CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP030762	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence	0 crisprs	PD-DExK	0	2
CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	0 crisprs	csa3	0	0
CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	0 crisprs	csa3,DEDDh	0	0
CP030760	Rhizobium leguminosarum strain ATCC 14479 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,cas3	1	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6421 : 70954

Mycobacterium_phage(16.67%)

transposase,integrase

attL 36152:36211|attR 71702:71715

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA43471.1\|6421_7597_-\|transposase	Putative transposase family protein	NA	NA	NA	NA
AXA43472.1\|7610_8471_-\|integrase	Phage integrase family protein	S5W9T9	Leptospira_phage	1.4e-32	33.7
AXA43473.1\|9754_10075_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.5e-19	49.5
AXA43474.1\|10078_10480_+	Thioredoxin family protein	NA	NA	NA	NA
AXA43475.1\|11319_12093_-	Thiazole biosynthesis protein ThiG family protein	NA	NA	NA	NA
AXA43476.1\|12094_12292_-	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
AXA43477.1\|12288_13275_-	glycine oxidase ThiO	NA	NA	NA	NA
AXA43478.1\|13277_15002_-	phosphomethylpyrimidine synthase	NA	NA	NA	NA
AXA43479.1\|15503_16214_-	hypothetical protein	NA	NA	NA	NA
AXA43480.1\|16503_16725_-	hypothetical protein	NA	NA	NA	NA
AXA43481.1\|17161_17638_-	AsnC family protein	NA	NA	NA	NA
AXA43482.1\|17780_18800_+	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
AXA43483.1\|19371_19779_-	hypothetical protein	NA	NA	NA	NA
AXA43484.1\|19847_20564_-	hypothetical protein	NA	NA	NA	NA
AXA43485.1\|20688_21093_-	hypothetical protein	NA	NA	NA	NA
AXA43486.1\|21270_21906_+	Autoinducer synthetase family protein	NA	NA	NA	NA
AXA43487.1\|22069_22795_+	Autoinducer binding domain family protein	NA	NA	NA	NA
AXA43488.1\|23340_23985_-	ABC transporter family protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-10	25.7
AXA43489.1\|23977_24754_-	ABC transporter family protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-12	24.1
AXA43490.1\|24750_25713_-	Branched-chain amino acid transport system / permease component family protein	NA	NA	NA	NA
AXA43491.1\|25709_26606_-	Branched-chain amino acid transport system / permease component family protein	NA	NA	NA	NA
AXA43492.1\|26750_28031_-	Periplasmic binding family protein	NA	NA	NA	NA
AXA43493.1\|28561_29392_-	Bacterial transcriptional regulator family protein	NA	NA	NA	NA
AXA43494.1\|29951_30920_+	Aldehyde dehydrogenase family protein	NA	NA	NA	NA
AXA43495.1\|30945_32109_+	Iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
AXA43496.1\|32156_32948_+	Metallo-beta-lactamase family protein	NA	NA	NA	NA
AXA43497.1\|33116_34292_+	alpha/beta hydrolase fold family protein	NA	NA	NA	NA
AXA43498.1\|34467_34560_+	hypothetical protein	NA	NA	NA	NA
AXA43499.1\|35037_35295_+	hypothetical protein	NA	NA	NA	NA
AXA43500.1\|35413_35524_-	hypothetical protein	NA	NA	NA	NA
AXA43501.1\|35737_36013_+	putative integral membrane protein	NA	NA	NA	NA
36152:36211	attL	NA	NA	NA	NA
AXA43502.1\|36275_37517_+\|integrase	Phage integrase family protein	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
36152:36211	attL	NA	NA	NA	NA
AXA43503.1\|37513_38437_+\|integrase	Phage integrase family protein	NA	NA	NA	NA
AXA43504.1\|38433_39435_+\|integrase	Phage integrase family protein	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
AXA43505.1\|39317_41003_-	Transposase IS66 family protein	A0A218MNE7	uncultured_virus	8.1e-45	31.9
AXA43506.1\|41128_41473_-	IS66 Orf2 like family protein	NA	NA	NA	NA
AXA43507.1\|42149_42953_+	4Fe-4S binding domain family protein	NA	NA	NA	NA
AXA43508.1\|43592_44789_-	Alpha/beta hydrolase family protein	NA	NA	NA	NA
AXA43509.1\|44739_45357_-	Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E) family protein	NA	NA	NA	NA
AXA43510.1\|46284_46503_+	Coenzyme A transferase family protein	NA	NA	NA	NA
AXA43511.1\|47260_47965_+	Transglycosylase SLT domain family protein	A0A1P8CWQ1	Bacillus_phage	4.2e-19	45.8
AXA43512.1\|48430_48970_+	hypothetical protein	NA	NA	NA	NA
AXA43513.1\|48966_49536_+	hypothetical protein	NA	NA	NA	NA
AXA43514.1\|49607_49859_+	hypothetical protein	NA	NA	NA	NA
AXA43515.1\|49878_50793_+	FMN-dependent dehydrogenase family protein	NA	NA	NA	NA
AXA43516.1\|52143_53037_+	CobQ/CobB/MinD/ParA nucleotide binding domain family protein	A0A240F4U1	Ochrobactrum_phage	2.3e-38	42.1
AXA43517.1\|53036_53147_+	hypothetical protein	NA	NA	NA	NA
AXA43518.1\|53139_54393_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.7e-68	40.4
AXA43519.1\|54989_55454_-	Immunity protein 14 family protein	NA	NA	NA	NA
AXA43520.1\|55771_56773_-\|integrase	Phage integrase family protein	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
AXA43521.1\|56769_57693_-\|integrase	Phage integrase family protein	NA	NA	NA	NA
AXA43522.1\|57689_58931_-\|integrase	Phage integrase family protein	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
AXA43523.1\|58982_60500_-	Transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	7.5e-90	40.9
58996:59119	attR	NA	NA	NA	NA
AXA43524.1\|60568_60922_-	IS66 Orf2 like family protein	NA	NA	NA	NA
58996:59119	attR	NA	NA	NA	NA
AXA43525.1\|60918_61305_-	Transposase family protein	NA	NA	NA	NA
AXA43526.1\|61806_62520_-\|integrase	Phage integrase family protein	A0A160DCT0	Gordonia_phage	4.0e-09	30.7
AXA43527.1\|62640_62805_-	hypothetical protein	NA	NA	NA	NA
AXA43528.1\|62801_63335_-\|integrase	Phage integrase family protein	NA	NA	NA	NA
AXA43529.1\|63425_63620_-	hypothetical protein	NA	NA	NA	NA
AXA43530.1\|63719_64001_-\|integrase	Phage integrase family protein	NA	NA	NA	NA
AXA43531.1\|64211_64622_+	Transposase family protein	NA	NA	NA	NA
AXA43532.1\|64618_64966_+	IS66 Orf2 like family protein	A0A0P0ZDM8	Stx2-converting_phage	9.8e-38	62.6
AXA43533.1\|65011_66631_+	Transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	1.6e-90	45.5
AXA43534.1\|66682_67924_+\|integrase	Phage integrase family protein	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
AXA43535.1\|67920_68844_+\|integrase	Phage integrase family protein	NA	NA	NA	NA
AXA43536.1\|68840_69842_+\|integrase	Phage integrase family protein	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
AXA43537.1\|70084_70954_-\|integrase	Phage integrase family protein	NA	NA	NA	NA
71702:71715	attR	NA	NA	NA	NA

DBSCAN-SWA_2

121061 : 136652

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA43584.1\|121061_121688_+	GTP cyclohydrolase I family protein	E7DN69	Pneumococcus_phage	4.4e-44	44.3
AXA43585.1\|121687_122695_+	Adenylosuccinate synthetase family protein	A0A1B3B082	Gordonia_phage	6.8e-31	30.9
AXA43586.1\|122691_123990_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.0e-19	34.7
AXA43587.1\|124045_124741_-	4Fe-4S single cluster domain family protein	A0A0A0RTJ1	Escherichia_phage	3.7e-44	43.5
AXA43588.1\|124737_125943_-	IMP dehydrogenase / GMP reductase domain family protein	A0A1V0SHK8	Klosneuvirus	1.2e-66	36.5
AXA43589.1\|125939_126611_-	Nitrile hydratase, alpha chain family protein	NA	NA	NA	NA
AXA43590.1\|126610_127315_-	Queuosine biosynthesis protein QueC family protein	A0A1V0DY95	Dinoroseobacter_phage	1.9e-32	40.5
AXA43591.1\|127389_128055_-	Haloacid dehalogenase-like hydrolase family protein	NA	NA	NA	NA
AXA43592.1\|128051_128624_-	Phosphoribosyl transferase domain family protein	NA	NA	NA	NA
AXA43593.1\|128940_129402_+	6-pyruvoyl tetrahydropterin synthase family protein	NA	NA	NA	NA
AXA43594.1\|129538_129712_+	hypothetical protein	A0A077SL39	Escherichia_phage	3.2e-05	58.3
AXA43595.1\|129746_130289_+	DDE domain family protein	A0A077SL39	Escherichia_phage	5.9e-21	40.3
AXA43596.1\|130301_130547_-	hypothetical protein	NA	NA	NA	NA
AXA43597.1\|130543_131173_-	hypothetical protein	NA	NA	NA	NA
AXA43598.1\|131984_132191_-	cold-shock DNA-binding domain family protein	A0A1W6JNX5	Morganella_phage	1.8e-10	50.0
AXA43599.1\|132432_133143_-	Transposase DDE domain family protein	Q1MVF0	Enterobacteria_phage	9.7e-32	37.9
AXA43600.1\|133903_134689_-	Transposase DDE domain family protein	Q1MVF0	Enterobacteria_phage	9.4e-36	37.3
AXA43601.1\|134768_135185_+	hypothetical protein	NA	NA	NA	NA
AXA43602.1\|135305_136652_-	HTH-like domain family protein	A0A1B1P773	Bacillus_phage	1.6e-22	32.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030760_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030760_1

4119676-4119755

Orphan

Consensus_repeat	Method
TGCCGAAAAGTGTGAGCGGTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030760_1

>merge|CP030760|1|4119676-4119755|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTTCGGGCAACATCATGCTCCCACTATTAAAGCATGGTGCCGGAAAGTGTGAGCGGTTTT

>CP030760|1|1|4119676-4119755|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTT	CGGGCAACATCATGCTCCCACTATTAAAGCATGG
TGCCGGAAAGTGTGAGCGGTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP030760.1\|AXA41527.1\|4128502_4129642_-\|Histidine-kinase-,-DNA-gyrase-B-,-and-HSP90-like-ATPase-family-protein	unknown	unknown	gnl\|CDD\|223715
CP030760.1\|AXA41520.1\|4121784_4122036_-\|exodeoxyribonuclease-VII,-small-subunit	unknown	unknown	gnl\|CDD\|179195
CP030760.1\|AXA41513.1\|4112244_4113495_-\|tRNA-(Uracil-5-)-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|225174
CP030760.1\|AXA41515.1\|4114370_4115369_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373054
CP030760.1\|AXA41512.1\|4111231_4112242_-\|Beta-lactamase-domain-family-protein	unknown	unknown	gnl\|CDD\|293841
CP030760.1\|AXA41511.1\|4110395_4111151_+\|Enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|168351
CP030760.1\|AXA41521.1\|4122038_4122974_-\|Histone-deacetylase-domain-family-protein	unknown	unknown	gnl\|CDD\|212541
CP030760.1\|AXA41523.1\|4123696_4124308_-\|2'-5'-RNA-ligase-family-protein	unknown	unknown	gnl\|CDD\|379265
CP030760.1\|AXA41508.1\|4106824_4107310_+\|BA14K-like-family-protein	unknown	unknown	gnl\|CDD\|369573
CP030760.1\|AXA41526.1\|4128154_4128376_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|215598
CP030760.1\|AXA41519.1\|4120927_4121695_-\|short-chain-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|212491
CP030760.1\|AXA41524.1\|4124467_4125991_-\|FAD-binding-domain-family-protein	unknown	unknown	gnl\|CDD\|235870
CP030760.1\|AXA41517.1\|4117655_4119572_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|224076
CP030760.1\|AXA41518.1\|4119794_4120718_-\|Pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
CP030760.1\|AXA41522.1\|4123257_4123659_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223894
CP030760.1\|AXA41525.1\|4126445_4127990_+\|tRNA-synthetases-class-I-(M)-family-protein	unknown	unknown	gnl\|CDD\|237012
CP030760.1\|AXA41510.1\|4108607_4110386_+\|Acyl-CoA-dehydrogenase,-C-terminal-domain-family-protein	unknown	unknown	gnl\|CDD\|173842
CP030760.1\|AXA41509.1\|4107403_4108399_-\|CorA-like-Mg2+-transporter-family-protein	unknown	unknown	gnl\|CDD\|213368
CP030760.1\|AXA41514.1\|4113491_4114277_-\|FtsJ-like-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224110
CP030760.1\|AXA41516.1\|4115588_4117535_+\|Methyl-accepting-chemotaxis-protein-(MCP)-signaling-domain-family-protein	unknown	unknown	gnl\|CDD\|214599

Protein	Function_ID	Function_description	E-value
CP030760.1\|AXA41527.1\|4128502_4129642_-\|Histidine-kinase-,-DNA-gyrase-B-,-and-HSP90-like-ATPase-family-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.71334e-41
CP030760.1\|AXA41520.1\|4121784_4122036_-\|exodeoxyribonuclease-VII,-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.83197e-24
CP030760.1\|AXA41513.1\|4112244_4113495_-\|tRNA-(Uracil-5-)-methyltransferase-family-protein	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	4.5785e-121
CP030760.1\|AXA41515.1\|4114370_4115369_+\|hypothetical-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	3.64472e-129
CP030760.1\|AXA41512.1\|4111231_4112242_-\|Beta-lactamase-domain-family-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.76119e-76
CP030760.1\|AXA41511.1\|4110395_4111151_+\|Enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	1.24586e-161
CP030760.1\|AXA41521.1\|4122038_4122974_-\|Histone-deacetylase-domain-family-protein	gnl\|CDD\|212541	cd11599, HDAC_classII_2, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes eukaryotic as well as bacterial Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. In D. discoideum, where four homologs (HdaA, HdaB, HdaC, HdaD) have been identified, HDAC activity is important for regulating the timing of gene expression during development. Also, inhibition of HDAC activity by trichostatin A is shown to cause hyperacetylation of the histone and a delay in cell aggregation and differentiation.	3.26826e-156
CP030760.1\|AXA41523.1\|4123696_4124308_-\|2'-5'-RNA-ligase-family-protein	gnl\|CDD\|379265	pfam13563, 2_5_RNA_ligase2, 2'-5' RNA ligase superfamily. This family contains proteins related to pfam02834. These proteins are likely to be enzymes, but they may not share the RNA ligase activity.	0.00015911
CP030760.1\|AXA41508.1\|4106824_4107310_+\|BA14K-like-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.84683e-10
CP030760.1\|AXA41526.1\|4128154_4128376_+\|hypothetical-protein	gnl\|CDD\|215598	PLN03138, PLN03138, Protein TOC75; Provisional.	0.00211985
CP030760.1\|AXA41519.1\|4120927_4121695_-\|short-chain-dehydrogenase-family-protein	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.10785e-68
CP030760.1\|AXA41524.1\|4124467_4125991_-\|FAD-binding-domain-family-protein	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	5.79499e-101
CP030760.1\|AXA41517.1\|4117655_4119572_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|224076	COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism].	0
CP030760.1\|AXA41518.1\|4119794_4120718_-\|Pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	1.74269e-104
CP030760.1\|AXA41522.1\|4123257_4123659_+\|hypothetical-protein	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	1.95552e-13
CP030760.1\|AXA41525.1\|4126445_4127990_+\|tRNA-synthetases-class-I-(M)-family-protein	gnl\|CDD\|237012	PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed.	7.10983e-176
CP030760.1\|AXA41510.1\|4108607_4110386_+\|Acyl-CoA-dehydrogenase,-C-terminal-domain-family-protein	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.10631e-148
CP030760.1\|AXA41509.1\|4107403_4108399_-\|CorA-like-Mg2+-transporter-family-protein	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.40768e-112
CP030760.1\|AXA41514.1\|4113491_4114277_-\|FtsJ-like-methyltransferase-family-protein	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	1.2727e-115
CP030760.1\|AXA41516.1\|4115588_4117535_+\|Methyl-accepting-chemotaxis-protein-(MCP)-signaling-domain-family-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.65517e-68

>CP030760.1|AXA41517.1|4117655_4119572_-|1-deoxy-D-xylulose-5-phosphate-synthase
MTQLPKTPLLDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNIDRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNGRGPVLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEAALDDKIVGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAELKHMVRTAVAYDGGPISFRYPRGEGVGVDMPARGEILQIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFGSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFRALGRGVAVGVAG
>CP030760.1|AXA41516.1|4115588_4117535_+|Methyl-accepting-chemotaxis-protein-(MCP)-signaling-domain-family-protein
MSAKNISLNGKLAATFAALILIFVAISAFVYSKATASAAASAEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTATGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNATKGQLDGFRQASAKIKATAREKSNALAAIRADANSDLKTTLLAGGILASLAAAVLAWLMSRTIVRPVVGMTAAMDRLAGGQNDIEVPAVERGDEIGRMAQSVLVFKQAAIEKLRLAGETDRMRDDAERQRRAGDEQKAREEGEIRYAIDALAGGLAELANGDMAGRIQTPFASQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEEVTTTVRDSAKRAEDVGNLVERTRLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVGLVGETGKALEVIVSEVQEINHHVNAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHALAQEANALDELLRQFKLGQAKADAPAPRAAVAGTSSRPVASPAHALTRTVAKAFGGRQAAATATVQEEWTEF
>CP030760.1|AXA41515.1|4114370_4115369_+|hypothetical-protein
MLKLFTLIVAAVIASPALANDTMAEVKTGGLIFAQSDDVSMAEEDLFISASEVRVDYIFENSSEKDVESLVAFPMPDITGQVDNNSAISDYDSNNFLHFSTVQDGKPITAKLQQRVVSLGIDVTDEFAKLGIPVLPYSQKTTEALAKLPETVRKDWISRGLVYPMGAGDAAGVDLVPLWTLRSTYWWRTTFPAKKKVSVEHRYKPAVGGTVAISFLEGGEPKGDRFEEYSRKYCLDGDFVRVAQQRAREAEAGGANYTESWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVQKIGPTTFRMASEDFDPTRDFDILILNPPETAQ
>CP030760.1|AXA41514.1|4113491_4114277_-|FtsJ-like-methyltransferase-family-protein
MLATGGFAGHAQPMSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFGADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLLRGAQHVTAIDVGHGQMHPRISGDPRVTNREGLNARNMTAEDIGHPATFIVSDVSFITLKLALAPALEIAEPGAVAILLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>CP030760.1|AXA41513.1|4112244_4113495_-|tRNA-(Uracil-5-)-methyltransferase-family-protein
MSTETVTIEKLGAQGDGIASSASGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPPCRHFGPDGVNGTCGGCTLQHMADAPYRAFKRQLVIDALKSKGLTPEVGEVVPARPGERRRVVFAARKTEKDMLVGFNQAESHHIVAIEECPISSAGIIARLPAIRAIAASLATNAEPFRVAVLETLSGLDISVDEVKKLSDPQRRKAIETALGLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGSFTQATKPAEEAMAELVIAHAGKAKRIADLFAGSGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSGVKKIVAVSCNPLTLARDLAILVEGGYRITQVTPIDQFLWTSHVEVVATLEK
>CP030760.1|AXA41512.1|4111231_4112242_-|Beta-lactamase-domain-family-protein
MPVGKAKRRNPYYNGPVSDHFDGTHFFNPDGIEPLGFRDLLRWQFGGGRERWPQSVPSPYPAAKPDPCVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERVSPFSFAGPKRVVQPGIAFDDLPPIDLVLVSHNHYDHLDIATLRRLGAKHRPRVVTPLGNDTIIRRAVPDIQTTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHNGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMKLANAAYVAGHHFATFQLTNEAVDAPARALQDAMSEHDIPPERFRPLRAGEVFNVPAV
>CP030760.1|AXA41511.1|4110395_4111151_+|Enoyl-CoA-hydratase/isomerase-family-protein
MTDYIIVEQPSAYPGVQSIRFNRPEKKNAITRAMYRTMADALNAANTSPDIRATAFLGTEGCFSAGNDLNDFLAAAMGGRGLEQEILDFLYELVSAEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGHQRAFAMLAAGEAFSADEAKEAGLVWKVVESGEVDSLTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARHFSARLKSAEARAAFEAFMRR
>CP030760.1|AXA41510.1|4108607_4110386_+|Acyl-CoA-dehydrogenase,-C-terminal-domain-family-protein
MYKAPVEEIAFTLKHVAGMGEAIAQGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLIDGEVRLPDGWRDLYRHWIAGGWNGLTAPEALGGQALPHMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSTHGSVALKDKYLEKMVSGEWTGTMNLTEPHAGSDLGVLKARAERCDDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGASGAGMSPIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDASRHWQERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVKGFIAELREIADGVRRSNLDGFGETAARLDAAIADLEQATAWLMKTLAENRTAEALSGATPYQRLFGLVLTGCYLAKGGLAESADGAAENRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>CP030760.1|AXA41509.1|4107403_4108399_-|CorA-like-Mg2+-transporter-family-protein
MDTLPVNIPGFVWAYRFSPEEKTAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLDGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQRDFAQDTNNLGWLHFAMSDRFLITTRLQPLRSVERARALIEKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADDDEMPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVALIVASIAFAWWLLRRVDIL
>CP030760.1|AXA41508.1|4106824_4107310_+|BA14K-like-family-protein
MIGLRNKIATAVLAAAVVLTGFAPSQAIQMPTAPQVEKSSAVENVQYRRYYRPGYRPGAYYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRHYNGYWYPLAAFGAGAVIGGAIVAQPRYVDPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY
>CP030760.1|AXA41518.1|4119794_4120718_-|Pirin-family-protein
MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPSRQRRLVGPFIFFDRMGPAILKPDEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPGDINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPDDKEEIDPSFAHTEKSAMPLIETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLDLQPGAKFPFGAGHEERAVYVLSGEVVISGDRFAADQLLVFRPGDAITLEAGRDGCHLMLFGGAALNSKRYIWWNFVSSSKERIEQAKEEWRTGRFDIVPGDEEEFVPLPEG
>CP030760.1|AXA41519.1|4120927_4121695_-|short-chain-dehydrogenase-family-protein
MSDRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNDQAAADTVQAIREAGGEADCWTADVSDESAVNAAVAGVEERYGAVTVLFNHAGTIVIKPFLETTLQEWDWLHAVNVRSMFLMTKAVLPKMIESGGGSIVCTSSISAVAATPMEVLYDTTKGAVHMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGEPEDVARAALYLASDESSFVNGAHLFVDNGFTAI
>CP030760.1|AXA41520.1|4121784_4122036_-|exodeoxyribonuclease-VII,-small-subunit
MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA
>CP030760.1|AXA41521.1|4122038_4122974_-|Histone-deacetylase-domain-family-protein
MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERRQAPQANEDAVLLAHPEEHLIAVMREIPEEEGEINQIEADTYASSKSLQAALTGIGGAMAAVDDVFTGRADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQKTHGAERIAIVDWDVHHGNGTQDIFWDDASVLFCSTHQMPLYPGTGAKDEKGTHNTIVNAPLSPNVGSDHFREAFKSRVLPALDEFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRHAKNRVVSLLEGGYDLEGLAESAGMHILRMMKG
>CP030760.1|AXA41522.1|4123257_4123659_+|hypothetical-protein
MSQSKRPDVAEIRVPFRDVDMTGQMFLASYISYAESVLASFWSSRPDVDDEPVYSPSKVSCMLHRPLHYDELATFTATVDKIGMHSIGLLVAIDTGEERAAEVEIIWQARTREDQSPASLPEETRDWLYRFLD
>CP030760.1|AXA41523.1|4123696_4124308_-|2'-5'-RNA-ligase-family-protein
MIRTKVDTLWFKQCCAFHLQFFPDGEALSQLCNFQDRIERDSDAPLSRVPAKSLHMTVVTLVNAAAQFSIPNDEVWKLNGERWKEIVERLVEETPPFELHFHEVAASEAAVFVKAEEPPELRRLRSAISHAICFEQWRPTPPRIAHITLFRFFAEDRLPAVNFDAGLLPTGVKVGSLKLLEERVYPSVKINILSEPLLRGKST
>CP030760.1|AXA41524.1|4124467_4125991_-|FAD-binding-domain-family-protein
MNNRHPTSFLFDVVIAGAGPVGLLLACELRLARVSVLVLEQAENPHSPLKKLPFGMRGLTLPTIEAFYRRGLLDSLEAPGRQAKPEGKPRKQAGHFAGIPFDYDRINPSMWAYRLPSPADSNMAAEMERVEAVLADRAQSIGVEIRRGVGVEGFAQSADGVTIQAGDQSFEGRWLVGCDGGRSMVRKVGGFSFVGTDPEFTGYSVQVDLADPEKLKLGRQLTPTGMYFQTQPGHFGMVEFDGGASHRTGPITLAHVQAVLRRISQTDVTLTALHVATSWTDRAQQATEYRRGRVLLAGDAAHIHSPLGGQGLNLGLGDAMNLGWKLAATVRGEAPDGLLDSYFSERHPIGEQILAWSRAQVSIMRPSPHARAMESIIRDLIATRDGATYFANRVWNASMRYDLGDGHALAGRSAPDFEWTDGTRLAALLADGTGLLIDFGDRAPLRSIARRWDDRVKYVRGEVKDRLGLTALLVRPDGIVAWACEGEANAEDAVEAGSRWFAVHGGG
>CP030760.1|AXA41525.1|4126445_4127990_+|tRNA-synthetases-class-I-(M)-family-protein
MNKIYITTSIPYVNAAPHVGFALELIQADAYARHFRLLGHDVRFQCGTDDNSLKNVRSAEAAGLEVRDFVNANADRFEHLGGLLDISNEEFVRTSGDPRHIACVHALWRACAENGDLYRKAYEGLYCVGCEQFYEPSELDDGRCPEHGIALETIREENWFFRLSRYGDRLLELVETGELRIVPAHRRNEVLALLRRGLTDISVSRSAERARGWGVPVPDGDEVVYVWFDALANYLTGLSHGADPTLLQHYWTGGQRIHVVGKGISKFHAIYWPAILLSAGLPPPSSILVHGYVTVDGRKIGKSAGNGIDPERIIQSYETPDALRYYLLRHIRSGDDGDFSDERLEAAWSGELAGQLGNLANRVLALLSTSFNGIVPPVPDSELVEEAARLPEKVARAFAAYELHVGLADIFEFIGAANRRFAQRAPWADAKALLADLTPDDRKATATRLGTSLAEQVHGLAIIARCLLPFLPSSAAKLHSRLGIPSPRLYRDPLIVGGVKAAPQAVLFPQRAAA
>CP030760.1|AXA41526.1|4128154_4128376_+|hypothetical-protein
MEIFLVVTVLVGGFALIFALIARAERGATTQTTANTKRRWGNSEGSGDGGGGWFDASGDGGCDGGGGDGGGGD
>CP030760.1|AXA41527.1|4128502_4129642_-|Histidine-kinase-,-DNA-gyrase-B-,-and-HSP90-like-ATPase-family-protein
MSGPDTQISMPAEDLEDLYENAPCGYLSLQPDGRIVKVNRTLSTWIGIPAEQLLGKRLHDLLNTSGRIFYETHFAPLLRMQGFFNEVALDLVAVDGRKLPVLANAMERRAEDGALLFTRVTMFQAAERRRYERELVEARAAADTAGAIVKSQLDFEQQTAELREQFIAILGHDLRNPLASIAAAGRMLRKEEQTDRSTKVLDLMQGSVVRMSGLIDNVLDFARARLGGGIVLDRRAEEFEPILRQVIEELRYSHLDRRIEVSIELDGPINCDSSRIGQLVSNLLGNALTHGTPDEPVRLSAATLDGRLELWIANGGAPISSDAMTRLFQPFFKGEAGTSQRGLGLGLYIASEIARAHGGAITVSSGVNETRFTFVMPLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030760_1	1.1\|4119699\|34\|CP030760\|CRISPRCasFinder	4119699-4119732	34	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	179879-179912	9	0.735

1. spacer 1.1|4119699|34|CP030760|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.735

cgggcaacatcatgctcccactattaaagcatgg	CRISPR spacer
cggacaacatcatgctccaactatataatttaga	Protospacer
***.************** *****  ** .  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4126 : 14835

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA37632.1\|4126_5380_-	diguanylate cyclase (GGDEF) domain protein	A0A127AWB9	Bacillus_phage	1.0e-12	34.1
AXA37633.1\|5756_6386_+	ATP-dependent Clp endopeptidase, proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
AXA37634.1\|6689_7967_+\|protease	ATP-dependent Clp protease, ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-132	58.4
AXA37635.1\|8369_10787_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
AXA37636.1\|10993_11269_+	Bacterial DNA-binding family protein	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
AXA37637.1\|11641_12541_+	EamA-like transporter family protein	NA	NA	NA	NA
AXA37638.1\|12636_14835_+	Esterase-like activity of phytase family protein	M4SLV1	Cyanophage	7.8e-80	42.4

DBSCAN-SWA_2

303406 : 316787

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA37916.1\|303406_304420_+	Glycosyl hydrolase 3 N terminal domain family protein	A0A1B1IVS3	uncultured_Mediterranean_phage	1.6e-24	42.6
AXA37917.1\|304438_305296_+	ScpA/B family protein	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-34	38.5
AXA37918.1\|305292_306009_+	Putative transcriptional regulators (Ypuh-like) family protein	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
AXA37919.1\|306192_306384_+	twin arginine-targeting protein translocase, TatA/E family protein	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
AXA37920.1\|306435_307047_+	twin arginine-targeting protein translocase TatB	NA	NA	NA	NA
AXA37921.1\|307043_307871_+	Sec-independent protein translocase protein (TatC) family protein	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.5
AXA37922.1\|308071_309355_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.3
AXA37923.1\|309359_310133_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-23	30.2
AXA37924.1\|310129_310783_+	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) family protein	A0A1B1IU40	uncultured_Mediterranean_phage	8.9e-16	34.1
AXA37925.1\|311023_312628_+	Peptidase M23 family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
AXA37926.1\|312774_313647_-	hypothetical protein	NA	NA	NA	NA
AXA37927.1\|313853_314201_+	Preprotein translocase subunit family protein	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
AXA37928.1\|314246_316787_+	protein-export membrane protein SecD	A0A1B1IVP7	uncultured_Mediterranean_phage	6.3e-57	48.2

DBSCAN-SWA_3

594028 : 604297

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA38191.1\|594028_596950_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
AXA38192.1\|597234_597744_+	Single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.6e-44	72.9
AXA38193.1\|597844_598492_-	MarC integral membrane family protein	NA	NA	NA	NA
AXA38194.1\|598791_601569_+	DNA gyrase, A subunit	A0A1B1IVS2	uncultured_Mediterranean_phage	1.5e-75	42.2
AXA38195.1\|601751_601886_-	hypothetical protein	NA	NA	NA	NA
AXA38196.1\|601922_602078_-	hypothetical protein	NA	NA	NA	NA
AXA38197.1\|602220_602520_-	hypothetical protein	NA	NA	NA	NA
AXA38198.1\|602632_603127_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.8e-24	35.9
AXA38199.1\|603185_603758_+	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD family protein	A0A1B1IVS0	uncultured_Mediterranean_phage	1.1e-41	52.8
AXA38200.1\|603787_604297_+	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD family protein	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4

DBSCAN-SWA_4

1578908 : 1592711

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA39170.1\|1578908_1580966_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
AXA39171.1\|1581537_1581885_-	Glutathione-dependent formaldehyde-activating enzyme family protein	NA	NA	NA	NA
AXA39172.1\|1581895_1582933_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
AXA39173.1\|1583195_1584383_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	7.5e-37	28.3
AXA39174.1\|1584547_1585276_-	Methyltransferase domain family protein	A0A1X9I6N4	Streptococcus_phage	2.4e-49	42.0
AXA39175.1\|1585324_1587205_-	ATP-dependent DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	6.7e-72	34.4
AXA39176.1\|1587204_1589214_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.2e-89	42.2
AXA39177.1\|1589843_1590773_+	hypothetical protein	NA	NA	NA	NA
AXA39178.1\|1590776_1591232_-	Yqey-like family protein	A0A292GL36	Xanthomonas_phage	3.1e-15	38.7
AXA39179.1\|1591499_1592711_+	carbamoyl-phosphate synthase, small subunit	R4TGJ8	Halovirus	1.1e-40	33.2

DBSCAN-SWA_5

2557658 : 2567569

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXA40063.1\|2557658_2558369_+	Queuosine biosynthesis protein QueC family protein	A0A2P1JXV3	Rhodococcus_phage	2.3e-49	48.7
AXA40064.1\|2558368_2558725_+	6-pyruvoyl tetrahydropterin synthase family protein	NA	NA	NA	NA
AXA40065.1\|2558721_2559450_+	7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE	A0A1U9WRB6	Streptococcus_virus	2.9e-39	37.6
AXA40066.1\|2559454_2560675_-	Adenylate and Guanylate cyclase catalytic domain family protein	M1HLN3	Pelagibacter_phage	5.4e-14	29.7
AXA40067.1\|2560779_2561754_-	Ribonucleoside-diphosphate reductase subunit beta nrdF2	R4TBI6	Mycobacterium_phage	7.3e-139	75.1
AXA40068.1\|2561841_2564046_-	Ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.3e-211	51.4
AXA40069.1\|2564024_2564429_-	nrdI protein	A0A142F1R4	Bacillus_phage	6.5e-17	43.1
AXA40070.1\|2564443_2564665_-	glutaredoxin-like protein NrdH family protein	V5UN81	Mycobacterium_phage	7.9e-17	52.1
AXA40071.1\|2565316_2567569_-	heavy metal translocating P-type ATPase family protein	E4ZFI9	Streptococcus_phage	7.4e-126	41.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030762

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP030760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection