  *****

360. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tcaggcggcaaaggcggcagcggcgg	Protospacer
 * ****************  *****

361. spacer 2.27|321424|26|CP019611|CRT matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cctggcggcatgggcggcatgggcgg	Protospacer
 *.******* .**************

362. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gcgggcggcaacggcggcaggggcgg	Protospacer
.* ******** ******* ******

363. spacer 2.27|321424|26|CP019611|CRT matches to JN698993 (Mycobacterium phage Firecracker, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcaagggcggcaagggcgg	Protospacer
*. ********.******* ******

364. spacer 2.27|321424|26|CP019611|CRT matches to MN694268 (Marine virus AFVG_250M110, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcatgggcggcatgggcgg	Protospacer
*. ******* .**************

365. spacer 2.27|321424|26|CP019611|CRT matches to MN694268 (Marine virus AFVG_250M110, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcatgggcggcatgggcgg	Protospacer
*. ******* .**************

366. spacer 2.27|321424|26|CP019611|CRT matches to MN694268 (Marine virus AFVG_250M110, complete genome) position: , mismatch: 4, identity: 0.846

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atgggcggcatgggcggcatgggcgg	Protospacer
*. ******* .**************

367. spacer 6.6|1126185|29|CP019611|CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

--ccggtccccgtgctggccctcccgccggc	CRISPR spacer
gtccgg--cccgtgctggcccacccgccgac	Protospacer
  ****  ************* *******.*

368. spacer 6.6|1126185|29|CP019611|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 4, identity: 0.862

--ccggtccccgtgctggccctcccgccggc	CRISPR spacer
tgccgg--cccgtgctggcgcgcccgccggc	Protospacer
  ****  *********** * *********

369. spacer 6.6|1126185|29|CP019611|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 4, identity: 0.862

--ccggtccccgtgctggccctcccgccggc	CRISPR spacer
tgccgg--cccgtgctggcgcgcccgccggc	Protospacer
  ****  *********** * *********

370. spacer 7.1|1154227|27|CP019611|CRISPRCasFinder matches to NC_023591 (Mycobacterium phage Adler, complete genome) position: , mismatch: 4, identity: 0.852

-aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
cagtgc-ccggtgtccccatcgcccgtg	Protospacer
 *..** ********* ***********

371. spacer 7.1|1154227|27|CP019611|CRISPRCasFinder matches to KF981876 (UNVERIFIED: Mycobacterium phage ADLER F1725, complete genome) position: , mismatch: 4, identity: 0.852

-aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
cagtgc-ccggtgtccccatcgcccgtg	Protospacer
 *..** ********* ***********

372. spacer 7.7|1154623|27|CP019611|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 4, identity: 0.852

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
ccgaagccgatgtcgtagcggccggcg	Protospacer
 ************.***** *****.*

373. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgaaggtgaggtcgccgggg	Protospacer
.* ********* ***********.**

374. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NC_016652 (Rhodococcus phage REQ2, complete genome) position: , mismatch: 4, identity: 0.852

accccgccgaagttgaggtcgccgagg	CRISPR spacer
acggcgccgaagttgaggccgccgacg	Protospacer
**  **************.****** *

375. spacer 9.10|1716566|27|CP019611|CRT matches to KY945355 (Mycobacterium phage Shandong1, complete genome) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgcatccggcggcggcggttgcgttct	Protospacer
** **************** ***** .

376. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggcctcggcggcggcggtggcgttgc	Protospacer
*** ..*************.*******

377. spacer 9.10|1716566|27|CP019611|CRT matches to NC_041888 (Mycobacterium phage Tortellini, complete genome) position: , mismatch: 4, identity: 0.852

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggccgcggcggcggcggtagcggtgc	Protospacer
*** . ***************** ***

378. spacer 9.15|1716803|30|CP019611|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.867

cctgctgttcggctccggcggcgctggcgg-	CRISPR spacer
gctgctgttcggcgccggcggcg-tggtggc	Protospacer
 ************ ********* ***.**

379. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ctacgaccacggcggcgctggcgg	Protospacer
   ***** ***************

380. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
gcccgatctcggcggcgctggcgt	Protospacer
. ****.****************

381. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tcccgacctcggcggtgctggcgc	Protospacer
  *************.*******

382. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP016822 (Rhodococcus sp. p52 plasmid pDF03, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cgtcgacgtcggcggcgctggcgg	Protospacer
 ..**** ****************

383. spacer 9.16|1716851|24|CP019611|CRT matches to MN582086 (Siphoviridae sp. ctdEk19, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cttcgacttcggcggcgctggcgg	Protospacer
  .****.****************

384. spacer 9.16|1716851|24|CP019611|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

385. spacer 9.16|1716851|24|CP019611|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

386. spacer 9.16|1716851|24|CP019611|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

387. spacer 9.16|1716851|24|CP019611|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ccgcggcctcggcggcgctggcgg	Protospacer
   **.******************

388. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
cgccgacctcggcggcggtggcga	Protospacer
 .*************** *****.

389. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tcccgacctcggcggtgctggcgc	Protospacer
  *************.*******

390. spacer 9.16|1716851|24|CP019611|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ctacgaccacggcggcgctggcgg	Protospacer
   ***** ***************

391. spacer 9.16|1716851|24|CP019611|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tctcgacctcggcggcgatggcgg	Protospacer
  .************** ******

392. spacer 9.16|1716851|24|CP019611|CRT matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
tgccgacctcggctgcgctggcgc	Protospacer
 .*********** *********

393. spacer 9.16|1716851|24|CP019611|CRT matches to MK279853 (Gordonia phage Gray, complete genome) position: , mismatch: 4, identity: 0.833

aaccgacctcggcggcgctggcgg	CRISPR spacer
ggtcgacctcgacggcgctggcgg	Protospacer
...********.************

394. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggcggcctcggcggagcgctg	Protospacer
 **************** *****.

395. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggcggcctcggcggagcgctg	Protospacer
 **************** *****.

396. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

397. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to CP003956 (Rhodococcus opacus PD630 plasmid 7, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
gtccggcggccttggcgtagcgcct	Protospacer
  **********.***********.

398. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

399. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NC_012723 (Burkholderia glumae BGR1 plasmid bglu_1p, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggccccggcgtcgcgcga	Protospacer
***********.****** ****

400. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtaatggtc	Protospacer
*******************..* .*

401. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggcatcggcgtagcggcg	Protospacer
.********* *********** *

402. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggcctccgcgtcgcgcct	Protospacer
.************ **** *****.

403. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgtcggcggcctcggcgtagcgggc	Protospacer
.*.*******************  *

404. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NC_022437 (Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggcggccgcgtcgtagcgcca	Protospacer
.********** ** *********

405. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

406. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggtgtcctcggcgtagcgcga	Protospacer
******.* **************

407. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP051294 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctccgcgaagcgctt	Protospacer
************* *** *****..

408. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
ggccggctgcctcggcatagcgccg	Protospacer
 ****** ********.*******

409. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

410. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgccggtggcctcggcgtagccccg	Protospacer
.*****.************** **

411. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP033363 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctccgcgaagcgctt	Protospacer
************* *** *****..

412. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tggcggcggcctcgccgtagcgctt	Protospacer
** *********** ********..

413. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
cgtcggcggcctcggcgtagcggac	Protospacer
.*.*******************  *

414. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP014580 (Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
agccggcggcctcggcctcgcgccg	Protospacer
 *************** * *****

415. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 4, identity: 0.84

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgtcggcggcctcgccgtagcgctt	Protospacer
**.*********** ********..

416. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

417. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

418. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.857

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gccgccgggggtgccctcgttgccgggc	Protospacer
*..************ ********** *

419. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP021372 (Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
tccgccgaacgcgccgaagccgtcg	Protospacer
...*******.**************

420. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gctgccgaacacgccgatgccgacg	Protospacer
 .*************** **** **

421. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gctgccgaacacgccgatgccgacg	Protospacer
 .*************** **** **

422. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to MT553342 (Microbacterium phage Kelcole, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

423. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NC_048068 (Microbacterium phage OneinaGillian, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

424. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to MT310894 (Microbacterium phage Tempo, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gatgctgatcacgccgaagccgtcg	Protospacer
  ***.** ****************

425. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cttgccgaacacgccgatgccctgc	Protospacer
***************** *** *

426. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
aatgccgaattcgccgaagccgtcg	Protospacer
  *******. **************

427. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to MN034284 (Leviviridae sp. isolate H2_Rhizo_Litter_49_scaffold_25938 sequence) position: , mismatch: 4, identity: 0.84

cttgccgaacacgccgaagccgtcg	CRISPR spacer
cccgtagaacacgccgaagccgtcg	Protospacer
*..*. *******************

428. spacer 12.14|2359998|25|CP019611|CRISPRCasFinder matches to MN582064 (Podoviridae sp. ctka020, complete genome) position: , mismatch: 4, identity: 0.84

cttgccgccaccgacccccccttgc	CRISPR spacer
ttttccgacaccgacccccccttga	Protospacer
.** *** ****************

429. spacer 13.5|2875288|24|CP019611|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
atcgaagaagctgaacacgcccgc	Protospacer
**************** ****  .

430. spacer 13.5|2875288|24|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
gtcgatgaagctgaacccgccgaa	Protospacer
.**** ****************

431. spacer 13.5|2875288|24|CP019611|CRT matches to NZ_CP015007 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence) position: , mismatch: 4, identity: 0.833

atcgaagaagctgaacccgccgtt	CRISPR spacer
atcggagaagctgaacccgcccgg	Protospacer
****.****************

432. spacer 1.7|109916|31|CP019611|CRT matches to NC_010850 (Rhodococcus sp. NS1 plasmid pNSL1, complete sequence) position: , mismatch: 5, identity: 0.839

aacgccc-acttcaccgccgttgccgccgtca	CRISPR spacer
-acacccgacttcaccgccgctgccgccgaga	Protospacer
 **.*** ************.********  *

433. spacer 2.13|320290|32|CP019611|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 5, identity: 0.844

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agcagcgccaccggcggggccggcggcgactc	Protospacer
*. .*** *****************.******

434. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP054842 (Acidovorax sp. 16-35-5 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.857

agcagcggtgccggcggcaccaacggctccggcgg-	CRISPR spacer
cgcatcggtgccggcggcaccatcggc-acggcggc	Protospacer
 *** ***************** ****  ******

435. spacer 2.21|320899|32|CP019611|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 5, identity: 0.844

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agcagcgccaccggcggggccggcggcgactc	Protospacer
*. .*** *****************.******

436. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggccaaggcggcatcggcgc	Protospacer
. ******* ********** ****

437. spacer 2.27|321424|26|CP019611|CRT matches to CP047389 (Agrobacterium sp. CGMCC 11546 plasmid pA) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcatccacct	Protospacer
********************  .*

438. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010957 (Sphingobium sp. YBL2 plasmid 3pYBL2-3, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gacggcggcgaaggcggcacgggcgc	Protospacer
. *******.*********.*****

439. spacer 2.27|321424|26|CP019611|CRT matches to NC_007713 (Sodalis glossinidius str. 'morsitans' plasmid pSG1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cccggcggcgaaggcggcctgggcca	Protospacer
 ********.******** ***** .

440. spacer 2.27|321424|26|CP019611|CRT matches to NC_014840 (Pantoea sp. At-9b plasmid pPAT9B03, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atcgtcggcaaaggcggcatggggcc	Protospacer
*.** ******************

441. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaaggtggcatcggcga	Protospacer
. ************.***** ****.

442. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gccggcggcaatgtcggcatgggcac	Protospacer
.********** * **********.

443. spacer 2.27|321424|26|CP019611|CRT matches to NZ_LN854558 (Sodalis glossinidius str. 'morsitans' isolate B4 plasmid pSG1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cccggcggcgaaggcggcctgggcca	Protospacer
 ********.******** ***** .

444. spacer 2.27|321424|26|CP019611|CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gccggcggcaaaggcggcatctgtgt	Protospacer
.*******************  *.*

445. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
atcgtcggcaaaggcggcatggggcc	Protospacer
*.** ******************

446. spacer 2.27|321424|26|CP019611|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcgacggcggcatgggcgt	Protospacer
. *******.* *************

447. spacer 2.27|321424|26|CP019611|CRT matches to NC_007182 (Sodalis glossinidius pSG1 plasmid from Glossina austeni) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cccggcggcgaaggcggcctgggcca	Protospacer
 ********.******** ***** .

448. spacer 2.27|321424|26|CP019611|CRT matches to NC_007183 (Sodalis glossinidius pSG1 plasmid from Glossina palpalis palpalis) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cccggcggcgaaggcggcctgggcca	Protospacer
 ********.******** ***** .

449. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaacggcggcatcgggca	Protospacer
*********** ******** **  .

450. spacer 2.27|321424|26|CP019611|CRT matches to NZ_AP022338 (Mameliella alba strain KU6B plasmid pKUB257, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
acaggcggcaagggcggcatgggtca	Protospacer
** ********.***********. .

451. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaccggcggcatgggcaa	Protospacer
 *********  ************..

452. spacer 2.27|321424|26|CP019611|CRT matches to NC_042098 (Erwinia phage vB_EamM_Desertfox, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaaaggcgtcatggatga	Protospacer
 *************** *****..*.

453. spacer 2.27|321424|26|CP019611|CRT matches to MG655267 (Erwinia phage vB_EamM_Bosolaphorus, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaaaggcgtcatggatga	Protospacer
 *************** *****..*.

454. spacer 2.27|321424|26|CP019611|CRT matches to MG655269 (Erwinia phage vB_EamM_MadMel, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaaaggcgtcatggatga	Protospacer
 *************** *****..*.

455. spacer 2.27|321424|26|CP019611|CRT matches to KF806589 (Erwinia phage Ea35-70, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaaaggcgtcatggatga	Protospacer
 *************** *****..*.

456. spacer 2.27|321424|26|CP019611|CRT matches to KU886223 (Erwinia phage vB_EamM_Simmy50, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
tccggcggcaaaggcgtcatggatga	Protospacer
 *************** *****..*.

457. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaacggcggcatcgggca	Protospacer
*********** ******** **  .

458. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

459. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcacaggcggcacgggcgg	Protospacer
.. ******* ********.******

460. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaacggcggcatcgggca	Protospacer
*********** ******** **  .

461. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gccggcggcaagggcggcacgggcct	Protospacer
.**********.*******.****

462. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP010860 (Marinovum algicola DG 898 plasmid pMaD5, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggcggcggcaaaggcggcgagggcga	Protospacer
. ****************. *****.

463. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaacggcggcatcgggca	Protospacer
*********** ******** **  .

464. spacer 2.27|321424|26|CP019611|CRT matches to AY129335 (Mycobacterium virus Corndog, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

465. spacer 2.27|321424|26|CP019611|CRT matches to NC_004685 (Mycobacterium phage Corndog, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

466. spacer 2.27|321424|26|CP019611|CRT matches to MG099943 (Mycobacterium phage Familton, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

467. spacer 2.27|321424|26|CP019611|CRT matches to MN585964 (Mycobacterium phage Blessica, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

468. spacer 2.27|321424|26|CP019611|CRT matches to KJ829260 (Mycobacterium phage YungJamal, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

469. spacer 2.27|321424|26|CP019611|CRT matches to NC_022057 (Mycobacterium phage Catdawg, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

470. spacer 2.27|321424|26|CP019611|CRT matches to MN428052 (Mycobacterium phage Smooch, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gtgggcggcaagggcggcaagggcgg	Protospacer
.. ********.******* ******

471. spacer 2.27|321424|26|CP019611|CRT matches to NC_048047 (Caulobacter phage CcrBL9, complete genome) position: , mismatch: 5, identity: 0.808

accggcggcaaaggcggcatgggcgg	CRISPR spacer
ggtggcggcgcaggcggcatgggcgg	Protospacer
. .******. ***************

472. spacer 4.2|1118770|27|CP019611|CRT matches to MN103533 (Mycobacterium phage Weirdo19, complete genome) position: , mismatch: 5, identity: 0.815

ccggcgcctagagcgttggcaccgctg	CRISPR spacer
ctcgggcctagagcgttggcaccgtgg	Protospacer
*. * *******************. *

473. spacer 4.11|1119250|27|CP019611|CRT matches to MK415400 (Phage apr34_1784, complete genome) position: , mismatch: 5, identity: 0.815

ccgccgttggcgaacagtccgccgttg	CRISPR spacer
ccgccgttggcgaccagtccgcaatca	Protospacer
************* ******** .*..

474. spacer 4.11|1119250|27|CP019611|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 5, identity: 0.815

ccgccgttggcgaacagtccgccgttg	CRISPR spacer
gggtcgtcggagaacagtccgccgttg	Protospacer
  *.***.** ****************

475. spacer 4.11|1119250|27|CP019611|CRT matches to NC_011987 (Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence) position: , mismatch: 5, identity: 0.815

ccgccgttggcgaacagtccgccgttg	CRISPR spacer
gtggcgttgtcgaacagaccgccgttg	Protospacer
 .* ***** ******* *********

476. spacer 4.12|1119295|30|CP019611|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 5, identity: 0.833

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccgggtcaccgccagcggggccagga	Protospacer
********* ************ ***. *.

477. spacer 4.12|1119295|30|CP019611|CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 5, identity: 0.833

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccgatccagacaccgccagcggcgccgagg	Protospacer
***..* .******************* **

478. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ccggccgggacaccgccagcggcg-ccgtgg	CRISPR spacer
ccggccgggacaccgcccccggcgagcgcg-	Protospacer
*****************  *****  **.*

479. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 5, identity: 0.833

--ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
gcctggcc--gacagcgccagcggcgccgtgc	Protospacer
  *.****  **** ****************

480. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 5, identity: 0.833

--ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
gcctggcc--gacagcgccagcggcgccgtgc	Protospacer
  *.****  **** ****************

481. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 5, identity: 0.833

--ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
gcctggcc--gacagcgccagcggcgccgtgc	Protospacer
  *.****  **** ****************

482. spacer 6.6|1126185|29|CP019611|CRT matches to NZ_KM017071 (Sphingomonas sp. JE1 plasmid pJE1, complete sequence) position: , mismatch: 5, identity: 0.828

ccggtccccgtgctggccctcccgccggc	CRISPR spacer
ccggtccccgtgctggcgatcccgaatgc	Protospacer
*****************  *****   **

483. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 5, identity: 0.844

-ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcaggcg-tgccgttgacgccggtcgcgcagga	Protospacer
 * **** .**************.***** ***

484. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 5, identity: 0.844

-ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcaggcg-tgccgttgacgccggtcgcgcagga	Protospacer
 * **** .**************.***** ***

485. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 5, identity: 0.844

-ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gtcggcg-tgccgatgacgccggccgggccgga	Protospacer
 .***** .**** ************ ******

486. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 5, identity: 0.844

-ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gtcggcg-tgccgatgacgccggccgggccgga	Protospacer
 .***** .**** ************ ******

487. spacer 7.1|1154227|27|CP019611|CRISPRCasFinder matches to LR794124 (Vibrio phage vB_Vc_SrVc9 genome assembly, chromosome: 1) position: , mismatch: 5, identity: 0.815

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
aacgcaccgttgtccacatcaccaatc	Protospacer
********* **********.** .*

488. spacer 7.1|1154227|27|CP019611|CRISPRCasFinder matches to NC_012662 (Vibrio phage VP93, complete genome) position: , mismatch: 5, identity: 0.815

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
aacgcaccgttgtccacatcaccaatc	Protospacer
********* **********.** .*

489. spacer 7.7|1154623|27|CP019611|CRISPRCasFinder matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
gcgaagccgaagttgtagctgcgctcg	Protospacer
********** ***********   .*

490. spacer 7.7|1154623|27|CP019611|CRISPRCasFinder matches to MN693945 (Marine virus AFVG_250M952, complete genome) position: , mismatch: 5, identity: 0.815

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
atgaagccgatgttgtcgctaccgggg	Protospacer
..************** ***.**** *

491. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

492. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

493. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

494. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP015368 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p1, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tccccgcggaagttgaggtcgcgggtg	Protospacer
 ****** ************** *. *

495. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

496. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

497. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

498. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

499. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

500. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

501. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

502. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

503. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP020444 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

504. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

505. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

506. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
gcgccgccgatgttgagggcgccgagt	Protospacer
.* ******* ******* *******

507. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP044078 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

508. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP031081 (Paracoccus yeei strain CCUG 32053 plasmid pYEE3, complete sequence) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcaccgccgaagttgaagtggccgagc	Protospacer
 * *************.** ******

509. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MN586031 (Gordonia phage Gambino, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

510. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to KU998236 (Gordonia phage Blueberry, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

511. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MN062704 (Gordonia phage JuJu, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

512. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MK501729 (Gordonia phage Walrus, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

513. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NC_031226 (Gordonia phage BaxterFox, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

514. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MK967393 (Rhodococcus phage Whack, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tccttaccgaagttgaggtcgacgagg	Protospacer
 **...*************** *****

515. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MT723935 (Gordonia phage Azula, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

516. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to KU963249 (Gordonia phage Yeezy, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

517. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MH153808 (Gordonia phage Petra, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

518. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MT639650 (Gordonia phage Ohgeesy, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

519. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MH536818 (Gordonia phage Frokostdame, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

520. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to KX557275 (Gordonia phage CarolAnn, complete genome) position: , mismatch: 5, identity: 0.815

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tcgacgccgaagttgatgtcgacgagg	Protospacer
 *  ************ **** *****

521. spacer 9.5|1716356|27|CP019611|CRT matches to KX683875 (Mycobacterium phage Baehexic, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

522. spacer 9.5|1716356|27|CP019611|CRT matches to KM197169 (Mycobacterium phage Piro94, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

523. spacer 9.5|1716356|27|CP019611|CRT matches to MF668269 (Mycobacterium phage Drake55, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

524. spacer 9.5|1716356|27|CP019611|CRT matches to MK284522 (Mycobacterium phage Malec, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

525. spacer 9.5|1716356|27|CP019611|CRT matches to KM677210 (Mycobacterium phage Larenn, complete genome) position: , mismatch: 5, identity: 0.815

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttgccggtgggctgttcagcggcgg	Protospacer
    ****************.******

526. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
ggcaggcggcggcggcggtagcgttgg	Protospacer
 * *  ********************

527. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
ggcaggcggcggcggcggtagcgttgg	Protospacer
 * *  ********************

528. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
aggatccggccgcggcggtagcgctcg	Protospacer
 ********* ************.*

529. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
aggatccggccgcggcggtagcgctcg	Protospacer
 ********* ************.*

530. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgggtccggcggcggcggtggcggttt	Protospacer
***.***************.*** * .

531. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP049908 (Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgactccggcggcgggggtagcgttcg	Protospacer
**. *********** *********

532. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_CP049700 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2a, complete sequence) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cgccgccggcggcggcggtggcgttgg	Protospacer
**   **************.******

533. spacer 9.10|1716566|27|CP019611|CRT matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
tgactccggcggcggccgtggcgttgc	Protospacer
.*. ************ **.*******

534. spacer 9.10|1716566|27|CP019611|CRT matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 5, identity: 0.815

cggatccggcggcggcggtagcgttgc	CRISPR spacer
tgactccggcggcggccgtggcgttgc	Protospacer
.*. ************ **.*******

535. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgaggccggcctgctggtcgtctccgggct	Protospacer
*** **************** ******

536. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
agattccggcctgttcgtcggctccggcgg	Protospacer
 **. ********.* **************

537. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgccatcggcctgctgctcggcaccggcgg	Protospacer
** *..********** ***** *******

538. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP031193 (Humibacter sp. BT305 plasmid unnamed1) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgccgccggcctgctggtcggcgcggcggg	Protospacer
** ******************* * *  **

539. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 5, identity: 0.833

cgacgccggcctgctggtcggc-tccggcgg	CRISPR spacer
cgacgccggcatgccggtcggcttcctgct-	Protospacer
********** ***.******* *** **

540. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
attgctgttcggctgcggcggcgcgggcgc	Protospacer
 .************ ********* ****

541. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
attgctgttcggctgcggcggcgcgggcgc	Protospacer
 .************ ********* ****

542. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcactcgg	Protospacer
*******.***** **********   ***

543. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP046705 (Nostoc sp. ATCC 53789 plasmid pNsp_b, complete sequence) position: , mismatch: 5, identity: 0.833

cctgctg--ttcggctccggcggcgctggcgg	CRISPR spacer
--tactgattacggctccggcggtgctggcgg	Protospacer
  *.***  * ************.********

544. spacer 9.15|1716803|30|CP019611|CRT matches to AY950802 (Haloarcula phage SH1, complete genome) position: , mismatch: 5, identity: 0.833

--cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ggcctac--ttcggctccggcggctccggcgg	Protospacer
  ***.*  *************** *.*****

545. spacer 9.16|1716851|24|CP019611|CRT matches to NC_006911 (Streptomyces sp. F11 plasmid pFP11, complete sequence) position: , mismatch: 5, identity: 0.792

aaccgacctcggcggcgctggcgg	CRISPR spacer
gggcgacctcggcggcgctggcct	Protospacer
.. *******************

546. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MG925349 (Mycobacterium phage Mendokysei, complete genome) position: , mismatch: 5, identity: 0.853

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggcgacggcgggttcccc	Protospacer
******************** ********  *.

547. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
gcgcggcggcctcggcgtagagccg	Protospacer
   ***************** ***

548. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NC_015178 (Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtggccgag	Protospacer
******************.**

549. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
caccggcggcctcggcgtagcttgc	Protospacer
..******************* . *

550. spacer 11.4|2003335|25|CP019611|CRISPRCasFinder matches to NC_009469 (Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence) position: , mismatch: 5, identity: 0.8

tgccggcggcctcggcgtagcgccc	CRISPR spacer
tgccggcggcctcggcgtggccgag	Protospacer
******************.**

551. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_LN907828 (Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gctgccgtgggtgccatcgttgccgagt	Protospacer
*.***** *****************. .

552. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to KU728633 (Mycobacterium phage Bipper, complete genome) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gcgtccgggggtgccgtcgttgccgtcc	Protospacer
*.  ***********.********* **

553. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to MK977701 (Mycobacterium phage Cracklewink, complete genome) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gcgtccgggggtgccgtcgttgccgtcc	Protospacer
*.  ***********.********* **

554. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 5, identity: 0.821

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
gttgccgcgggtgccctcgttgcggacg	Protospacer
******* ******* ******* *.*

555. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 5, identity: 0.8

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gccgccgaacacgccgaagccgttt	Protospacer
 ..********************.

556. spacer 12.5|2359290|25|CP019611|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 5, identity: 0.8

cttgccgaacacgccgaagccgtcg	CRISPR spacer
gttgccgaacacgccgacgccgcgc	Protospacer
 **************** ****.

557. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_018746 (Pseudomonas putida ND6 plasmid pND6-2, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

558. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to MN961671 (Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

559. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to MN961672 (Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence) position: , mismatch: 5, identity: 0.839

aattg--cgccttgcccgccgttgccgccggca	CRISPR spacer
--ttggccaccttgcacgcccttgccgccggca	Protospacer
  ***  *.****** **** ************

560. spacer 12.13|2359932|34|CP019611|CRISPRCasFinder matches to NC_006362 (Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence) position: , mismatch: 5, identity: 0.853

gtcgccgtgcagccagccaccaccgcca-ccggcg	CRISPR spacer
ttcgccgtgcagccggccaccacctccagcctgc-	Protospacer
 *************.********* *** ** **

561. spacer 1.7|109916|31|CP019611|CRT matches to NC_009478 (Clavibacter michiganensis subsp. michiganensis NCPPB 382 plasmid pCM1, complete sequence) position: , mismatch: 6, identity: 0.806

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgaccacttcaccgccgtcgccgccggcg	Protospacer
. ** ***************.******* *.

562. spacer 2.13|320290|32|CP019611|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.812

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aagcgcggcaccggcgggaccggcggcgtgtc	Protospacer
**. **************.******.**  **

563. spacer 2.21|320899|32|CP019611|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.812

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aagcgcggcaccggcgggaccggcggcgtgtc	Protospacer
**. **************.******.**  **

564. spacer 2.27|321424|26|CP019611|CRT matches to NC_008271 (Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence) position: , mismatch: 6, identity: 0.769

accggcggcaaaggcggcatgggcgg	CRISPR spacer
cttctcggcaaaggcggcatgggcga	Protospacer
 ..  ********************.

565. spacer 2.27|321424|26|CP019611|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.769

accggcggcaaaggcggcatgggcgg	CRISPR spacer
accggcggcaaaggcggcaacctctt	Protospacer
*******************    *

566. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 6, identity: 0.769

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gccggcggcaagggcggcatggcgtc	Protospacer
.**********.**********

567. spacer 2.27|321424|26|CP019611|CRT matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 6, identity: 0.769

accggcggcaaaggcggcatgggcgg	CRISPR spacer
gccggcggcaagggcggcatggcgtc	Protospacer
.**********.**********

568. spacer 4.3|1118815|30|CP019611|CRT matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

ccggcggagccgaagagcaagccgccgttc	CRISPR spacer
tcagcggagccgaagatcacgccgccgagc	Protospacer
.*.************* ** *******  *

569. spacer 4.12|1119295|30|CP019611|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 6, identity: 0.8

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccgggacaccggcatcggcgaaggcg	Protospacer
*************** ** *****  *  *

570. spacer 4.12|1119295|30|CP019611|CRT matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 6, identity: 0.8

ccggccgggacaccgccagcggcgccgtgg----	CRISPR spacer
ccagccgggagaccgccagcggc----tggctct	Protospacer
**.******* ************    ***

571. spacer 4.12|1119295|30|CP019611|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 6, identity: 0.8

--ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
agatggcc--gacaccaccagcggcgccgtgc	Protospacer
   .****  ******.**************

572. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.812

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
cgggcgccgccgatgacgccggccgcgtggag	Protospacer
* ********** **************. *..

573. spacer 6.9|1126344|32|CP019611|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 6, identity: 0.812

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcgatgccgccgttgccgccggccccgccggg	Protospacer
 **..********** ******** ******.

574. spacer 7.1|1154227|27|CP019611|CRISPRCasFinder matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 6, identity: 0.778

aacgcaccggtgtccacatcgcccgtg	CRISPR spacer
agttcactggtgtccacatcgcccgaa	Protospacer
*.. ***.***************** .

575. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agcaggtcgatcacgatctggccgttgccggcg	Protospacer
**   *.***** ******************.*

576. spacer 7.7|1154623|27|CP019611|CRISPRCasFinder matches to NZ_CP022542 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcgaagccgatgttgtagctgccggtg	CRISPR spacer
ggataggcgatgttgtagctgccggaa	Protospacer
* . ** ****************** .

577. spacer 7.9|1154773|27|CP019611|CRISPRCasFinder matches to NC_009959 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence) position: , mismatch: 6, identity: 0.778

gccaagccgatatcgaagatcccggtg	CRISPR spacer
accatgccgatatcgacgatcccgtcc	Protospacer
.*** *********** ******* .

578. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
tagacgccgaagtcgaggtcggcgagg	Protospacer
    *********.******* *****

579. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
ctcccgccgaagttgagggtgccgaac	Protospacer
 .**************** .*****.

580. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
aagaagccgaagttgaggtcgccgtag	Protospacer
*    ******************* .*

581. spacer 7.10|1154833|27|CP019611|CRISPRCasFinder matches to MK494099 (Mycobacterium phage Typha, complete genome) position: , mismatch: 6, identity: 0.778

accccgccgaagttgaggtcgccgagg	CRISPR spacer
cggtcgccgaggtcgaggtcgccgagg	Protospacer
   .******.**.*************

582. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to GQ141189 (Bifidobacterium phage Bbif-1, complete sequence) position: , mismatch: 6, identity: 0.806

agcgcgaacggcaagccgaac----cgttggaccc	CRISPR spacer
agcgcgaacggccagccgaaccatgcgctgg----	Protospacer
************ ********    **.***

583. spacer 9.5|1716356|27|CP019611|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
gatggccggtaggctgttgaacggcgc	Protospacer
.. *******.******* *******

584. spacer 9.5|1716356|27|CP019611|CRT matches to NC_023606 (Mycobacterium phage CRB1, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

585. spacer 9.5|1716356|27|CP019611|CRT matches to MK524491 (Mycobacterium phage Whabigail7, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

586. spacer 9.5|1716356|27|CP019611|CRT matches to KX619650 (Mycobacterium phage Jerm, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

587. spacer 9.5|1716356|27|CP019611|CRT matches to MN585998 (Mycobacterium phage Bugsy, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

588. spacer 9.5|1716356|27|CP019611|CRT matches to JN408460 (Mycobacterium phage Turbido, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

589. spacer 9.5|1716356|27|CP019611|CRT matches to MH077576 (Mycobacterium phage AbbyPaige, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

590. spacer 9.5|1716356|27|CP019611|CRT matches to MH825704 (Mycobacterium phage LilTurb, complete genome) position: , mismatch: 6, identity: 0.778

aggggccggtgggctgttcaacggcgg	CRISPR spacer
ccttggcggtgggctgttcagcggcgg	Protospacer
    * **************.******

591. spacer 9.10|1716566|27|CP019611|CRT matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 6, identity: 0.778

cggatccggcggcggcggtagcgttgc	CRISPR spacer
cggatcctgcggcggcggtagaaagcc	Protospacer
******* ************* .   *

592. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gagcgtcggcctgctggtcggcttcggcgc	Protospacer
 ..**.*****************.*****

593. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gagcgtcggcctgctggtcggcttcggcgc	Protospacer
 ..**.*****************.*****

594. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgacggcctggtggtcggctacctcga	Protospacer
***** ******* ********* *  **.

595. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

596. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

597. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgcgcggcgtgccggtcggctccggcgg	Protospacer
**    **** ***.***************

598. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgatcggcctgctgctcggcaccggcgg	Protospacer
**  ..********** ***** *******

599. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcgcgcggcgtgccggtcggctccggcgg	Protospacer
**    **** ***.***************

600. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgcggcgggcctgctggtcggcttcggcac	Protospacer
**  ** ****************.****.

601. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

602. spacer 9.13|1716707|30|CP019611|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

603. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

604. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP037868 (Hydrogenophaga pseudoflava strain DSM 1084 plasmid pDSM1084, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcg----gctccggcgg	CRISPR spacer
cgacgccggccggctggtcggagagctgcg----	Protospacer
*********** ********    *** **

605. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

606. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

607. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtcgccggcctgctgatcggcttcttctg	Protospacer
** *************.******.*  * *

608. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

609. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

610. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

611. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

612. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

613. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

614. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

615. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggtcctggcctgctggtcggcgccggcag	Protospacer
**.. *.*************** *****.*

616. spacer 9.13|1716707|30|CP019611|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtcatcggcctgctggtcgtcgccggcgc	Protospacer
** *..************** * ******

617. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgccgacctgctggtcggggcggactg	Protospacer
********.************  * *.* *

618. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP017941 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
caagctggtcggccccggcggcgctggcaa	Protospacer
*  **** *****.**************..

619. spacer 9.15|1716803|30|CP019611|CRT matches to MK937608 (Microbacterium phage Cressida, complete genome) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tcacctgtccggctccggcggcggtggcga	Protospacer
.*  ****.************** *****.

620. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

621. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

622. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP017592 (Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg--	CRISPR spacer
tctgctgttcggctgcggcggcg--agcagcg	Protospacer
.************* ********  .**.*

623. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP008898 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-576, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

624. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP023489 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

625. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP043515 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

626. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgctcggcaccggcggcgcgcttgg	Protospacer
*******.***** **********   .**

627. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_LT984809 (Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
catcgcgctcggcttcggcggcgctggcgg	Protospacer
* *  .*.******.***************

628. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP026371 (Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

629. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP050069 (Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

630. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP039425 (Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgttcggcaccgacggcgccctccg	Protospacer
************* ***.******.  * *

631. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP009856 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-784, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgttcggcgccgccggcgctattgg	Protospacer
 ************ *** *******. .**

632. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP039430 (Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgttcggcaccgacggcgccctccg	Protospacer
************* ***.******.  * *

633. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgt-tcggctccggcggcgctggcgg	CRISPR spacer
-ccgccgcgccggctccggccgcgctggcgg	Protospacer
 *.**.*. .********** **********

634. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgtccagctcggcgccggcggcgctggcgt	Protospacer
* * * *.***** ***************

635. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgtccagctcggcgccggcggcgctggcgt	Protospacer
* * * *.***** ***************

636. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP006588 (Hymenobacter sp. APR13 plasmid pHA, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgt-tcggctccggcggcgctggcgg	CRISPR spacer
-ccgccgcgccggctccggccgcgctggcgg	Protospacer
 *.**.*. .********** **********

637. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgtt--cggctccggcggcgctggcgg	CRISPR spacer
--cgccgctggcggcgccggcggcgctggcgg	Protospacer
  .**.*.*  **** ****************

638. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.8

cctgctgtt----cggctccggcggcgctggcgg	CRISPR spacer
----cagttggggcggctccggcggcgcgggcgg	Protospacer
    * ***    *************** *****

639. spacer 9.15|1716803|30|CP019611|CRT matches to MH029534 (Myoviridae environmental samples clone NHS-Seq2, complete sequence) position: , mismatch: 6, identity: 0.8

-cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
atttggt-ttcggcgctggcggcgctggcgg	Protospacer
 ..** * ****** *.**************

640. spacer 9.17|1716893|36|CP019611|CRT matches to MT723940 (Mycobacterium phage Ellie, complete genome) position: , mismatch: 6, identity: 0.833

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
cgttgtcggcaacggcggtaacggcgggggtggcgg	Protospacer
  * .************************ .*****

641. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
ggccggcggcaagggcggcgacggcggcgccggc--	Protospacer
************ ******* *****  * .***

642. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgggt--ggcta	CRISPR spacer
caccggcggcaacggcggcggcggcggcttcggc--	Protospacer
 .****************** ****** *  ***

643. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
caccggcggcagcggcggcgccggcggcacggct-	Protospacer
 .*********.*************** ..****

644. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.824

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
cggcggcggcaacggcggcgctggt-ggtggcaac	Protospacer
 * ******************.**. ****** *

645. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccgggggtggcaccgttgccgcgg	Protospacer
* *********** **.********

646. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccgggggtggcaccgttgccgcgg	Protospacer
* *********** **.********

647. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 6, identity: 0.786

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
ggtgccggcggtgccatcggtgccgagg	Protospacer
* ****** ********** *****.

648. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 6, identity: 0.806

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ccttgcgccttgcccgccgctgccgcagggc	Protospacer
  *****************.****** **

649. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 6, identity: 0.806

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ccttgcgccttgcccgccgctgccgcagggc	Protospacer
  *****************.****** **

650. spacer 12.13|2359932|34|CP019611|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.824

--gtcgccgtgcagccagccaccaccgccaccggcg	CRISPR spacer
ctgtcgtc--gcagcgcgccaccaccgccaccggca	Protospacer
  ****.*  *****  ******************.

651. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cccacccacttcaccgacgtcgccgccgacg	Protospacer
  *.************ ***.******* *.

652. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cccacccacttcaccgacgtcgccgccgacg	Protospacer
  *.************ ***.******* *.

653. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP042263 (Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
atccgccatttcaccgccgttgccgacgccg	Protospacer
* *  ***.**************** **.*.

654. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
aacggcggggccggcggtagcggcggcgcaggcgc	Protospacer
*.************************ ** ..* .

655. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
agcggcggggacggcggcagcggcggcgggctctt	Protospacer
********** ******.******** *    ***

656. spacer 2.11|320137|35|CP019611|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

657. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

658. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

659. spacer 2.11|320137|35|CP019611|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

660. spacer 2.11|320137|35|CP019611|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

661. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

662. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

663. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

664. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

665. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt--	CRISPR spacer
ggcggcgcggccggcggcagcggc--ggccaacccgg	Protospacer
.****** *********.******  *******..

666. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 7, identity: 0.781

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacctcctc	Protospacer
**** ************** *** . *  ***

667. spacer 2.13|320290|32|CP019611|CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcggcgc	Protospacer
****.****.************* . **.* *

668. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP026546 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed2) position: , mismatch: 7, identity: 0.8

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
cgctgatgcgccggcgacaccaaaggctccggcgg	Protospacer
 ** *  *.*******.****** ***********

669. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 7, identity: 0.781

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacctcctc	Protospacer
**** ************** *** . *  ***

670. spacer 2.21|320899|32|CP019611|CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcggcgc	Protospacer
****.****.************* . **.* *

671. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
aacggcggggccggcggtagcggcggcgcaggcgc	Protospacer
*.************************ ** ..* .

672. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
agcggcggggacggcggcagcggcggcgggctctt	Protospacer
********** ******.******** *    ***

673. spacer 2.26|321352|35|CP019611|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

674. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

675. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

676. spacer 2.26|321352|35|CP019611|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

677. spacer 2.26|321352|35|CP019611|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

678. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

679. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

680. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

681. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcgg---ggccaactt	CRISPR spacer
agcggcggtgtcggcggtagcggcggcgaggtcga---	Protospacer
******** *.***************   **.*.*

682. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.8

agcggcggggccggcggtagcggcggggccaactt--	CRISPR spacer
ggcggcgcggccggcggcagcggc--ggccaacccgg	Protospacer
.****** *********.******  *******..

683. spacer 4.3|1118815|30|CP019611|CRT matches to MK460246 (Mycobacterium phage Nibb, complete genome) position: , mismatch: 7, identity: 0.767

ccggcggagccgaagagcaagccgccgttc	CRISPR spacer
ccggcgaagccgaagcgcaagccgaaacgc	Protospacer
******.******** ********  .. *

684. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccggcagcggcgcgaaca	Protospacer
******.******** ********* .  .

685. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ttggcccggtcaccgccagcggcgccgcca	Protospacer
..**** ** *****************. .

686. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
cgggccggaacaccgccagcggcgtgaggc	Protospacer
* ******.***************. . *

687. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
tcgcctatgactccgccagcggcgccgtgc	Protospacer
.** *.. *** *****************

688. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccgccagcagcacaccga	Protospacer
******.*************.**.*  .*.

689. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccgccagcagcacgccga	Protospacer
******.*************.**.*  .*.

690. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccatccggcacaccgccagcggcaccggca	Protospacer
**. **** **************.***  .

691. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccatccggcacaccgccagcggcaccggca	Protospacer
**. **** **************.***  .

692. spacer 4.12|1119295|30|CP019611|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
acggccgggtcatcgccagcggcgaaccgg	Protospacer
 ******** **.***********   .**

693. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
accgcatcgaccccgccagcggcgccgtga	Protospacer
 * **   *** *****************.

694. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccgccagcagcacgccga	Protospacer
******.*************.**.*  .*.

695. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccgccagcagcacgccga	Protospacer
******.*************.**.*  .*.

696. spacer 4.12|1119295|30|CP019611|CRT matches to NC_021279 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccatccggcacaccgccagcggcaccggca	Protospacer
**. **** **************.***  .

697. spacer 6.6|1126185|29|CP019611|CRT matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

ccggtccccgtgctggccctcccgccggc	CRISPR spacer
accatccccgtgctggcgctcgcgccgat	Protospacer
 * .************* *** *****..

698. spacer 6.9|1126344|32|CP019611|CRT matches to MG925349 (Mycobacterium phage Mendokysei, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccgtcgccgccgttgccgccggccgcgatcac	Protospacer
*** *********** *********** . .

699. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgacgttgccgccggcccaggcgtt	Protospacer
********* ***** ********  * **

700. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
caggcgccgccgtcgacgccggccgccatcgc	Protospacer
* ***********.************  . *

701. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttgacgccgccgttgccgccgcccgcgccgct	Protospacer
..*.*********** ***** ********

702. spacer 6.9|1126344|32|CP019611|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttgacgccgccgttgccgccgcccgcgccgct	Protospacer
..*.*********** ***** ********

703. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgacgttgccgccggcccaggcgtt	Protospacer
********* ***** ********  * **

704. spacer 6.9|1126344|32|CP019611|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgacgttgccgccggcccaggcgtt	Protospacer
********* ***** ********  * **

705. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
caggcgccgccgtcgacgccggccgccatcgc	Protospacer
* ***********.************  . *

706. spacer 6.9|1126344|32|CP019611|CRT matches to NC_008712 (Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcggcgccgccgctgacgccggcctgtgcgaa	Protospacer
 ***********.***********    **.*

707. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccg-cgccgga	CRISPR spacer
ccggcgccgccgtagacgtcggcgatcaacgg-	Protospacer
************* ****.**** . *. ***

708. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
caggcgccgtcgttgacgccggacgcgttgcc	Protospacer
* *******.************ ****..*

709. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
acgaagccgccgttgccgccggccgcaccgcc	Protospacer
 **. ********** **********.***

710. spacer 6.9|1126344|32|CP019611|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
cggccgccgccgttgatgccggccgcgtggcg	Protospacer
* * ************.**********. * .

711. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.781

ccggc--gccgccgttgacgccggccgcgccgga	CRISPR spacer
--ggttggccgccgctgccgccggccgcgccgcc	Protospacer
  **.  *******.** **************

712. spacer 6.9|1126344|32|CP019611|CRT matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccacccccgccgttggcgccgcccgcgccgcc	Protospacer
**. * *********.***** ********

713. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcccagccgccgctgatgccggccgcgccgta	Protospacer
 *   *******.***.************* *

714. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
acgaagccgccgtcgccgccggccgcgccgcc	Protospacer
 **. ********.* **************

715. spacer 6.9|1126344|32|CP019611|CRT matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactgccggcgttgacgccgcccgcgccgcc	Protospacer
**. .**** *********** ********

716. spacer 6.9|1126344|32|CP019611|CRT matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgc-cgccgttgacgccggccgcgccgga	CRISPR spacer
-tgttgcacgccgtcgacgccggccgcgccgac	Protospacer
 .* .** ******.****************.

717. spacer 6.9|1126344|32|CP019611|CRT matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactgccggcgttgacgccgcccgcgccgcc	Protospacer
**. .**** *********** ********

718. spacer 6.9|1126344|32|CP019611|CRT matches to MT711975 (Streptomyces phage Alderaan, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgc-cgccgttgacgccggccgcgccgga	CRISPR spacer
-tgttgcacgccgtcgacgccggccgcgccgac	Protospacer
 .* .** ******.****************.

719. spacer 6.9|1126344|32|CP019611|CRT matches to MK305888 (Streptomyces phage Austintatious, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgc-cgccgttgacgccggccgcgccgga	CRISPR spacer
-tgttgcacgccgtcgacgccggccgcgccgac	Protospacer
 .* .** ******.****************.

720. spacer 6.9|1126344|32|CP019611|CRT matches to AY369265 (Burkholderia cenocepacia phage Bcep1, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcaccgccgttgccgccggccgtataggc	Protospacer
*****.********* *********... **

721. spacer 6.9|1126344|32|CP019611|CRT matches to MK524485 (Mycobacterium phage MissDaisy, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ctcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
*. ********* ****** ********.*

722. spacer 6.9|1126344|32|CP019611|CRT matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgc-cgccgttgacgccggccgcgccgga	CRISPR spacer
-tgttgcacgccgtcgacgccggccgcgccgac	Protospacer
 .* .** ******.****************.

723. spacer 6.9|1126344|32|CP019611|CRT matches to MH926058 (Mycobacterium phage Reptar3000, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ctcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
*. ********* ****** ********.*

724. spacer 6.9|1126344|32|CP019611|CRT matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgc-cgccgttgacgccggccgcgccgga	CRISPR spacer
-tgttgcacgccgtcgacgccggccgcgccgac	Protospacer
 .* .** ******.****************.

725. spacer 6.9|1126344|32|CP019611|CRT matches to MK524488 (Mycobacterium phage Patt, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ctcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
*. ********* ****** ********.*

726. spacer 6.9|1126344|32|CP019611|CRT matches to NC_005263 (Burkholderia phage Bcep1, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcaccgccgttgccgccggccgtataggc	Protospacer
*****.********* *********... **

727. spacer 6.9|1126344|32|CP019611|CRT matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactgccggcgttgacgccgcccgcgccgcc	Protospacer
**. .**** *********** ********

728. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga----	CRISPR spacer
ccggcgccgccgttggcgccgac----ccgaactac	Protospacer
***************.*****.*    ***.*

729. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccg-cgccgga	CRISPR spacer
ccggcgccgccgtagacgtcggcgatcaacgg-	Protospacer
************* ****.**** . *. ***

730. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgacgttgccgccggcccaggcgtt	Protospacer
********* ***** ********  * **

731. spacer 6.9|1126344|32|CP019611|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
caggcgacgccgtagacgccggccggcgcggt	Protospacer
* **** ****** ***********   ***

732. spacer 6.9|1126344|32|CP019611|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggggagccgccgttgccgccggccgccgccga	Protospacer
  ** ********** **********  * **

733. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccg-cgccgga	CRISPR spacer
ccggcgccgccgtagacgtcggcgatcaacgg-	Protospacer
************* ****.**** . *. ***

734. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccg-cgccgga	CRISPR spacer
ccggcgccgccgtagacgtcggcgatcaacgg-	Protospacer
************* ****.**** . *. ***

735. spacer 6.9|1126344|32|CP019611|CRT matches to MH271296 (Gordonia phage Emperor, complete genome) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
cccttgtcgcctttggcgccggccgcgccggt	Protospacer
**  .*.**** ***.***************

736. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_KR997898 (Mycobacterium avium subsp. hominissuis strain 88Br plasmid pMA100, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccg-ccgttgacgccggccgcgccgga	CRISPR spacer
-tgaccctgcccgtggacgccgggcgcgccgga	Protospacer
 .*.* *.* **** ******** *********

737. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
cggccgtcgccgttgacaccggccgcgaggaa	Protospacer
* * **.**********.*********  *.*

738. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcgccgccgttgacgccggc----cgcgccgga	CRISPR spacer
ccgccgccgccgatgacgccggcgagatgcgc----	Protospacer
*** ******** **********    .****

739. spacer 6.10|1126398|32|CP019611|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

attaaccagccgccgtccccgccattggcccc	CRISPR spacer
atggaaaagccgccgtccccgacataggccac	Protospacer
** .*  ************** *** **** *

740. spacer 6.10|1126398|32|CP019611|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

attaaccagccgccgtccccgccattggcccc	CRISPR spacer
atggaaaagccgccgtccccgacataggccac	Protospacer
** .*  ************** *** **** *

741. spacer 6.10|1126398|32|CP019611|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 7, identity: 0.781

attaaccagccgccgtccccgccattggcccc	CRISPR spacer
atggaaaagccgccgtccccgacataggccac	Protospacer
** .*  ************** *** **** *

742. spacer 7.4|1154422|27|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.741

aagccgcccgagttcgcgagaccgaag	CRISPR spacer
tgaccgcccgagttcgcgagacgttgg	Protospacer
 ..*******************   .*

743. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

744. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

745. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

746. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

747. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

748. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

749. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

750. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

751. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

752. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

753. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

754. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

755. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

756. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

757. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to NC_031243 (Mycobacterium phage Xeno, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

758. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 7, identity: 0.774

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
cgcgcgaacggcatcccgaaccgttgaccgg	Protospacer
 ************  ***********. *

759. spacer 9.13|1716707|30|CP019611|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggtcgccggcctgctggtcgggttcggatc	Protospacer
 * ****************** *.***

760. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

761. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

762. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ctgctgcagcctgctggtcagctccggcgc	Protospacer
* .*  *.***********.*********

763. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

764. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

765. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ctgctgcagcctgctggtcagctccggcgc	Protospacer
* .*  *.***********.*********

766. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

767. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

768. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

769. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

770. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

771. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

772. spacer 9.13|1716707|30|CP019611|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgggaccggcccgctggtcggccccggctt	Protospacer
**. .******.**********.*****

773. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gctgggcggcctgctggtcggctggggcgg	Protospacer
    * *****************  *****

774. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

775. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

776. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

777. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

778. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

779. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

780. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgcaggtcggcttcacctt	Protospacer
 ************* ********.*. *

781. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

782. spacer 9.13|1716707|30|CP019611|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

783. spacer 9.13|1716707|30|CP019611|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

784. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

785. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

786. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

787. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

788. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

789. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

790. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

791. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

792. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

793. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

794. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

795. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

796. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

797. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

798. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

799. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

800. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

801. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

802. spacer 9.13|1716707|30|CP019611|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

803. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

804. spacer 9.13|1716707|30|CP019611|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

805. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

806. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

807. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

808. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

809. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

810. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

811. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

812. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

813. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

814. spacer 9.13|1716707|30|CP019611|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

815. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

816. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

817. spacer 9.13|1716707|30|CP019611|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

818. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

819. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

820. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

821. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

822. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

823. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

824. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

825. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

826. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

827. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

828. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

829. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

830. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

831. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

832. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

833. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

834. spacer 9.13|1716707|30|CP019611|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

835. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

836. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

837. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

838. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

839. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

840. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

841. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggacgccggcctgctggtcgactgggaaga	Protospacer
 *******************.**  *. *.

842. spacer 9.13|1716707|30|CP019611|CRT matches to HM560026 (Uncultured bacterium plasmid pTRACA45, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
acacgccgccctgctggtcggcttaggtcg	Protospacer
  ****** **************. **. *

843. spacer 9.13|1716707|30|CP019611|CRT matches to NC_010867 (Neisseria lactamica plasmid pNL3.1, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gaacgccgccctgctggtcggcttagtcgc	Protospacer
 .****** **************. * **

844. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
agacgccggcctgctgttcggcctcgaccc	Protospacer
 *************** *****..**.*

845. spacer 9.13|1716707|30|CP019611|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgggctcggcctgctgctcggcttcggcga	Protospacer
**.  .********** ******.*****.

846. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggc-tccggcgg	CRISPR spacer
gtcggccggcctgctggtcggcgcccggct-	Protospacer
    ****************** .*****

847. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgacggcctgctggtcgacttcatccc	Protospacer
***** **************.**.*. *

848. spacer 9.13|1716707|30|CP019611|CRT matches to KT997827 (Uncultured Mediterranean phage uvDeep-CGR0-KM15-C219, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcgccggcctgctggaccgctccgtggg	Protospacer
   ************** * ******  **

849. spacer 9.13|1716707|30|CP019611|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgtgtccggcctgctggtcgggttcggcac	Protospacer
**   **************** *.****.

850. spacer 9.13|1716707|30|CP019611|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
tgacgccgccctgctggtcggcaaagtcga	Protospacer
.******* *************   * **.

851. spacer 9.13|1716707|30|CP019611|CRT matches to KT997829 (Uncultured Mediterranean phage uvDeep-CGR0-KM22-C158, complete genome) position: , mismatch: 7, identity: 0.767

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcgccggcctgctggaccgctccgtggg	Protospacer
   ************** * ******  **

852. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttcggggtcggctccggcggcgctggcga	Protospacer
..*   * *********************.

853. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttcggggtcggctccggcggcgctggcga	Protospacer
..*   * *********************.

854. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctccgcgctcggctccggcggcggtggcgg	Protospacer
*..  .*.*************** ******

855. spacer 9.15|1716803|30|CP019611|CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

856. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

857. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

858. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

859. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

860. spacer 9.15|1716803|30|CP019611|CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

861. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

862. spacer 9.15|1716803|30|CP019611|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tttccggctcggcgccggcggcgctggcga	Protospacer
..* * *.***** ***************.

863. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

864. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

865. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

866. spacer 9.15|1716803|30|CP019611|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg-	CRISPR spacer
actgctgtccggctccggcggca-tgatgtc	Protospacer
 *******.*************. **..*

867. spacer 9.15|1716803|30|CP019611|CRT matches to MN582086 (Siphoviridae sp. ctdEk19, complete genome) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gccggccttcgacttcggcggcgctggcgg	Protospacer
 *.* . ****.**.***************

868. spacer 9.15|1716803|30|CP019611|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

869. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP022700 (Acetobacter tropicalis strain BDGP1 plasmid pAtBDGP1A, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gttcctccacggttccggcggcgctggcgg	Protospacer
 .* ** . ***.*****************

870. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

871. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

872. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
ctgcctggtcggctccggcggcgctcgtcg	Protospacer
*.  *** ***************** *. *

873. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 7, identity: 0.767

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tctcgggctcggccccggcggcgctggcgc	Protospacer
.**   *.*****.***************

874. spacer 9.17|1716893|36|CP019611|CRT matches to NC_022087 (Mycobacterium phage AnnaL29, complete genome) position: , mismatch: 7, identity: 0.806

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
cgtgatcggcaacggcggaaacggcgggagctgggg	Protospacer
  **************** *********. * * **

875. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
ggccggaggcaccggcggcgccggcggcacgggc-	Protospacer
****** **** *************** ..** .

876. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg--tggcta	CRISPR spacer
gaccggcggcagcggcggcgcgggcggagccggc--	Protospacer
*.*********.********* *****.  .***

877. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
cgcaggcggcaacggcggccccggcggcgccgcc-	Protospacer
 ** *************** ******* *. **.

878. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta----	CRISPR spacer
ggccgggggcaacggcggcgacggc----gtctacgac	Protospacer
****** ************* ****    * ***

879. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
tgccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 ******************. ******  *..**

880. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
tgccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 ******************. ******  *..**

881. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg--tggcta	CRISPR spacer
tgtcggcggcagcggcggcggcggcggggccggc--	Protospacer
 *.********.******** *******  .***

882. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggt--ggcta	CRISPR spacer
ggccggcggcatcggcgacgccggctgcttcagc--	Protospacer
*********** *****.******* * *  .**

883. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
caccggcggccacggcggcaccggc-ggcggcgat	Protospacer
 .******** ********.***** **.*** *

884. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP039641 (Azospirillum sp. TSH100 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
agacggcggcaccggcggcggcggcggtgaggcc-	Protospacer
.* ******** ******** ****** * ***.

885. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH697583 (Mycobacterium phage EricMillard, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

886. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH727551 (Mycobacterium phage Kalah2, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

887. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH077579 (Mycobacterium phage Halley, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

888. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH669017 (Mycobacterium phage Zelink, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

889. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN062701 (Mycobacterium phage Dallas, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

890. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK524527 (Mycobacterium phage ThreeRngTarjay, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

891. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK524529 (Mycobacterium phage Phoebus, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

892. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MF919512 (Mycobacterium phage Klein, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

893. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KF114875 (Mycobacterium phage Redno2, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

894. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg---gtggcta	CRISPR spacer
acccggcggcaacggcgcccccggcggcgtgtgg---	Protospacer
. *************** * *******   ****

895. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
agacggtggcagcggcggcgccggcggcggtgct-	Protospacer
.* ***.****.*************** *  ***

896. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcggg-tggcta	CRISPR spacer
ggtcggcgccaacggcggcgccggtgaactgggt-	Protospacer
**.***** ***************.*.. *** *

897. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggc--gggtggcta	CRISPR spacer
cgctggcggcaacgtcggcgccggccatggcggc--	Protospacer
 **.********** **********   **.***

898. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
tggcggcggcaacggcggcggtggc-ggtggcggt	Protospacer
 * ***************** .*** ****** .

899. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggc--gggtggcta	CRISPR spacer
cgctggcggcaacgtcggcgccggccatggcggc--	Protospacer
 **.********** **********   **.***

900. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
tgctggcggcaacggcggcgtcggcatcgctggc--	Protospacer
 **.****************.****.  * ****

901. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 7, identity: 0.794

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
cgacggcggcaacggcggcggtggc-ggtggtcac	Protospacer
 * ***************** .*** *****..*

902. spacer 11.9|2003599|37|CP019611|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 7, identity: 0.811

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
tgtcggcggtgccggcggtgccggcggtgccggcgac	Protospacer
******************..*******  . ***.**

903. spacer 12.1|2359068|28|CP019611|CRISPRCasFinder matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 7, identity: 0.75

gttgccgggggtgccatcgttgccggcc	CRISPR spacer
agcacccggggtgccgtcgttgccggcg	Protospacer
. ..** ********.***********

904. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 7, identity: 0.774

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gttgccgccatgcccgccgctgccgccggcc	Protospacer
. *  **** *********.**********

905. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to CP017041 (Propionibacterium sp. oral taxon 193 strain F0672 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
aacggcgtcttgcccgccgtggccgccaccg	Protospacer
**. ***.************ ******. *.

906. spacer 13.3|2875198|30|CP019611|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

907. spacer 13.3|2875198|30|CP019611|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

908. spacer 13.3|2875198|30|CP019611|CRT matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 7, identity: 0.767

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ttcggtaaagccgtcggtgtgcacgctgac	Protospacer
*. *. ************ ********* .

909. spacer 1.7|109916|31|CP019611|CRT matches to CP033373 (Lactobacillus fermentum strain DR9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
ttagcccacttcacggccgttgccgacgcgg	Protospacer
   *********** ********** **. .

910. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

911. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

912. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

913. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

914. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

915. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

916. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

917. spacer 1.7|109916|31|CP019611|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

918. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

919. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
cgcaactccttcaccgccgctgccgccgtct	Protospacer
 .*. *. ***********.**********

920. spacer 1.7|109916|31|CP019611|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

921. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

922. spacer 1.7|109916|31|CP019611|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
gccgcccacctcaccgccgtggccgcgctgg	Protospacer
. *******.********** *****  * .

923. spacer 1.7|109916|31|CP019611|CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
ctcggtggcttcgccgccgtcgccgccgtca	Protospacer
  ** . .****.*******.**********

924. spacer 1.7|109916|31|CP019611|CRT matches to NC_014213 (Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence) position: , mismatch: 8, identity: 0.742

aacgcccacttcaccgccgttgccgccgtca	CRISPR spacer
atcgcccacttcaccggcgtttccgaccctt	Protospacer
* ************** **** *** * ..

925. spacer 2.13|320290|32|CP019611|CRT matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggccccggcggtgccggcgataccga	Protospacer
.******** ******* ********.. *

926. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP053714 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcggcggcgccggcggggccggcggcgggac	Protospacer
.. ******.***************.**.  *

927. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggtgacggcaccggcggtgccggcggcgatgc	Protospacer
.. *.************ *******.***. *

928. spacer 2.13|320290|32|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcg-gcaccggcggggccggcgacgactc	CRISPR spacer
-ctgccgcgcaccgggggggacggcgacgacgg	Protospacer
   * ** ******* **** **********

929. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtacccggcaccgccgaggccggcgacgagtt	Protospacer
. *  ******** **.************ *.

930. spacer 2.13|320290|32|CP019611|CRT matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcgccggtggggccggcgaagcggc	Protospacer
*  ******.****.*********** *   *

931. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacgtcctc	Protospacer
**** ************** *** .    ***

932. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP033508 (Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcaccac	Protospacer
****.****.************* . *. * *

933. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP033369 (Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcaccac	Protospacer
****.****.************* . *. * *

934. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcgccggcggggccggcgaccgctt	Protospacer
.*. ** **.***************** .**.

935. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacgtcctc	Protospacer
**** ************** *** .    ***

936. spacer 2.13|320290|32|CP019611|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtcgacgacaccggcgaggccggcgacgccgc	Protospacer
.  *.**.********.*********** * *

937. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacgggacatcctc	Protospacer
**** ************** *** .    ***

938. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcaacggcggggccggcgaccgctt	Protospacer
.*. ** *** **************** .**.

939. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP032053 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcgtcgggaccggcggggcgggcgacggcga	Protospacer
*  * *** *********** *******.*

940. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacgggacatcctc	Protospacer
**** ************** *** .    ***

941. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcaacggcggggccggcgaccgctt	Protospacer
.*. ** *** **************** .**.

942. spacer 2.13|320290|32|CP019611|CRT matches to MN234185 (Mycobacterium phage Lemuria, complete genome) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gacgtcggcaccggcggcgccggcggcggcaa	Protospacer
.* * ************ *******.**.*

943. spacer 2.21|320899|32|CP019611|CRT matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggccccggcggtgccggcgataccga	Protospacer
.******** ******* ********.. *

944. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP053714 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcggcggcgccggcggggccggcggcgggac	Protospacer
.. ******.***************.**.  *

945. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggtgacggcaccggcggtgccggcggcgatgc	Protospacer
.. *.************ *******.***. *

946. spacer 2.21|320899|32|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcg-gcaccggcggggccggcgacgactc	CRISPR spacer
-ctgccgcgcaccgggggggacggcgacgacgg	Protospacer
   * ** ******* **** **********

947. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtacccggcaccgccgaggccggcgacgagtt	Protospacer
. *  ******** **.************ *.

948. spacer 2.21|320899|32|CP019611|CRT matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcgccggtggggccggcgaagcggc	Protospacer
*  ******.****.*********** *   *

949. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacgtcctc	Protospacer
**** ************** *** .    ***

950. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP033508 (Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcaccac	Protospacer
****.****.************* . *. * *

951. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP033369 (Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagacggcgccggcggggccgggatcaccac	Protospacer
****.****.************* . *. * *

952. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcgccggcggggccggcgaccgctt	Protospacer
.*. ** **.***************** .**.

953. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacggaacgtcctc	Protospacer
**** ************** *** .    ***

954. spacer 2.21|320899|32|CP019611|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtcgacgacaccggcgaggccggcgacgccgc	Protospacer
.  *.**.********.*********** * *

955. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacgggacatcctc	Protospacer
**** ************** *** .    ***

956. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcaacggcggggccggcgaccgctt	Protospacer
.*. ** *** **************** .**.

957. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP032053 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcgtcgggaccggcggggcgggcgacggcga	Protospacer
*  * *** *********** *******.*

958. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
aaagtcggcaccggcggggacgggacatcctc	Protospacer
**** ************** *** .    ***

959. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gagcgccgcaacggcggggccggcgaccgctt	Protospacer
.*. ** *** **************** .**.

960. spacer 2.21|320899|32|CP019611|CRT matches to MN234185 (Mycobacterium phage Lemuria, complete genome) position: , mismatch: 8, identity: 0.75

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gacgtcggcaccggcggcgccggcggcggcaa	Protospacer
.* * ************ *******.**.*

961. spacer 4.3|1118815|30|CP019611|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 8, identity: 0.733

ccggcggagccgaagagcaagccgccgttc	CRISPR spacer
agcacgaagccgaagagaaagccgccgatg	Protospacer
   .**.********** ********* *

962. spacer 4.12|1119295|30|CP019611|CRT matches to NC_019847 (Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence) position: , mismatch: 8, identity: 0.733

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
tcaccctggacaccgcctgcggcgccggac	Protospacer
.*. ** ********** ********* .

963. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.733

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
ccggccaggacaccggcagcggcacgaaca	Protospacer
******.******** *******.* .  .

964. spacer 4.12|1119295|30|CP019611|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 8, identity: 0.733

ccggccgggacaccgccagcggcgccgtgg	CRISPR spacer
tcgcggtcgacaccgccagcggcgacgtga	Protospacer
.**     **************** ****.

965. spacer 4.12|1119295|30|CP019611|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggccgggacaccgccagcg----gcgccgtgg	CRISPR spacer
agggccgggacaccgcccgcggccagcgct----	Protospacer
  *************** ***    ****.

966. spacer 6.6|1126185|29|CP019611|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.724

ccggtccccgtgctggccctcccgccggc	CRISPR spacer
tgcgtccccctgctggccctaccgccctg	Protospacer
.  ****** ********** *****

967. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

968. spacer 6.9|1126344|32|CP019611|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcgatgttgccgttgccgccggtcgcgccggt	Protospacer
 **..*..******* ******.********

969. spacer 6.9|1126344|32|CP019611|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agcgcgccgccgatgacgccggccacggtggc	Protospacer
   ********* ***********.** .**

970. spacer 6.9|1126344|32|CP019611|CRT matches to NC_010399 (Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gctccgccgccgcagacgccggccgcgccatg	Protospacer
 *  ********. ***************. .

971. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
tccgcgccgccgtcgacgcccgccgcgacccg	Protospacer
.* **********.****** ****** *  .

972. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccgcgctcgccgttgacgccggacacgccgcc	Protospacer
***   .*************** *.*****

973. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccacccttgacgccggcaggatcgtg	Protospacer
********.** *********** * ..** .

974. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agcgcgccgccgatgacgccggccacggtggc	Protospacer
   ********* ***********.** .**

975. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agcgcgccgccgatgacgccggccacggtggc	Protospacer
   ********* ***********.** .**

976. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgccgcagttgccgccggcgcttgagga	Protospacer
********** **** *******  .   ***

977. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
tgatcgccgccgtcgacgccgcccgcgccata	Protospacer
. . *********.******* *******. *

978. spacer 6.9|1126344|32|CP019611|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

979. spacer 6.9|1126344|32|CP019611|CRT matches to MN369761 (Mycobacterium phage Malthus, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

980. spacer 6.9|1126344|32|CP019611|CRT matches to MK224497 (Mycobacterium phage Henu3, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

981. spacer 6.9|1126344|32|CP019611|CRT matches to KJ944841 (Mycobacterium phage Cheetobro, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

982. spacer 6.9|1126344|32|CP019611|CRT matches to AP018469 (Mycobacterium phage Y10 DNA, complete genome, note: sample1) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

983. spacer 6.9|1126344|32|CP019611|CRT matches to KY087992 (Mycobacterium phage Mitti, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

984. spacer 6.9|1126344|32|CP019611|CRT matches to EF602154 (Burkholderia phage BcepNY3, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcaccgccgttgccgccggccgtatagac	Protospacer
*****.********* *********... *.

985. spacer 6.9|1126344|32|CP019611|CRT matches to MF140402 (Mycobacterium phage Chancellor, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

986. spacer 6.9|1126344|32|CP019611|CRT matches to AP018470 (Mycobacterium phage Y2 DNA, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

987. spacer 6.9|1126344|32|CP019611|CRT matches to KT361920 (Mycobacterium phage Slarp, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

988. spacer 6.9|1126344|32|CP019611|CRT matches to MT310882 (Mycobacterium phage JF1, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

989. spacer 6.9|1126344|32|CP019611|CRT matches to AP018471 (Mycobacterium phage Y10 DNA, complete genome, note: sample2) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

990. spacer 6.9|1126344|32|CP019611|CRT matches to KX621007 (Mycobacterium phage Taquito, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

991. spacer 6.9|1126344|32|CP019611|CRT matches to MH051258 (Mycobacterium phage SamScheppers, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ttcgcgccgccggtgacgcgggccgcgctgcc	Protospacer
.. ********* ****** ********.*

992. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP036221 (Mycobacterium avium subsp. hominissuis strain mc2 2500 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggggttccgccggtgacgccggcggcgccgat	Protospacer
  **. ****** ********** ******.

993. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP040251 (Mycobacterium avium subsp. hominissuis strain 101115 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggggttccgccggtgacgccggcggcgccgat	Protospacer
  **. ****** ********** ******.

994. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP040252 (Mycobacterium avium subsp. hominissuis strain 101115 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggggttccgccggtgacgccggcggcgccgat	Protospacer
  **. ****** ********** ******.

995. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP026546 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcggagccgccgttgccgccggccgaacctcg	Protospacer
 *** ********** ********* .**  .

996. spacer 6.9|1126344|32|CP019611|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agggcgccgccgctgccgccggccgcctccgg	Protospacer
  **********.** ********** .* *.

997. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP029334 (Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109b, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggggttccgccggtgacgccggcggcgccgat	Protospacer
  **. ****** ********** ******.

998. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccgcgctcgccgttgacgccggacacgccgcc	Protospacer
***   .*************** *.*****

999. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccgcgctcgccgttgacgccggacacgccgcc	Protospacer
***   .*************** *.*****

1000. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccgcgctcgccgttgacgccggacacgccgcc	Protospacer
***   .*************** *.*****

1001. spacer 6.9|1126344|32|CP019611|CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactaccggcgttgacgccgcccgcgccgcc	Protospacer
**. ..*** *********** ********

1002. spacer 6.9|1126344|32|CP019611|CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactaccggcgttgacgccgcccgcgccgcc	Protospacer
**. ..*** *********** ********

1003. spacer 6.9|1126344|32|CP019611|CRT matches to NC_047975 (Microbacterium phage Squash, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
aggacgccgccggagacgccggccgcgcggtc	Protospacer
  *.********  ************** *

1004. spacer 6.9|1126344|32|CP019611|CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccactaccggcgttgacgccgcccgcgccgcc	Protospacer
**. ..*** *********** ********

1005. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1006. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1007. spacer 6.9|1126344|32|CP019611|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
agggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1008. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1009. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1010. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcgccgccgttgacgccggcc----gcgccgga	CRISPR spacer
ggggggccgccgttgccgccggccggctgcgc----	Protospacer
  ** ********** ********    ****

1011. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttggtgtcgatctcgatctggccgttgcccgca	Protospacer
  * **.*****.**************** *..

1012. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agctggttgatgccgatctggccgctgccggtc	Protospacer
** . *..*** ************.*******

1013. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
atgctgccgaccccgatctggtcgttttcgact	Protospacer
* ********.**********.**** .**..

1014. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtcgaccttc	Protospacer
 ***************** ** ***.* *  *

1015. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.758

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
agctggttgatgccgatctggccgctgccggtc	Protospacer
** . *..*** ************.*******

1016. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgacgccggcctgctggtcgggctgacctc	Protospacer
********************* .. . *

1017. spacer 9.13|1716707|30|CP019611|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccgcaaactcctgctggtcggcgccggcgg	Protospacer
* .*.    ************* *******

1018. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

1019. spacer 9.13|1716707|30|CP019611|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccgcaaactcctgctggtcggcgccggcgg	Protospacer
* .*.    ************* *******

1020. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ccttcagggcgtgctggtcggctccggcgc	Protospacer
*  .   *** ******************

1021. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_KY126370 (Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1022. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggccgccggcctgctgtgcggctccgcgct	Protospacer
 * *************  ********

1023. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

1024. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
gttcaccgccctgctgatcggctccggcat	Protospacer
   *.*** *******.***********.

1025. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1026. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1027. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP032156 (Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
aatcgccggcctgctggtcggtgccgcggt	Protospacer
 . ******************. ***  *

1028. spacer 9.13|1716707|30|CP019611|CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
ggtgatcggcctgctggtcgtcgccggcgc	Protospacer
 *  ..************** * ******

1029. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_KP873172 (Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1030. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1031. spacer 9.13|1716707|30|CP019611|CRT matches to NC_021492 (Enterobacter sp. R4-368 plasmid pENT01, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1032. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1033. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP024682 (Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
catggccggcctgctgctcggcaccgggac	Protospacer
*.  ************ ***** **** .

1034. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.733

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cgatgccggcctgctggtcggggttcccag	Protospacer
***.*****************  ..  *.*

1035. spacer 9.15|1716803|30|CP019611|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cgaccatctcggctccgacggcgctggcgc	Protospacer
*   *  .*********.***********

1036. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1037. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gccaccccgcggctccggaggcgctggcgg	Protospacer
 *..*. . ********* ***********

1038. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1039. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1040. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1041. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1042. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1043. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1044. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1045. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1046. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1047. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcgccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1048. spacer 9.15|1716803|30|CP019611|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
tatcaggctcggcaccggcggcgctggcga	Protospacer
. *   *.***** ***************.

1049. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgctgatcggctccggcgccggcttctc	Protospacer
******* ************ ** .  *

1050. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gctgctgtgcggctccggcggcaaccccga	Protospacer
 ******* *************. .  **.

1051. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
cctgatgttcgactccggcggcgacgcacc	Protospacer
**** ******.*********** .*

1052. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 8, identity: 0.733

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gcaccgcgccggctccggcggcggtggcgg	Protospacer
 *  *   .************** ******

1053. spacer 9.17|1716893|36|CP019611|CRT matches to MG770216 (Mycobacterium phage Rem711, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
attcggcggcaacggcggcaacggcgcggccggcgc	Protospacer
..* . ************.******* ********

1054. spacer 9.17|1716893|36|CP019611|CRT matches to KY087993 (Mycobacterium phage Hammy, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtgcagc	Protospacer
** ******** *************** * .*  *

1055. spacer 9.17|1716893|36|CP019611|CRT matches to MF140406 (Mycobacterium phage DarthP, complete genome) position: , mismatch: 8, identity: 0.778

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtgcagc	Protospacer
** ******** *************** * .*  *

1056. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caacggcggcaacggcggcgacggcggtcgcggt--	Protospacer
 . ***************** ******  *.**.

1057. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ccccggcggcaacggcggcaacggcggcaatgcc--	Protospacer
  *****************. ******  .** *

1058. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
cgccggcggcagcgccggcgccggcagtatcggc--	Protospacer
 **********.** **********.*   .***

1059. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
tgtcggcggtaacggcggcgtcggcgg--agccagc	Protospacer
 *.******.**********.******  .**.*

1060. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

1061. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_047958 (Burkholderia phage vB_BmuP_KL4, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggccgcaacgacggcgccggcggccggtgc	Protospacer
 ****** ******.************ .**.

1062. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

1063. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

1064. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcgggaagggcggcgccggcggcggtctg	Protospacer
  ******* ** **************  * **.

1065. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

1066. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacgtcggcgccggt-----gccaatgtt	Protospacer
************** *********.     **.*

1067. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgccggcggaaacggtggcgccggcggcacggtg	Protospacer
 ******** *****.***********   * *.

1068. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
taccggcggcaatggaggcgccggcggcatcgcc-	Protospacer
 .**********.** *********** .* **.

1069. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

1070. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ctccggcggcaacggcggtgccgccgg--gaccact	Protospacer
  ****************.**** ***  *.*.*

1071. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN234223 (Mycobacterium phage Philly, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1072. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KJ194581 (Mycobacterium phage Audrey, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1073. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH051265 (Mycobacterium phage Yahalom, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1074. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH316565 (Mycobacterium phage Mortcellus, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1075. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT310871 (Mycobacterium phage Jackstina, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1076. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to EU816589 (Mycobacterium phage Phaedrus, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1077. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT952851 (Mycobacterium phage Gervas, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1078. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MG920059 (Mycobacterium phage Baloo, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1079. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_023686 (Mycobacterium phage Gadjet, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1080. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_041965 (Mycobacterium phage Athena, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1081. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to DQ398049 (Mycobacterium phage Pipefish, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1082. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT310892 (Mycobacterium phage Compostia, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1083. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN699018 (Mycobacterium phage Kamiyu, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gtccggcggcaacggcggcgcgggcgcagcgcac	Protospacer
* ******************* **** .  **

1084. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg----gtggcta	CRISPR spacer
cggcggcggcaccggcggcaccggcggtgccgtg----	Protospacer
 * ******** *******.*******    ***

1085. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta--	CRISPR spacer
ggccggcggcaacgggagcgccggc--ctcgccgcc	Protospacer
*************** .********   * **..

1086. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcg-gcaacggcggcgccggcgggtggcta	CRISPR spacer
-ccgagcgcgccacggcggctccggcgggtggccc	Protospacer
  * .*** ** ******** ************.

1087. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1088. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1089. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1090. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1091. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1092. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1093. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1094. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1095. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1096. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1097. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1098. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1099. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1100. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1101. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1102. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1103. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1104. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN698995 (Mycobacterium phage Dori, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggccctggcggctcggtg	Protospacer
 .***************** *.***** * * *.

1105. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ttccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1106. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
taccggcggcaacggcggcaacggcggcagcagc--	Protospacer
 .*****************. ******  *..**

1107. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN234184 (Mycobacterium phage IdentityCrisis, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caccggcggcagcggcggcgcaggcggaaacggc--	Protospacer
 .*********.********* *****  ..***

1108. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1109. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggcagcagc--	Protospacer
  *****************. ******  *..**

1110. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgg-gtggcta	CRISPR spacer
tctcggcggcgacggcggcgacggcggtgttgat-	Protospacer
  .*******.********* ****** ** * *

1111. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcaacggcggccgcggctgccagcca	Protospacer
.******************  **** * ..**.*

1112. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta-	CRISPR spacer
gcgcggcggcaccggcggcaccggc-ggcggtcat	Protospacer
*  ******** *******.***** **.**..*

1113. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN234183 (Mycobacterium phage Antsirabe, complete genome) position: , mismatch: 8, identity: 0.765

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgtcggcggcagcggcggcggcggcggacgtcca	Protospacer
 *.********.******** ******..* *.*

1114. spacer 11.9|2003599|37|CP019611|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.784

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
agtcggcggcggcggcggcaccggcgggaccggcggc	Protospacer
 ********.* **************** . ***..*

1115. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcgggcgccttgtccgccgctgccgccgggc	Protospacer
.   ********.******.*********

1116. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP039899 (Agrobacterium tumefaciens strain CFBP5877 plasmid pAtCFBP5877a, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1117. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP039913 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1118. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP039890 (Agrobacterium tumefaciens strain CFBP5499 plasmid pAtCFBP5499a, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1119. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1120. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1121. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1122. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcgagcgccttgcccgccgtggtcgccgccc	Protospacer
.   **************** *.***** *

1123. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to CP036360 (Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcagcgcaatgcccgccgttgccgccgcaa	Protospacer
... ****  ******************  *

1124. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP021914 (Sagittula sp. P11 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgc--gccttgcccgccgttgccgccggca	CRISPR spacer
--ccgctggccttgcccggggttgccgccgggg	Protospacer
  ..**  **********  *********** .

1125. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.742

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
attgccgccctggccgccgttgccgccgatc	Protospacer
* *  ****.** ***************..

1126. spacer 13.3|2875198|30|CP019611|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 8, identity: 0.733

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ccgcgagcagccgtcggtttgcgcgctgtc	Protospacer
.** ... **************.******.

1127. spacer 13.3|2875198|30|CP019611|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 8, identity: 0.733

tcggagaaagccgtcggtttgcacgctgtt	CRISPR spacer
ccgcgagcagccgtcggtttgcgcgctgtc	Protospacer
.** ... **************.******.

1128. spacer 17.26|3903131|29|CP019611|PILER-CR matches to MK599315 (Pseudomonas phage PA1C, complete genome) position: , mismatch: 8, identity: 0.724

tccgcgaaattcactgcgcgttattcaag	CRISPR spacer
gacgcgaaatacactgcgctttattttca	Protospacer
  ******** ******** *****.  .

1129. spacer 1.5|109775|34|CP019611|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.735

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
attgagatccgcgacgatgggtgtggcgccggcg	Protospacer
.**    .********.**** ***********.

1130. spacer 1.5|109775|34|CP019611|CRT matches to MG812496 (Gordonia phage SallySpecial, complete genome) position: , mismatch: 9, identity: 0.735

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gcgcaccaccgcggcggtgcgggtggcgccggcg	Protospacer
*. . *. *****.***** *************.

1131. spacer 1.9|110048|37|CP019611|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.757

cttgccggcggtgccggcgaccgcggtgccgccggcg	CRISPR spacer
ggagacggcggtgccggagaccgcggtgtcgctgccc	Protospacer
   * ************ **********.***.* *

1132. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gccggcggggccggcgggaccggcggggccggggg	Protospacer
. *************** * **********..

1133. spacer 2.11|320137|35|CP019611|CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
agcggcggggacggcggcagcggcgtgcagcgctg	Protospacer
********** ******.******* *    .**

1134. spacer 2.11|320137|35|CP019611|CRT matches to NC_028791 (Mycobacterium phage MOOREtheMARYer, complete genome) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
ggcggcggcgccggcggtaacggcggcgtgggcat	Protospacer
.******* **********.****** *. ..* *

1135. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggccgcggcaccggcggggccgccgccgatca	Protospacer
..  ****************** ** ***..

1136. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1137. spacer 2.13|320290|32|CP019611|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1138. spacer 2.13|320290|32|CP019611|CRT matches to NZ_LR594668 (Variovorax sp. SRS16 plasmid 3) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
acgcgcggcaccggctggtccggcgacgcgcg	Protospacer
* . *********** ** *********  .

1139. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1140. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1141. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1142. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggcaccggcggtgacggcggaaccgg	Protospacer
.**************** * *****. . *

1143. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggcaccggcggtgacggcggaaccgg	Protospacer
.**************** * *****. . *

1144. spacer 2.13|320290|32|CP019611|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gcaggcggcgccggcgaggccggcgaggggca	Protospacer
. *******.******.********* *. .

1145. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1146. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1147. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1148. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1149. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1150. spacer 2.13|320290|32|CP019611|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atgaccggcaccggcagggctggcgacgagca	Protospacer
* .. **********.****.******** .

1151. spacer 2.13|320290|32|CP019611|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atgaccggcaccggcagggctggcgacgagca	Protospacer
* .. **********.****.******** .

1152. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1153. spacer 2.13|320290|32|CP019611|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggggaccgccccggcgggaccggcgacgacga	Protospacer
...*.* ** ********.***********

1154. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cacgtcggccccgtcggggccggcgacgcgga	Protospacer
 * * **** *** **************

1155. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP023524 (Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcaccagcggtgccggcgaggcgcg	Protospacer
*  *********.**** ******** *  .

1156. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgac---gactc	CRISPR spacer
gcgcgcggcaccggcgaggccgtcgacctgga---	Protospacer
. . ************.***** ****   **

1157. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaatt	Protospacer
.  *  ********** ******** *** *.

1158. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP017564 (Paraburkholderia sprentiae WSM5005 plasmid pl3WSM5005, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcggcggaaccggcgcggccggcgaagccgg	Protospacer
.. ***** ******* ********* * *

1159. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP033429 (Burkholderia gladioli strain Burkholderia gladioli Co14 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcaccagcggtgccggcgaggcgcg	Protospacer
*  *********.**** ******** *  .

1160. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
accggcggcaccggcggtggcggcgaggcact	Protospacer
*  ************** * ****** *  ..

1161. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gttgcgggcaccggcgcggccggcgccgaatt	Protospacer
.  *  ********** ******** *** *.

1162. spacer 2.13|320290|32|CP019611|CRT matches to MN234219 (Mycobacterium phage Mercurio, complete genome) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gacgtcggcaccggcggcgccggcggcgcgaa	Protospacer
.* * ************ *******.**

1163. spacer 2.17|320599|35|CP019611|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

gctggcatcagcttcagcaacggcagcaacggcgg	CRISPR spacer
gccccaatcagcttcagcaacggcagcaccgcacc	Protospacer
**.   ********************** **

1164. spacer 2.19|320755|35|CP019611|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.743

gccggcggtagcggcggggccaacttcaacggcgg	CRISPR spacer
gccggcggtatcggcgggcccaactggctcgacct	Protospacer
********** ******* ******    **.*

1165. spacer 2.19|320755|35|CP019611|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.743

gccggcggtagcggcggggccaacttcaacggcgg	CRISPR spacer
gccggcggtatcggcgggcccaactggctcgacct	Protospacer
********** ******* ******    **.*

1166. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggccgcggcaccggcggggccgccgccgatca	Protospacer
..  ****************** ** ***..

1167. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1168. spacer 2.21|320899|32|CP019611|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1169. spacer 2.21|320899|32|CP019611|CRT matches to NZ_LR594668 (Variovorax sp. SRS16 plasmid 3) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
acgcgcggcaccggctggtccggcgacgcgcg	Protospacer
* . *********** ** *********  .

1170. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1171. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1172. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1173. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggcaccggcggtgacggcggaaccgg	Protospacer
.**************** * *****. . *

1174. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gaaggcggcaccggcggtgacggcggaaccgg	Protospacer
.**************** * *****. . *

1175. spacer 2.21|320899|32|CP019611|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gcaggcggcgccggcgaggccggcgaggggca	Protospacer
. *******.******.********* *. .

1176. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1177. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1178. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1179. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1180. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1181. spacer 2.21|320899|32|CP019611|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atgaccggcaccggcagggctggcgacgagca	Protospacer
* .. **********.****.******** .

1182. spacer 2.21|320899|32|CP019611|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atgaccggcaccggcagggctggcgacgagca	Protospacer
* .. **********.****.******** .

1183. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcggtgacggcggaaccgg	Protospacer
 **************** * *****. . *

1184. spacer 2.21|320899|32|CP019611|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggggaccgccccggcgggaccggcgacgacga	Protospacer
...*.* ** ********.***********

1185. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cacgtcggccccgtcggggccggcgacgcgga	Protospacer
 * * **** *** **************

1186. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP023524 (Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcaccagcggtgccggcgaggcgcg	Protospacer
*  *********.**** ******** *  .

1187. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgac---gactc	CRISPR spacer
gcgcgcggcaccggcgaggccgtcgacctgga---	Protospacer
. . ************.***** ****   **

1188. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaatt	Protospacer
.  *  ********** ******** *** *.

1189. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP017564 (Paraburkholderia sprentiae WSM5005 plasmid pl3WSM5005, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcggcggaaccggcgcggccggcgaagccgg	Protospacer
.. ***** ******* ********* * *

1190. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP033429 (Burkholderia gladioli strain Burkholderia gladioli Co14 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
atcggcggcaccagcggtgccggcgaggcgcg	Protospacer
*  *********.**** ******** *  .

1191. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
accggcggcaccggcggtggcggcgaggcact	Protospacer
*  ************** * ****** *  ..

1192. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gttgcgggcaccggcgcggccggcgccgaatt	Protospacer
.  *  ********** ******** *** *.

1193. spacer 2.21|320899|32|CP019611|CRT matches to MN234219 (Mycobacterium phage Mercurio, complete genome) position: , mismatch: 9, identity: 0.719

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gacgtcggcaccggcggcgccggcggcgcgaa	Protospacer
.* * ************ *******.**

1194. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gccggcggggccggcgggaccggcggggccggggg	Protospacer
. *************** * **********..

1195. spacer 2.26|321352|35|CP019611|CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
agcggcggggacggcggcagcggcgtgcagcgctg	Protospacer
********** ******.******* *    .**

1196. spacer 2.26|321352|35|CP019611|CRT matches to NC_028791 (Mycobacterium phage MOOREtheMARYer, complete genome) position: , mismatch: 9, identity: 0.743

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
ggcggcggcgccggcggtaacggcggcgtgggcat	Protospacer
.******* **********.****** *. ..* *

1197. spacer 4.13|1119343|39|CP019611|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.769

--ccgaagagcaaaccggcgtcgccgccgcgcccgccggcc	CRISPR spacer
ggccggcgg--aaaccggcgtcgccgcggcggccgccggag	Protospacer
  ***. *.  **************** *** *******

1198. spacer 6.7|1126236|41|CP019611|CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.78

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
gcggcgccgccggggccgccgttgccgcctgcgccgccgtt	Protospacer
..*.  ******* *************** ********* .

1199. spacer 6.7|1126236|41|CP019611|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 9, identity: 0.78

atgagcccgcc-----ggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
-----cgcgccgccgtggcgcggccgatgccgccggcgccgccggt	Protospacer
     * ****     ***** **** ******************.

1200. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1201. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP018080 (Sulfitobacter sp. AM1-D1 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agggcgccgccgatgacggcggccgcggtcag	Protospacer
  ********** ***** ******** . ..

1202. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
tcatccgcgccgtcgaggccggccgcgccgcg	Protospacer
.*. *  ******.** ************* .

1203. spacer 6.9|1126344|32|CP019611|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1204. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

----ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
agttgcag----gccgatgccgccggccgcgccggt	Protospacer
     *.*    **** ** ***************

1205. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
tgcgccacgccgatgacgccgcccgcgccgcc	Protospacer
.  **  ***** ******** ********

1206. spacer 6.9|1126344|32|CP019611|CRT matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1207. spacer 6.9|1126344|32|CP019611|CRT matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1208. spacer 6.9|1126344|32|CP019611|CRT matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1209. spacer 6.9|1126344|32|CP019611|CRT matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1210. spacer 6.9|1126344|32|CP019611|CRT matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1211. spacer 6.9|1126344|32|CP019611|CRT matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1212. spacer 6.9|1126344|32|CP019611|CRT matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1213. spacer 6.9|1126344|32|CP019611|CRT matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1214. spacer 6.9|1126344|32|CP019611|CRT matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1215. spacer 6.9|1126344|32|CP019611|CRT matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1216. spacer 6.9|1126344|32|CP019611|CRT matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1217. spacer 6.9|1126344|32|CP019611|CRT matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1218. spacer 6.9|1126344|32|CP019611|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1219. spacer 6.9|1126344|32|CP019611|CRT matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1220. spacer 6.9|1126344|32|CP019611|CRT matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1221. spacer 6.9|1126344|32|CP019611|CRT matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1222. spacer 6.9|1126344|32|CP019611|CRT matches to MK524494 (Mycobacterium phage Rabbs, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1223. spacer 6.9|1126344|32|CP019611|CRT matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1224. spacer 6.9|1126344|32|CP019611|CRT matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1225. spacer 6.9|1126344|32|CP019611|CRT matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1226. spacer 6.9|1126344|32|CP019611|CRT matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1227. spacer 6.9|1126344|32|CP019611|CRT matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1228. spacer 6.9|1126344|32|CP019611|CRT matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1229. spacer 6.9|1126344|32|CP019611|CRT matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1230. spacer 6.9|1126344|32|CP019611|CRT matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1231. spacer 6.9|1126344|32|CP019611|CRT matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1232. spacer 6.9|1126344|32|CP019611|CRT matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1233. spacer 6.9|1126344|32|CP019611|CRT matches to NC_031102 (Mycobacterium phage Sneeze, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1234. spacer 6.9|1126344|32|CP019611|CRT matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1235. spacer 6.9|1126344|32|CP019611|CRT matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1236. spacer 6.9|1126344|32|CP019611|CRT matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1237. spacer 6.9|1126344|32|CP019611|CRT matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1238. spacer 6.9|1126344|32|CP019611|CRT matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1239. spacer 6.9|1126344|32|CP019611|CRT matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1240. spacer 6.9|1126344|32|CP019611|CRT matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1241. spacer 6.9|1126344|32|CP019611|CRT matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1242. spacer 6.9|1126344|32|CP019611|CRT matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1243. spacer 6.9|1126344|32|CP019611|CRT matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1244. spacer 6.9|1126344|32|CP019611|CRT matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1245. spacer 6.9|1126344|32|CP019611|CRT matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1246. spacer 6.9|1126344|32|CP019611|CRT matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1247. spacer 6.9|1126344|32|CP019611|CRT matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1248. spacer 6.9|1126344|32|CP019611|CRT matches to JN412593 (Mycobacterium phage Liefie, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1249. spacer 6.9|1126344|32|CP019611|CRT matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1250. spacer 6.9|1126344|32|CP019611|CRT matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1251. spacer 6.9|1126344|32|CP019611|CRT matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1252. spacer 6.9|1126344|32|CP019611|CRT matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1253. spacer 6.9|1126344|32|CP019611|CRT matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1254. spacer 6.9|1126344|32|CP019611|CRT matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaatcgccgccgttcccgccggccgcgccctg	Protospacer
  . **********  *************  .

1255. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gcggcggcgccgatgacgccggcccgggtgtg	Protospacer
 ***** ***** ***********  * .* .

1256. spacer 6.9|1126344|32|CP019611|CRT matches to NC_019958 (Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccccgtccgccgcagacgccggccgcgccccc	Protospacer
**    ******. ***************

1257. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1258. spacer 6.9|1126344|32|CP019611|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1259. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1260. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1261. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcgcgccgccgctgccgccggccgcccacgg	Protospacer
 . *********.** ********** *  *.

1262. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ccggcgacggcgttgacgccggcgatggcctc	Protospacer
****** ** ************* ..* *

1263. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtattcgatcccgatctggccgtcgccggcc	Protospacer
  *.  .******************.*****.

1264. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

1265. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

1266. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 9, identity: 0.727

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
cggctgccgatcccgatcaggacgtctaccttc	Protospacer
 ***************** ** ***.  *  *

1267. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to NZ_CP014964 (Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
ggaacgaacggcaagccgaaatgttggtgga	Protospacer
.* .**************** .*****

1268. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
taagcgaacggtaagccgaaccgctgaggcg	Protospacer
 . ********.***********.**.. *

1269. spacer 8.1|1482437|31|CP019611|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.71

agcgcgaacggcaagccgaaccgttggaccc	CRISPR spacer
taagcgaacggtaagccgaaccgctgaggcg	Protospacer
 . ********.***********.**.. *

1270. spacer 9.13|1716707|30|CP019611|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.7

cgacgccggcctgctggtcggctccggcgg	CRISPR spacer
cggcgccggcctgctggtcggactgctcac	Protospacer
**.****************** ..   *.

1271. spacer 9.15|1716803|30|CP019611|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.7

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gaccacgttcggctccggccgcgctcgcgt	Protospacer
  .  .************* ***** ***

1272. spacer 9.15|1716803|30|CP019611|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.7

cctgctgttcggctccggcggcgctggcgg	CRISPR spacer
gaccacgttcggctccggccgcgctcgcgt	Protospacer
  .  .************* ***** ***

1273. spacer 9.17|1716893|36|CP019611|CRT matches to MF140398 (Mycobacterium phage Amohnition, complete genome) position: , mismatch: 9, identity: 0.75

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gcagatcggcaccggcggtaacggcggcggtacggc	Protospacer
** ******** *************** * ..  *

1274. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgg--gtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcaacggc--	Protospacer
 . ****************. ******  ..***

1275. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
cagcggcggcaacggcggccgcggcggcgacggc--	Protospacer
 . ****************  *****  *..***

1276. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgccggcggcaactgcggcgccggcgcccaccgc	Protospacer
 ************ ************  .. *

1277. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
cagcggcagcaatggcggcgccggcggcgccggc--	Protospacer
 . ****.****.*************  * .***

1278. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cggcggcgggaccggcggcgccggcggcagtatc	Protospacer
 * ****** * ***************  *  *

1279. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to EF602154 (Burkholderia phage BcepNY3, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

1280. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AY369265 (Burkholderia cenocepacia phage Bcep1, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

1281. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_005263 (Burkholderia phage Bcep1, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcggcaacggcggtgccggtgcgccagcc	Protospacer
******************.*****.* *. . .

1282. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcggcattttc	Protospacer
.**********  **************    .*

1283. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcggcattttc	Protospacer
.**********  **************    .*

1284. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgtcggcggccacggcggcgtcggcggtcaggaa	Protospacer
 *.******* *********.****** ..*  *

1285. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP053906 (Hymenobacter sp. BRD67 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaccggcggcggcggcgggggcacc	Protospacer
 .********* ******** ******* *  .

1286. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KC170279 (Uncultured bacterium plasmid pMBUI8, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggcgccggcgtctaccag	Protospacer
  ********** *************  *. * .

1287. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1288. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gaccggcggcaccggcggcgccgccggccatcat	Protospacer
*.********* *********** *** .. *

1289. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1290. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1291. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1292. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1293. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cggcggcggcaatggcggcaccggcggcacggtc	Protospacer
 * *********.******.*******   * *

1294. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1295. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1296. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcggcagcggtggtgga	Protospacer
  ****************** *.****  *   *

1297. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1298. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1299. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1300. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1301. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1302. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1303. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1304. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1305. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1306. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1307. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1308. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1309. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1310. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggtggcaatggcggcgccggcggcgaggtc	Protospacer
 .****.*****.**************  .* *

1311. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1312. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1313. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gaccggcggcaacggcggcggcggtggctcctcg	Protospacer
*.****************** ***.** *  ...

1314. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1315. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1316. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1317. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaacggcggcaacggcggctatccc	Protospacer
 .*****************. ****** *. *.

1318. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KX443399 (Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

1319. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KX443400 (Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

1320. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KX443398 (Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

1321. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to CP054922 (Streptomyces sp. NA03103 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggcggccccggcggcgccggccagctgcac	Protospacer
 *********  ************* .*. **

1322. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KP851975 (Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

1323. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
ctgcggcggcgacggcggcaccggcggaggcagc--	Protospacer
   *******.********.******  **..**

1324. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gttcggcggcgagggcggcgccggcggcaagcgt	Protospacer
* .*******.* **************  .**

1325. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KF439868 (Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta-----	CRISPR spacer
ggccggcggcaacggaggggccgg-----agccacagga	Protospacer
*************** ** *****     .**.*

1326. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacggcggcaacggcggccgcggcggctccgtg	Protospacer
 * ****************  ****** *   *.

1327. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1328. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgcggcggcgccggcggcgccggcggcgaggga	Protospacer
*  *******. ***************  .*  *

1329. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

1330. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1331. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
caccggcggcaacggcggcaccgccgacaacggc--	Protospacer
 .*****************.*** **  ...***

1332. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1333. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1334. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1335. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1336. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013512 (Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1337. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
agccggcggcataggcggcgccggcagcatcctc	Protospacer
.**********  ************.*    **

1338. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

1339. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcg--ggtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcggcagc--	Protospacer
 . ****************. *****  **..**

1340. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

1341. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gagcggcggcaacggcggcaacggcggcttcccc	Protospacer
*. ****************. ****** *  *.

1342. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP041653 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacggccgcaacggcggctccggcggcgggaac	Protospacer
 * **** *********** *******  **

1343. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

1344. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccggcgaccacggcggcgccggtgcgctccat	Protospacer
********.* *************.* *.  *

1345. spacer 11.9|2003599|37|CP019611|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.757

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
ggtgggcggtgccggcggcagcggcggcatggccttc	Protospacer
 ** **************** ******  *.* *  *

1346. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcctcgccctgcccgccgttgccgcccacg	Protospacer
.... ****.***************** .*.

1347. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
tggcccgccttgccctccattgccgccggac	Protospacer
 . . ********** **.**********

1348. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
atccttgccttgaccgccgttgccgccgctg	Protospacer
* .. .****** *************** ..

1349. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
accccagccctgcccgccgttgccgccgctc	Protospacer
* ..  ***.****************** .

1350. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gcttgcgcctggcccgccgtagccggacacc	Protospacer
. ******** ********* ****   .*

1351. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
accggcaccttgcccgccattgccgccatgt	Protospacer
* . **.***********.********.

1352. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP013740 (Streptomyces globisporus C-1027 plasmid pSGL1, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
cgggccgccttgtccgccgtggccgccgacc	Protospacer
 .   *******.******* *******.*

1353. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.71

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
agcgtggccttggccgccgttgccggcggtc	Protospacer
*..   ****** ************ ***.

1354. spacer 1.5|109775|34|CP019611|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
cagcgcggccgcgtcggtgggggtggcgcccgcc	Protospacer
   . *  ***** **************** **

1355. spacer 1.5|109775|34|CP019611|CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

1356. spacer 1.5|109775|34|CP019611|CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

1357. spacer 1.5|109775|34|CP019611|CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.706

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
gagaccgcccgcgatggagggggtggcgccgagc	Protospacer
*   .* *******.** *************.

1358. spacer 2.11|320137|35|CP019611|CRT matches to MN908687 (Gordonia phage Skog, complete genome) position: , mismatch: 10, identity: 0.714

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
ggcggcgggtccggcggtaacggcggtttcttcac	Protospacer
.******** *********.******  .*  * .

1359. spacer 2.11|320137|35|CP019611|CRT matches to NC_019917 (Burkholderia phage BcepMigl, complete genome) position: , mismatch: 10, identity: 0.714

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
atcggcgcggccggcggtaccggcgggaagtatgg	Protospacer
* ***** *********** *******.   *.

1360. spacer 2.13|320290|32|CP019611|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtcatccgcagcggcggggccggcgaggaccg	Protospacer
.  . * *** *************** ***.

1361. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cccggccgcaccggcggtgccggcgaccgagg	Protospacer
   *** ********** ********* .

1362. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggttcccgcacccgcggggcccgcgacgaccg	Protospacer
..   * ***** ******** ********.

1363. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
tggtccggccccggcggggccggagacgggtt	Protospacer
 ..  **** ************* ****. *.

1364. spacer 2.13|320290|32|CP019611|CRT matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1365. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcgcgtccggccagcgtga	Protospacer
 *************** * ***** *  ..

1366. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agtacgggcaccggcggggcgggcgccgaaag	Protospacer
*. .  ************** **** ***

1367. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054026 (Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gccgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1368. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP054036 (Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1369. spacer 2.13|320290|32|CP019611|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1370. spacer 2.13|320290|32|CP019611|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1371. spacer 2.13|320290|32|CP019611|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1372. spacer 2.13|320290|32|CP019611|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1373. spacer 2.13|320290|32|CP019611|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1374. spacer 2.13|320290|32|CP019611|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1375. spacer 2.13|320290|32|CP019611|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1376. spacer 2.13|320290|32|CP019611|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1377. spacer 2.13|320290|32|CP019611|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1378. spacer 2.13|320290|32|CP019611|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1379. spacer 2.13|320290|32|CP019611|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1380. spacer 2.13|320290|32|CP019611|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1381. spacer 2.13|320290|32|CP019611|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1382. spacer 2.13|320290|32|CP019611|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1383. spacer 2.13|320290|32|CP019611|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1384. spacer 2.16|320527|35|CP019611|CRT matches to MH142220 (UNVERIFIED: Acidithiobacillus phage AcaML1 strain BC13 genomic sequence) position: , mismatch: 10, identity: 0.714

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
ttcctgggtgccggcggcagctacggctccgccac	Protospacer
  *   ************* * ********* *.

1385. spacer 2.16|320527|35|CP019611|CRT matches to MH142219 (UNVERIFIED: Acidithiobacillus phage AcaML1 strain F genomic sequence) position: , mismatch: 10, identity: 0.714

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
ttcctgggtgccggcggcagctacggctccgccac	Protospacer
  *   ************* * ********* *.

1386. spacer 2.16|320527|35|CP019611|CRT matches to JX507079 (Acidithiobacillus phage AcaML1, complete genome) position: , mismatch: 10, identity: 0.714

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
ttcctgggtgccggcggcagctacggctccgccac	Protospacer
  *   ************* * ********* *.

1387. spacer 2.17|320599|35|CP019611|CRT matches to MK310141 (Mycobacterium phage Fenn, complete genome) position: , mismatch: 10, identity: 0.714

gctggcatcagcttcagcaacggcagcaacggcgg	CRISPR spacer
aacgacctcagcatcagcagcggcagcaacggaac	Protospacer
. .*.* ***** ******.************ .

1388. spacer 2.17|320599|35|CP019611|CRT matches to MK524523 (Mycobacterium phage Naira, complete genome) position: , mismatch: 10, identity: 0.714

gctggcatcagcttcagcaacggcagcaacggcgg	CRISPR spacer
aacgacctcagcatcagcagcggcagcaacggaac	Protospacer
. .*.* ***** ******.************ .

1389. spacer 2.21|320899|32|CP019611|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gtcatccgcagcggcggggccggcgaggaccg	Protospacer
.  . * *** *************** ***.

1390. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cccggccgcaccggcggtgccggcgaccgagg	Protospacer
   *** ********** ********* .

1391. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggttcccgcacccgcggggcccgcgacgaccg	Protospacer
..   * ***** ******** ********.

1392. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
tggtccggccccggcggggccggagacgggtt	Protospacer
 ..  **** ************* ****. *.

1393. spacer 2.21|320899|32|CP019611|CRT matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1394. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
caaggcggcaccggcgcgtccggccagcgtga	Protospacer
 *************** * ***** *  ..

1395. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agtacgggcaccggcggggcgggcgccgaaag	Protospacer
*. .  ************** **** ***

1396. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054026 (Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gccgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1397. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP054036 (Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
gctgcgggcaccggcgcggccggcgccgaact	Protospacer
.  *  ********** ******** *** ..

1398. spacer 2.21|320899|32|CP019611|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1399. spacer 2.21|320899|32|CP019611|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1400. spacer 2.21|320899|32|CP019611|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1401. spacer 2.21|320899|32|CP019611|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1402. spacer 2.21|320899|32|CP019611|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1403. spacer 2.21|320899|32|CP019611|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1404. spacer 2.21|320899|32|CP019611|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1405. spacer 2.21|320899|32|CP019611|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1406. spacer 2.21|320899|32|CP019611|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1407. spacer 2.21|320899|32|CP019611|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1408. spacer 2.21|320899|32|CP019611|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1409. spacer 2.21|320899|32|CP019611|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1410. spacer 2.21|320899|32|CP019611|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1411. spacer 2.21|320899|32|CP019611|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1412. spacer 2.21|320899|32|CP019611|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 10, identity: 0.688

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
cgaggcggcaccggcggcggcggcggtgcggt	Protospacer
 .*************** * *****..*   .

1413. spacer 2.26|321352|35|CP019611|CRT matches to MN908687 (Gordonia phage Skog, complete genome) position: , mismatch: 10, identity: 0.714

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
ggcggcgggtccggcggtaacggcggtttcttcac	Protospacer
.******** *********.******  .*  * .

1414. spacer 2.26|321352|35|CP019611|CRT matches to NC_019917 (Burkholderia phage BcepMigl, complete genome) position: , mismatch: 10, identity: 0.714

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
atcggcgcggccggcggtaccggcgggaagtatgg	Protospacer
* ***** *********** *******.   *.

1415. spacer 6.7|1126236|41|CP019611|CRT matches to MG925349 (Mycobacterium phage Mendokysei, complete genome) position: , mismatch: 10, identity: 0.756

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
gggaacccgccgtcgccgccgttgccgccggccgcgatcac	Protospacer
. **.******* *******************  ** . .*

1416. spacer 6.7|1126236|41|CP019611|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.756

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
tcgcggcagatggcggcgccgatgccgccggcgccgccggt	Protospacer
 .* * * * .**** ***** ******************.

1417. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
tgctcgccgccgatgacgccggccgtgcgcag	Protospacer
.   ******** ************.**  ..

1418. spacer 6.9|1126344|32|CP019611|CRT matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
ggctccccgccgttgacgcccgcagcgccctt	Protospacer
    * ************** ** *****

1419. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gacaggccgccgtcgacgccggccgcaccccg	Protospacer
   . ********.************.**  .

1420. spacer 6.9|1126344|32|CP019611|CRT matches to NZ_CP032692 (Rhizobium sp. CCGE532 plasmid pRCCGE532b, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
gaaaagcggccgtagacgccggccgcgctgac	Protospacer
  .. ** ***** **************.*.

1421. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtactcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

1422. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtactcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

1423. spacer 7.6|1154557|33|CP019611|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 10, identity: 0.697

aggctgccgatcccgatctggccgttgccggtg	CRISPR spacer
ttgtattcgatgccgatctggccgtcgccggcc	Protospacer
  *.  .**** *************.*****.

1424. spacer 9.2|1716203|39|CP019611|CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.744

cggcgcgggcggggccgtcacgggaaccggcgccaccgg	CRISPR spacer
cacgggggccggggccgccacgggaaccggcgccccgcc	Protospacer
*.  * ** ********.**************** *

1425. spacer 9.17|1716893|36|CP019611|CRT matches to MN369764 (Mycobacterium phage Rahalelujah, complete genome) position: , mismatch: 10, identity: 0.722

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
atctggaggcaacggcggtaacggcggggccagcac	Protospacer
... .  ************************.**.

1426. spacer 9.17|1716893|36|CP019611|CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

gctgatcggcaacggcggtaacggcggggccggcgg	CRISPR spacer
gaccggcggcaacggcggaaacggcggcgccgcagc	Protospacer
* . . ************ ******** ****  *

1427. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcg-----ggtggcta	CRISPR spacer
ccgcggcggcgacggcggcgcgggcggcaccggt-----	Protospacer
   *******.********** ****     ***

1428. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gagcggcggcaacggcggtaccggcggtgacgtc	Protospacer
*. ***************..*******  .  *

1429. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acccggcggcaccggcggcgcgggcggtccggcc	Protospacer
. ********* ********* ***** . * .

1430. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to CP000620 (Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgccggcggcatcggcgccgccggcgcggcatcg	Protospacer
 ********** ***** ******** *  ....

1431. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP020810 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaccggaggcgccggcggaggcacc	Protospacer
  ********* *** ***********. *  .

1432. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
atccggcggcgccggcggcgccggcggcggaact	Protospacer
. ********. ***************  *. .

1433. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

1434. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggcaccggcggcaccggcggcaccgga	Protospacer
 .********* *******.*******      *

1435. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

1436. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ctccggcggcaacggcggcaacggcggctccacg	Protospacer
  *****************. ****** *   ..

1437. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1438. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AP018709 (Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1439. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta-------	CRISPR spacer
ggccgacggcaagggcggcgcc-------ggttacgcctcc	Protospacer
*****.****** *********       **.**

1440. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcatcggcggcgcgggcgaggcccag	Protospacer
  ********* ********* ****.*   * .

1441. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_008766 (Acidovorax sp. JS42 plasmid pAOVO02, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1442. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tgacggcggcaacagcggcaccggcggagcgaag	Protospacer
 * **********.*****.*******.  *  .

1443. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1444. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1445. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcatcggcggcgcgggcgaggcccag	Protospacer
  ********* ********* ****.*   * .

1446. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1447. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_024998 (Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1448. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_008385 (Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1449. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP018471 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1450. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1451. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_MN366359 (Bacterium plasmid pALTS31, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1452. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP027024 (Streptomyces sp. WAC00288 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcaacaacggcggcgccggcgccttcttc	Protospacer
 .*****..*****************  *  .*

1453. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_001735 (Enterobacter aerogenes plasmid R751, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1454. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AGRM01000006 (Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1455. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AJ863570 (Uncultured bacterium IncP-1beta multiresistance plasmid pB8) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1456. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1457. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgtctgggccacggcggcgctggcgggtgggtg	Protospacer
*  .   *** **********.********* *.

1458. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgtctgggccacggcggcgctggcgggtgggtg	Protospacer
*  .   *** **********.********* *.

1459. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_021492 (Enterobacter sp. R4-368 plasmid pENT01, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1460. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JX469828 (Uncultured bacterium plasmid pRSB223, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tcccggcggcaagggcggtgccggcgtctatcag	Protospacer
  ********** *****.*******  *. * .

1461. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JX469829 (Uncultured bacterium plasmid pB1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tcccggcggcaagggcggtgccggcgtctatcag	Protospacer
  ********** *****.*******  *. * .

1462. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1463. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1464. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1465. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1466. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1467. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1468. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1469. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1470. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1471. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN386974 (Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1472. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_001381 (Mycobacterium fortuitum plasmid pAL5000, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
gcgcggcggcagcggcggcgctggcggcggcacg	Protospacer
*  ********.*********.*****  *  ..

1473. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1474. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP021650 (Acidovorax sp. T1 plasmid p2-T1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1475. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to JX486125 (Uncultured bacterium plasmid pRWC72a, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1476. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP038640 (Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1477. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to AJ639924 (Uncultured bacterium plasmid pB3 complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1478. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KU356987 (Variovorax paradoxus plasmid pBS64, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1479. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to KU356988 (Variovorax paradoxus plasmid pHB44, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1480. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcgacggcggcgacggcgccccgcgc	Protospacer
  ********.********* *****  . **

1481. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP009797 (Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1482. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1483. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_019320 (Variovorax sp. DB1 plasmid pDB1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1484. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP017455 (Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1485. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NC_007337 (Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1486. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_MN366358 (Bacterium plasmid pALTS29, complete sequence) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ccccggcggcaagggcggtgccggcgtctaccag	Protospacer
  ********** *****.*******  *. * .

1487. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MN234219 (Mycobacterium phage Mercurio, complete genome) position: , mismatch: 10, identity: 0.706

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cgacgtcggcaccggcggcgccggcggcgcgaag	Protospacer
 * ** ***** ***************   *  .

1488. spacer 11.9|2003599|37|CP019611|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 10, identity: 0.73

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
cctcgacggtgccggcggcatcggcgggcgctggacc	Protospacer
. ***.**************.*******.   * * *

1489. spacer 11.9|2003599|37|CP019611|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 10, identity: 0.73

tgtcggcggtgccggcggcaccggcgggttaggcaac	CRISPR spacer
cctcgacggtgccggcggcatcggcgggcgctggacc	Protospacer
. ***.**************.*******.   * * *

1490. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gggctcgcctcgcccgccgttcccgccgctc	Protospacer
.. . *****.********** ****** .

1491. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ttcctcgccttccccgccgctgccgccgcgg	Protospacer
  .. ****** *******.********  .

1492. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggccagaacttccccgctgttgccgccggca	Protospacer
..... . *** *****.*************

1493. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
gggctcgcctcgcccgccgttcccgccgctc	Protospacer
.. . *****.********** ****** .

1494. spacer 12.10|2359683|31|CP019611|CRISPRCasFinder matches to NZ_AP014581 (Burkholderia sp. RPE67 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.677

aattgcgccttgcccgccgttgccgccggca	CRISPR spacer
ggcgtggccttggccgccgttgccggcggtc	Protospacer
...   ****** ************ ***.

1495. spacer 12.13|2359932|34|CP019611|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.706

gtcgccgtgcagccagccaccaccgccaccggcg	CRISPR spacer
ccgatgatgcagccggccaccaccgccaccagca	Protospacer
 . .. .*******.***************.**.

1496. spacer 15.9|3898951|35|CP019611|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 10, identity: 0.714

acttgcgcgcacaacgcatccgccatccacggggc	CRISPR spacer
gtcaccgcgcacaacacattcgccatccacacggt	Protospacer
...  **********.***.**********. **.

1497. spacer 17.22|3904004|34|CP019611|CRISPRCasFinder,CRT matches to NZ_AP022335 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence) position: , mismatch: 10, identity: 0.706

tagaaggcgatcactggaagcacggcgcttgcga	CRISPR spacer
ggcaaggcgatcagtggaagctcggcggcggcac	Protospacer
 . ********** ******* ***** . **.

1498. spacer 17.38|3904008|34|CP019611|PILER-CR matches to NZ_AP022335 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence) position: , mismatch: 10, identity: 0.706

tagaaggcgatcactggaagcacggcgcttgcga	CRISPR spacer
ggcaaggcgatcagtggaagctcggcggcggcac	Protospacer
 . ********** ******* ***** . **.

1499. spacer 1.5|109775|34|CP019611|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 11, identity: 0.676

gttttctcccgcgacggtgggggtggcgccggca	CRISPR spacer
cgcccccggcgtgacggtggaggtggcgccggcc	Protospacer
  ...*.  **.********.************

1500. spacer 1.9|110048|37|CP019611|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.703

cttgccggcggtgccggcgaccgcggtgccgccggcg	CRISPR spacer
gccgtgcacggcgccggcggccgcggtgccgccgctg	Protospacer
 ..*.  .***.*******.************** .*

1501. spacer 2.11|320137|35|CP019611|CRT matches to MT498048 (Mycobacterium phage Raymond7, complete genome) position: , mismatch: 11, identity: 0.686

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gctggcggggccggcggtagcggtggcgcgtcacc	Protospacer
. .********************.** **    ..

1502. spacer 2.11|320137|35|CP019611|CRT matches to KF986246 (Mycobacterium phage MichelleMyBell, complete genome) position: , mismatch: 11, identity: 0.686

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gctggcggggccggcggtagcggtggcgcgtcacc	Protospacer
. .********************.** **    ..

1503. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 11, identity: 0.656

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcttcggcaccggcgggccgggcgacgcgct	Protospacer
..   ************* * *******  ..

1504. spacer 2.13|320290|32|CP019611|CRT matches to NZ_CP022194 (Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.656

-----aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agttcaaggccggcaccgccggggccgccttc-----	Protospacer
     **.* ******** ******** *  *

1505. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1506. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1507. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1508. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1509. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1510. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1511. spacer 2.16|320527|35|CP019611|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1512. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1513. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1514. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1515. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1516. spacer 2.16|320527|35|CP019611|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1517. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1518. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1519. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1520. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1521. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1522. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1523. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1524. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1525. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1526. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1527. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1528. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1529. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1530. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1531. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1532. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1533. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1534. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1535. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1536. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1537. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1538. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1539. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1540. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1541. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1542. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1543. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1544. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1545. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1546. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1547. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1548. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1549. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1550. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1551. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1552. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1553. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1554. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1555. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1556. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1557. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1558. spacer 2.16|320527|35|CP019611|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1559. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1560. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1561. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1562. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1563. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacatt	Protospacer
. *****.***********.*******. *.

1564. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1565. spacer 2.16|320527|35|CP019611|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.686

agcagcggtgccggcggcaccaacggctccggcgg	CRISPR spacer
gtcagcgatgccggcggcatcaacggccacacgtt	Protospacer
. *****.***********.*******. *.

1566. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 11, identity: 0.656

aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
ggcttcggcaccggcgggccgggcgacgcgct	Protospacer
..   ************* * *******  ..

1567. spacer 2.21|320899|32|CP019611|CRT matches to NZ_CP022194 (Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.656

-----aaaggcggcaccggcggggccggcgacgactc	CRISPR spacer
agttcaaggccggcaccgccggggccgccttc-----	Protospacer
     **.* ******** ******** *  *

1568. spacer 2.26|321352|35|CP019611|CRT matches to MT498048 (Mycobacterium phage Raymond7, complete genome) position: , mismatch: 11, identity: 0.686

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gctggcggggccggcggtagcggtggcgcgtcacc	Protospacer
. .********************.** **    ..

1569. spacer 2.26|321352|35|CP019611|CRT matches to KF986246 (Mycobacterium phage MichelleMyBell, complete genome) position: , mismatch: 11, identity: 0.686

agcggcggggccggcggtagcggcggggccaactt	CRISPR spacer
gctggcggggccggcggtagcggtggcgcgtcacc	Protospacer
. .********************.** **    ..

1570. spacer 6.7|1126236|41|CP019611|CRT matches to NC_015147 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE302, complete sequence) position: , mismatch: 11, identity: 0.732

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
ggccactggccggcgccgcagttgccgccgccgccgccctc	Protospacer
.   .*. *********** ********** *******  *

1571. spacer 6.7|1126236|41|CP019611|CRT matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 11, identity: 0.732

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
ggccactggccggcgccgcagttgccgccgccgccgccctc	Protospacer
.   .*. *********** ********** *******  *

1572. spacer 6.9|1126344|32|CP019611|CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 11, identity: 0.656

-ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
cagcgcgccgccggcgtccacggcggcgccgt-	Protospacer
    ********* .* *  **** ******

1573. spacer 6.9|1126344|32|CP019611|CRT matches to NC_023067 (Streptomyces sp. F2 plasmid pFP3, complete sequence) position: , mismatch: 11, identity: 0.656

ccggcgccgccgttgacgccggccgcgccgga	CRISPR spacer
atcacgccgccgtcgacgtcggccgcggactg	Protospacer
 . .*********.****.********    .

1574. spacer 6.10|1126398|32|CP019611|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

attaaccagccgccgtccccgccattggcccc	CRISPR spacer
gcccgaacgccgccctccccggcattggcccg	Protospacer
... .   ****** ****** *********

1575. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caacggcggcaacggcggcaacggcggcacgtcg	Protospacer
 . ****************. ******   *...

1576. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tttcggcggcagcggcggcggcggcggaaccccg	Protospacer
  .********.******** ******.   *..

1577. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MH051334 (Escherichia phage vB_EcoS-Ro145c2YLVW, complete genome) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggcggctacggcggcggcggcggcaattgg	Protospacer
 .******** ********* ******  . . .

1578. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to MG852086 (Escherichia phage vB_EcoS-Ro145clw, complete genome) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
taccggcggctacggcggcggcggcggcaattgg	Protospacer
 .******** ********* ******  . . .

1579. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caccggcggccacggcggggccggcggcgacgcg	Protospacer
 .******** ******* ********  .  ..

1580. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
tttcggcggcaagggcggcgccgccggcgatcag	Protospacer
  .********* ********** ***  . * .

1581. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
caggggcggcaacggcggccccggcaggacggcg	Protospacer
 .  *************** *****.**  * ..

1582. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
cataggcggcgatggcggcgccggcgggatggcg	Protospacer
 .. ******.*.***************  * ..

1583. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 11, identity: 0.676

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
ggccgacggcaagggcggcgccggatacgccccc	Protospacer
*****.****** ***********  .    *.

1584. spacer 11.5|2003383|40|CP019611|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.725

tgccggcggcgccggcggtgtcggcggacccgccgggttg	CRISPR spacer
ggttggcggcaccggcggtgtcggcggagccggtgacatc	Protospacer
 *..******.***************** *** .*.  *

1585. spacer 6.7|1126236|41|CP019611|CRT matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 12, identity: 0.707

atgagcccgccggcgccgccgttgccgccggcgccgccggc	CRISPR spacer
gccgtgccgccggcgccgccgctgccgccggtgccgaacac	Protospacer
.. .  ***************.*********.****   .*

1586. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 12, identity: 0.647

ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
aaccggcggcgacggcgtcgccggcgccaattcg	Protospacer
..********.****** ********   . ...

1587. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_CP026703 (Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 12, identity: 0.647

ggccggcggcaacggcggcgc-----cggcgggtggcta	CRISPR spacer
-gccggaaacgccggcgccgctgttgcggccggtg----	Protospacer
 ***** ..*. ***** ***     **** ****

1588. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 14, identity: 0.588

-----ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acggcggccgccggcgccggcgtttccgccgaga-----	Protospacer
     ***** ****. ***** . *** **.*

1589. spacer 11.3|2003278|34|CP019611|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 15, identity: 0.559

-----ggccggcggcaacggcggcgccggcgggtggcta	CRISPR spacer
acggcggccgccggcgccgacgtttccgccgaga-----	Protospacer
     ***** ****. **.** . *** **.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1916425 : 1968357

Klosneuvirus(18.18%)

integrase,transposase,tRNA,protease

attL 1924248:1924264|attR 1973306:1973322

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY76744.1\|1916425_1917985_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.8e-100	39.2
AWY76745.1\|1918070_1918865_+	DNAase	NA	NA	NA	NA
AWY76746.1\|1919072_1920161_+	resuscitation-promoting factor RpfB	Q856D9	Mycobacterium_phage	8.2e-22	59.4
AWY76747.1\|1920133_1921087_+	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AWY79040.1\|1921172_1922093_+	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
AWY76748.1\|1922109_1922403_+	hypothetical protein	NA	NA	NA	NA
AWY79041.1\|1922450_1922681_-	hypothetical protein	NA	NA	NA	NA
AWY76749.1\|1922606_1924241_+	polyketide synthase	NA	NA	NA	NA
1924248:1924264	attL	NA	NA	NA	NA
AWY76750.1\|1924314_1924890_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
AWY76751.1\|1924902_1925550_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
AWY76752.1\|1925766_1926447_-	hypothetical protein	NA	NA	NA	NA
AWY76753.1\|1926482_1927463_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	1.8e-44	32.7
AWY76754.1\|1927554_1929042_-	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase	NA	NA	NA	NA
AWY76755.1\|1929296_1929890_+	TetR family transcriptional regulator	NA	NA	NA	NA
AWY76756.1\|1929948_1933653_+	transcription-repair coupling factor	NA	NA	NA	NA
AWY76757.1\|1933652_1934630_+	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
AWY76758.1\|1934717_1935449_+	hypothetical protein	NA	NA	NA	NA
AWY76759.1\|1935545_1936835_+	enolase	W6LP63	Streptococcus_phage	2.1e-133	56.6
AWY76760.1\|1936839_1937526_+	septation inhibitor protein	NA	NA	NA	NA
AWY79042.1\|1937542_1938010_+	hypothetical protein	NA	NA	NA	NA
AWY76761.1\|1938000_1938960_+	exopolyphosphatase	NA	NA	NA	NA
AWY76762.1\|1939199_1939412_+	hypothetical protein	NA	NA	NA	NA
AWY76763.1\|1939408_1940089_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.2e-24	30.6
AWY76764.1\|1940085_1942668_-	sensor protein KdpD	NA	NA	NA	NA
AWY76765.1\|1942758_1942905_+	potassium transporter Trk	NA	NA	NA	NA
AWY79043.1\|1942901_1942994_+	K+-transporting ATPase subunit F	NA	NA	NA	NA
AWY76766.1\|1942993_1944709_+	K+-transporting ATPase subunit A	NA	NA	NA	NA
AWY76767.1\|1944705_1946835_+	potassium-transporting ATPase B chain	M1HRW9	Paramecium_bursaria_Chlorella_virus	3.8e-23	26.2
AWY76768.1\|1946834_1947404_+	potassium-transporting ATPase C chain	NA	NA	NA	NA
AWY76769.1\|1947407_1948937_-	two-component sensor histidine kinase	NA	NA	NA	NA
AWY76770.1\|1948944_1949718_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.3e-34	36.3
AWY76771.1\|1951525_1951810_-	ESAT-6-like protein EsxI	NA	NA	NA	NA
AWY76772.1\|1951836_1952133_-	ESAT-6-like protein EsxK	NA	NA	NA	NA
AWY76773.1\|1952278_1953454_-	PPE family protein	NA	NA	NA	NA
AWY76774.1\|1953530_1954358_-	PE family protein	NA	NA	NA	NA
AWY76775.1\|1954918_1955167_+	hypothetical protein	NA	NA	NA	NA
AWY76776.1\|1955145_1955385_-	hypothetical protein	NA	NA	NA	NA
AWY76777.1\|1955290_1955509_-	hypothetical protein	NA	NA	NA	NA
AWY76778.1\|1955553_1956417_-\|transposase	IS5 family transposase	A0A1V0SLQ8	Klosneuvirus	1.1e-05	28.7
AWY79044.1\|1956763_1957789_-\|protease	serine protease	NA	NA	NA	NA
AWY76779.1\|1958035_1958659_+	hypothetical protein	NA	NA	NA	NA
AWY76780.1\|1958655_1959537_+	hypothetical protein	NA	NA	NA	NA
AWY76781.1\|1959618_1960407_-	hypothetical protein	NA	NA	NA	NA
AWY76782.1\|1960406_1961654_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.1e-81	45.1
AWY76783.1\|1962021_1963137_-	hypothetical protein	NA	NA	NA	NA
AWY76784.1\|1963093_1963297_-	hypothetical protein	NA	NA	NA	NA
AWY76785.1\|1963369_1963816_+	MarR family transcriptional regulator	NA	NA	NA	NA
AWY79045.1\|1963864_1964770_+	oxidoreductase	NA	NA	NA	NA
AWY76786.1\|1964928_1965684_-	hypothetical protein	NA	NA	NA	NA
AWY79046.1\|1965978_1966605_-	hypothetical protein	NA	NA	NA	NA
AWY76787.1\|1966650_1966854_+	hypothetical protein	NA	NA	NA	NA
AWY76788.1\|1967549_1967888_+\|integrase	integrase	NA	NA	NA	NA
AWY76789.1\|1967911_1968226_+\|integrase	integrase	Q854H9	Mycobacterium_phage	1.0e-09	53.6
AWY76790.1\|1968162_1968357_+\|integrase	integrase	A0A2H4JG32	uncultured_Caudovirales_phage	3.8e-07	54.5
1973306:1973322	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3721475 : 3762804

Mycobacterium_phage(27.27%)

integrase,protease,transposase,tRNA,capsid

attL 3750276:3750303|attR 3759900:3759927

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY78241.1\|3721475_3723554_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.5e-104	34.9
AWY78242.1\|3723662_3723890_+	hypothetical protein	NA	NA	NA	NA
AWY78243.1\|3723886_3725272_-	PE family protein	NA	NA	NA	NA
AWY78244.1\|3725616_3726117_+	hypothetical protein	NA	NA	NA	NA
AWY78245.1\|3726133_3726574_-	hypothetical protein	NA	NA	NA	NA
AWY79235.1\|3726720_3727398_+	transcriptional regulator	NA	NA	NA	NA
AWY78246.1\|3727382_3727736_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AWY78247.1\|3727748_3728174_-	hypothetical protein	NA	NA	NA	NA
AWY78248.1\|3728170_3728845_-	transcriptional regulator	NA	NA	NA	NA
AWY78249.1\|3728922_3729744_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AWY78250.1\|3729879_3730773_+	universal stress protein	NA	NA	NA	NA
AWY78251.1\|3730775_3731594_-	universal stress protein	NA	NA	NA	NA
AWY78252.1\|3731608_3732790_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AWY78253.1\|3732848_3733280_-	hypoxic response protein 1	A0A2I6B2H4	Macacine_betaherpesvirus	1.9e-75	100.0
AWY78254.1\|3733793_3735035_-	alpha/beta hydrolase	NA	NA	NA	NA
AWY79236.1\|3735344_3735707_+	hypothetical protein	NA	NA	NA	NA
AWY78255.1\|3736053_3737178_+	hypothetical protein	NA	NA	NA	NA
AWY78256.1\|3737179_3737719_+	archease	NA	NA	NA	NA
AWY78257.1\|3737858_3739157_+	RNA-splicing ligase RtcB	A2RQD0	Archaeal_BJ1_virus	3.8e-90	43.3
AWY78258.1\|3739195_3739477_-	hypothetical protein	NA	NA	NA	NA
AWY78259.1\|3739621_3740107_-	hypothetical protein	NA	NA	NA	NA
AWY78260.1\|3740133_3740391_-	hypothetical protein	NA	NA	NA	NA
AWY78261.1\|3740391_3742728_-	PE family protein	NA	NA	NA	NA
AWY78262.1\|3742756_3742999_+	hypothetical protein	NA	NA	NA	NA
AWY78263.1\|3742999_3743677_+	hypothetical protein	NA	NA	NA	NA
AWY78264.1\|3743872_3744529_+	protein DedA	NA	NA	NA	NA
AWY78265.1\|3744691_3745138_+	anti-anti-sigma factor	NA	NA	NA	NA
AWY78266.1\|3745312_3745645_-	hypothetical protein	NA	NA	NA	NA
AWY78267.1\|3745764_3746124_-	transcriptional regulator	NA	NA	NA	NA
AWY78268.1\|3746225_3746684_+	cadmium-induced protein CadI	NA	NA	NA	NA
AWY78269.1\|3746819_3747200_+	transcriptional regulator	NA	NA	NA	NA
AWY78270.1\|3747196_3748693_+	arsenic-transport integral membrane protein ArsC	A0A2H4PQT9	Staphylococcus_phage	5.1e-14	39.7
AWY79237.1\|3748927_3749119_+	antitoxin MazE	NA	NA	NA	NA
3750276:3750303	attL	NA	NA	NA	NA
AWY78271.1\|3750409_3750841_+	hypothetical protein	NA	NA	NA	NA
AWY78272.1\|3750837_3751836_+\|integrase	integrase	A0A2D1G8E2	Mycobacterium_phage	7.4e-62	47.8
AWY78273.1\|3751849_3752314_+	hypothetical protein	NA	NA	NA	NA
AWY78274.1\|3752301_3752553_+	hypothetical protein	NA	NA	NA	NA
AWY78275.1\|3752723_3754163_-\|capsid	major capsid protein	A0A1B3AYS4	Gordonia_phage	1.4e-66	40.6
AWY78276.1\|3754170_3754704_-\|protease	prophage protease	A0A2H4JB68	uncultured_Caudovirales_phage	3.1e-06	32.9
AWY78277.1\|3754856_3755483_-	hypothetical protein	V9H0V4	Actinophage	1.6e-17	47.2
AWY79238.1\|3755514_3755838_-	toxin	NA	NA	NA	NA
AWY78278.1\|3755917_3756163_-	antitoxin	NA	NA	NA	NA
AWY78279.1\|3756159_3757587_-	hypothetical protein	NA	NA	NA	NA
AWY78280.1\|3757588_3757981_-	hypothetical protein	NA	NA	NA	NA
AWY78281.1\|3757977_3758238_-	hypothetical protein	A0A2P1CHK7	Mycobacterium_phage	3.0e-15	64.6
AWY79239.1\|3758254_3758617_-	hypothetical protein	NA	NA	NA	NA
AWY78282.1\|3758619_3759747_-\|integrase	integrase	A0A1X9SFC1	Mycobacterium_phage	1.5e-66	40.4
AWY79240.1\|3759891_3760119_-	hypothetical protein	NA	NA	NA	NA
3759900:3759927	attR	NA	NA	NA	NA
AWY79241.1\|3760115_3760505_-	hypothetical protein	NA	NA	NA	NA
AWY78283.1\|3760410_3760683_+	hypothetical protein	NA	NA	NA	NA
AWY78284.1\|3760781_3761015_+	hypothetical protein	NA	NA	NA	NA
AWY78285.1\|3761025_3761280_+	hypothetical protein	NA	NA	NA	NA
AWY79242.1\|3762000_3762804_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.5e-46	46.4

DBSCAN-SWA_3

3879339 : 3901969

Burkholderia_virus(40.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY78394.1\|3879339_3880719_-\|transposase	transposase	A0A7P9	Microcystis_virus	9.3e-31	30.3
AWY78395.1\|3880718_3881300_-\|transposase	IS607 family transposase	F9VHY9	Thermus_phage	5.0e-18	30.6
AWY78396.1\|3881501_3882398_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AWY78397.1\|3882394_3883078_-	4'-phosphopantetheinyl transferase	NA	NA	NA	NA
AWY78398.1\|3883074_3884049_-	metallophosphoesterase	NA	NA	NA	NA
AWY78399.1\|3884193_3884757_-	hypothetical protein	NA	NA	NA	NA
AWY78400.1\|3884756_3886445_-	hypothetical protein	NA	NA	NA	NA
AWY79264.1\|3886448_3886775_-	hypothetical protein	NA	NA	NA	NA
AWY78401.1\|3886905_3887535_+	DUF3558 domain-containing protein	NA	NA	NA	NA
AWY78402.1\|3887553_3889203_+	hydrolase	NA	NA	NA	NA
AWY78403.1\|3889304_3889661_-	mRNA interferase MazF9	NA	NA	NA	NA
AWY78404.1\|3889644_3889875_-	antitoxin MazE	NA	NA	NA	NA
AWY78405.1\|3889917_3890961_-	hypothetical protein	NA	NA	NA	NA
AWY78406.1\|3890959_3891427_+	hypothetical protein	NA	NA	NA	NA
AWY78407.1\|3891602_3891794_-	hypothetical protein	NA	NA	NA	NA
AWY78408.1\|3891776_3891932_+	histone acetyltransferase	NA	NA	NA	NA
AWY79265.1\|3892004_3892409_+	hypothetical protein	NA	NA	NA	NA
AWY78409.1\|3892405_3892597_+	hypothetical protein	NA	NA	NA	NA
AWY78410.1\|3892795_3893950_+\|transposase	transposase	NA	NA	NA	NA
AWY78411.1\|3894183_3894441_+	hypothetical protein	NA	NA	NA	NA
AWY78412.1\|3894545_3894857_+	hypothetical protein	NA	NA	NA	NA
AWY78413.1\|3895276_3895885_+	hypothetical protein	NA	NA	NA	NA
AWY78414.1\|3895955_3897365_+\|transposase	transposase	NA	NA	NA	NA
AWY78415.1\|3897361_3898174_+	AAA family ATPase	NA	NA	NA	NA
AWY79266.1\|3899278_3900115_-\|transposase	transposase	Q8W6R2	Burkholderia_virus	2.9e-83	59.0
AWY78416.1\|3900213_3900540_-	hypothetical protein	A0A1B3AZF8	Gordonia_phage	4.2e-14	43.1
AWY79267.1\|3901132_3901969_-\|transposase	transposase	Q8W6R2	Burkholderia_virus	2.9e-83	59.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP019611

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection