CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP030788	Vibrio campbellii strain DS40M4 chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,csx1,DEDDh	1	1	5
CP030789	Vibrio campbellii strain DS40M4 chromosome 2, complete sequence	0 crisprs	csa3,cas3,WYL	0	0	1
CP030790	Vibrio campbellii strain DS40M4 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030788_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030788_1

2750143-2750380

Orphan

Consensus_repeat	Method
CCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCC	PILER-CR

2 spacers

The CRISPR arrays of CP030788_1

>merge|CP030788|1|2750143-2750380|PILER-CR
CTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATTTGGTGCACTTGCTTAAAGCAAGACACAAACAGAATAGTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>CP030788|1|1|2750143-2750380|PILER-CR
CTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGT	CACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGA
TAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCG	GTGGTTCGATTCCGCCTCGAGGCACCATATTTGGTGCACTTGCTTAAAGCAAGACACAAACAGAATAGTTCCTCCTTA
GCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
CP030788.1\|AXB32455.1\|2764546_2765869_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
CP030788.1\|AXB32459.1\|2768214_2769498_+\|dehydrogenase	unknown	unknown	gnl\|CDD\|200570
CP030788.1\|AXB32446.1\|2743982_2744903_-\|glutaminase	unknown	unknown	gnl\|CDD\|234880
CP030788.1\|AXB32451.1\|2748423_2749554_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
CP030788.1\|AXB32450.1\|2748064_2748337_+\|Fe(2+)-trafficking-protein	unknown	unknown	gnl\|CDD\|180059
CP030788.1\|AXB32453.1\|2762669_2763668_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380494
CP030788.1\|AXB32456.1\|2765879_2766191_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
CP030788.1\|AXB32443.1\|2741445_2741877_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
CP030788.1\|AXB32458.1\|2767661_2767967_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
CP030788.1\|AXB32958.1\|2753230_2754664_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
CP030788.1\|AXB32454.1\|2763773_2764529_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
CP030788.1\|AXB32448.1\|2746045_2746765_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
CP030788.1\|AXB32447.1\|2745005_2746034_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
CP030788.1\|AXB32457.1\|2766238_2767582_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
CP030788.1\|AXB32460.1\|2770242_2770908_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187643
CP030788.1\|AXB32444.1\|2741982_2742585_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
CP030788.1\|AXB32445.1\|2742603_2743776_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
CP030788.1\|AXB32442.1\|2741095_2741386_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
CP030788.1\|AXB32449.1\|2746968_2748045_+\|adenine-DNA-glycosylase	unknown	unknown	gnl\|CDD\|182805
CP030788.1\|AXB32452.1\|2750706_2752332_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910

Protein	Function_ID	Function_description	E-value
CP030788.1\|AXB32455.1\|2764546_2765869_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
CP030788.1\|AXB32459.1\|2768214_2769498_+\|dehydrogenase	gnl\|CDD\|200570	cd10946, CE4_Mll8295_like, Putative catalytic NodB homology domain of uncharacterized Mll8295 protein encoded from Rhizobium loti and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase Mll8295 encoded from Rhizobium loti. Although its biological function still remains unknown, Mll8295 shows high sequence homology to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both Mll8295 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	1.19841e-73
CP030788.1\|AXB32446.1\|2743982_2744903_-\|glutaminase	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
CP030788.1\|AXB32451.1\|2748423_2749554_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	1.80495e-150
CP030788.1\|AXB32450.1\|2748064_2748337_+\|Fe(2+)-trafficking-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	9.88866e-59
CP030788.1\|AXB32453.1\|2762669_2763668_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380494	cd06270, PBP1_GalS-like, ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type 1 periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar binding of ABC-type transport systems.	2.24384e-113
CP030788.1\|AXB32456.1\|2765879_2766191_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	1.19402e-35
CP030788.1\|AXB32443.1\|2741445_2741877_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	4.77864e-68
CP030788.1\|AXB32458.1\|2767661_2767967_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	4.26594e-46
CP030788.1\|AXB32958.1\|2753230_2754664_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
CP030788.1\|AXB32454.1\|2763773_2764529_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	3.19601e-123
CP030788.1\|AXB32448.1\|2746045_2746765_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	9.88686e-108
CP030788.1\|AXB32447.1\|2745005_2746034_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	1.72952e-08
CP030788.1\|AXB32457.1\|2766238_2767582_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	1.26236e-154
CP030788.1\|AXB32460.1\|2770242_2770908_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187643	cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR. These proteins include members identified as KDSR, ribitol type dehydrogenase, and others. The group shows strong conservation of the active site tetrad and glycine rich NAD-binding motif of the classical SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.75542e-70
CP030788.1\|AXB32444.1\|2741982_2742585_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.57095e-123
CP030788.1\|AXB32445.1\|2742603_2743776_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
CP030788.1\|AXB32442.1\|2741095_2741386_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	1.34108e-58
CP030788.1\|AXB32449.1\|2746968_2748045_+\|adenine-DNA-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
CP030788.1\|AXB32452.1\|2750706_2752332_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	2.58074e-60

>CP030788.1|AXB32451.1|2748423_2749554_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIAFIATALLMAGCSREFVEQIYDVNYEPTNRFANNLAELPGQFEKDTDALDALITSFSGNIKRRWGQREVKVAGKSNYVKYIDNYLSRAEVDFQKGVITIETVSPTEPQKHLKNAIITTLLTPDDPANVDLFSSKGIKLEGQPFLYNQVVDQDKKPIQWSWRANRFADYLIANQVKTKDVDFKKAYYVEIPMVEDHFSQRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKNRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLKDVQHPTSLEYSMISAYNGGTGGVLNTFHRTDRKRAMQDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNAG
>CP030788.1|AXB32450.1|2748064_2748337_+|Fe(2+)-trafficking-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKQLETEMVNFLFEGKDVHIEGYTPPSE
>CP030788.1|AXB32449.1|2746968_2748045_+|adenine-DNA-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAHKYNGEFPLDLEQMNALPGIGRSTAAAVLSSVYKQPHAILDGNVKRTLSRCFAVDGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMMCTRSKPKCTLCPVNELCVAKKQGNVLDYPGKKPKKDKPVKQTRFVMLHHKNGDSHEVWLEQRPQTGIWGGLFCFPQTEHIDVESDIELLLEQRGIQANDIRHQETLITFRHTFSHYHLDITPILIDLSKQPNVVMEGNKGLWYNLSKPEEVGLAAPVKLLLEALPHELR
>CP030788.1|AXB32448.1|2746045_2746765_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKMIRKIRSFVRREGRLTKGQENAMNECWPTMGIDYKAEILDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLILNEGVFHMATDWENYAEHMIEIMNQAPGFENIAEEGDFIPRPEERPLTKFEARGHRLGHGVWDIKFKRTA
>CP030788.1|AXB32447.1|2745005_2746034_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASEGVEVTEIGNKDVGLPAALVFSCETELSEAQAGKIAASSIYYALFEVREDGLLRPIQAPAFNTFPESMSQILRYTGKTNEQFTRLMVNLGVSAANTGSAQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINQKWVQEIQTFIVKFMKNGRFKHKVSKEKRTSGGKKVADGFVVEAAADKDDYNKGNLQTMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAIKP
>CP030788.1|AXB32446.1|2743982_2744903_-|glutaminase
MKPTAQILTDILAEVRPLIGQGKVADYIPALAKVPNTKLGIAVYTNEGEVIKAGDAEESFSIQSISKALSLTLAMCLYKQEEIWCRVGKEPSGQAFNSMIQLEMEQGIPRNPFINAGAIVVADLLQSRLSAPRQRLLEFARQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPELDASGNSLAGTKALELLAERIGRSIF
>CP030788.1|AXB32445.1|2742603_2743776_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKAEIPEEEYINALVEDLDTDIEKYRLNETPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFIGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFEQGHEKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLMAYQNMVKPYLDSEQLVADEDRPFEFFMNRFRLMEACPKQDYIDTTGLPLSSIQETIDWALEMGYLSETETHWQITKKGKLFLNDLLEAFMAEEE
>CP030788.1|AXB32444.1|2741982_2742585_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGEKASDQENLEKLLKAMEGVPEAERTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQVSQ
>CP030788.1|AXB32443.1|2741445_2741877_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSMAGQFKTMKDIEVHYIAFNSTFLTPKIARSYDIKRNGYNAVLNISVLDSASLGKPAVEAKISGQAKNLIGQTQKLNFREVKEGDAIYYLAELGITNEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>CP030788.1|AXB32442.1|2741095_2741386_+|YggU-family-protein
MSEAVWHDGKDVVLRLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPVQIPTEIKAII
>CP030788.1|AXB32452.1|2750706_2752332_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILVALLAQTATGLWTLRVASNIDNKARVTELFKSASSILTEVEQMAVEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMIFVAAPLDPQLHGTSFHDFRDGDGNSVGQLILDVLGRKTGQIVEYTWTQKQPDGTVEEKHSIAEKTPHWNWVVGTGIGFNEVNTRFWSTAQWQLALCLAIAGAILGGLIISIRKMLNLLGGEPNDVREAVQAVAQGDIQASFEHTAPKDSIYGAVQEMSQSLAKMVTNLDESMHALRSELSAVESRSNSIADLTMSQQQSTAMIATAMTEMASSANHVASSASDTAHNTDEADKQSQHTQSLIHSTVDNIQGLATQLNTASKAVADLDQDVNSIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQQMISNLQEGSRNAIHTMEICAETSESTVTESMNASEALQQIVTALESITAMSQQIATAAAEQTQVSDDIAHRINLIEESGSQLNAVVTKGQSSTQTLASLADELEGWVNKFSVKH
>CP030788.1|AXB32958.1|2753230_2754664_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MQQIESETLRVLFESLSSQDGIAVINPATEQELIRLKPSSLDELDVQIEACKSAQLEWAKLSAKARSASLKKWFQLLVEHTEDIANIITLEQGKPLTESRGEVAYGASFVEWFAEEAKRAYGEVIPAPSVDRRLSTIKQPVGVCAAITPWNFPIAMITRKAAPALSAGCGMIIKPSELTPLTALAVVELAHQAGIPKALLSTVVSEQAAEFGVVLSTDPRIKKISFTGSTRVGKILMKQASDTVKAASMELGGNAPFIVFDDADLDAAANGLIASKFRNAGQTCVCTNRLYVHQSVKEAFLAKLLDKAADLTVGNGLEENTTLGPVITMASKHRLEAVIDQAVQEGATMLNQPQKRSGRFMEPIILDNVEQSMAIVQQELFGPVLPVISFDDDEQVLSMANDTEYGLACYFYTDSLKRIIKFSEGLEYGMVGVNEGIISTEVAPFGGIKESGIGREGAKQGMDEYLETKYICLGGVS
>CP030788.1|AXB32453.1|2762669_2763668_-|LacI-family-DNA-binding-transcriptional-regulator
MARIKDVAELAGVNRSTVSRIINGEGKFRDETRKKVEAAMAELNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDMHKKFLITAQGHHSAEGEREAIQRFNDLRCDGYVLHSRYLSDDDLRELAKLPTPFVLLDRYVEGIEERCVTFNHHHASRIAVEHLIAGGHKNIACITGPSQRHNSLLRELGYVDAMKTAGIDIDESWCEEGNYGRQSGYDAMAAIYHRHPEVTAVFSCSEEMTVGAMQFLHEKRISVPEQISLVSFDSVDLCESLYPTVSAVHFPISDMARVAVQTLMGLIKDQQLHTKPVFEAELKLRKADRTLS
>CP030788.1|AXB32454.1|2763773_2764529_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTPGVNKGIVKAHQQGVVRSTTMMVGMDAEQHAVELAKQNPNLKIGVHLRFTAGAPVTGHLNLTNGQTQFVSYDELWKKQDFEEEVVYQEAIAQVEAFLKLGLSLSHLDSHHHAHTHPQLLPVIRKVAQKYKVPLRGSGLCHTESKVKYYFTDEFYDQGVSLGGIMKHLLGLKAKYDVVEVMCHPAEADQSLLLKSSYALQRELELQVLTSPILKQEFAQHGMTVTDYSALISSSKVVSV
>CP030788.1|AXB32455.1|2764546_2765869_-|6-phospho-beta-glucosidase
MPRNAIKLAIIGGGSSYTPELVEGVIKRLEFLPVKQMHFVDIESGAEKLEIIKGLAQRMVDKAGADIEIKASFDRRDAIKDADFVMTQFRVGGLAARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELAPNAWMLNFTNPAGLVSEAVSKYTNVKSIGLCNVPVSMEMMIAEMMDCEPKELQLEFAGLNHLVWVLKAWLKGKDITQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTYAMLAEEKQSAGEQGTRAEQVMATESALFKLYQDPNLDHKPKELEERGGAYYSDASLNLVDSIYNNRNSIHVVNVLNNGAINGLPDDAVIECSAVIGSWGAKPLAVGELSSNIKGLLHQVKAYEQLAIEAAVEGSYDKALMALTNNPLVPDISRAKSILDEILAVNAPYLPQFKLTTL
>CP030788.1|AXB32456.1|2765879_2766191_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREKDFSAAEEKLSQARECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKQLAEK
>CP030788.1|AXB32457.1|2766238_2767582_-|PTS-sugar-transporter-subunit-IIC
MDSMKLYDAIIGIVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFTLGRVWLDFATTHFDTIMMPFNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMSFLLVAAPAKDGALAMKHMGGTGIFTAVMCAFFAVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAIFLTLYPLSIFVQTQYDMLIPDAVMAMFKPLISASNTLPAIIGALLVCQLLWFAGIHGAAIVVGLLSPIFLTNISANIDAFVAGQPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSAHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPILFIPFVFAPIVNATIAYFAVQLGFVGMGVATTPWTTPALIGASWGSGWTFSPVLLVIGLLILDLFIYLPFFKMFEKQVMEQELPTSKESKDAEQPSGEGVTA
>CP030788.1|AXB32458.1|2767661_2767967_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAEKQGLECKIDALSVNAFDEAIREYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISPQDYGMMKGEEVLQQALEMIN
>CP030788.1|AXB32459.1|2768214_2769498_+|dehydrogenase
MKLTKLAMVTLLGSALSQFSYAQEAPKGTIYLTFDDGPINASIDVINVLNQQGVKGTFYFNAWHLDGIGDENEDRALEALKLALDTGHIVANHSYAHMIHNCVEEFGPNSGAECNATGDHQINSYQDPVYDAGTFAENLAVLERYLPNINSYPNYRGEEFARLPYTNGWRVTKNFKADGLCATSDDLKPWEPGYVCDTDNPSNSVKASIEVQNILANKGYQTHGWDLDWAPENWGIAMPANSLTEAEPFLGYVDAALNSCAPTTINPINSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATKNLPKLAKFIQIAKEAGYVFDTMDNYTPVWQVGQAYVAGDYVTHSGTVYKAVTTHVAQQDWAPSSTSSLWTNADPATNWTLNVAYEAGDVVTYQGLRYLVNVPHISQADWTPSTQNTLFTAL
>CP030788.1|AXB32460.1|2770242_2770908_-|SDR-family-NAD(P)-dependent-oxidoreductase
MIVITGASSGLGAQLAKLYDAQGEETLLTGRSEKKLNTLAQYLSSKAQVRSCDLIDASQVENLFNELPQAPTTVIHCAGSGYFGLLAEQDPQEIQKLIENNLTSAVHVLKELVKRYQEQPVNVVMVMSTAAQQPKAQESTYCAVKWAVKGLIESVRMELKGKPMKIVAVYPGGIATEFWETSGKSLDTSSFMSAGDAARMIHGALSNIGNGYVSDITVNRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	CP030788.1	2749831-2749873	0	1.0

1. spacer 1.1|2750185|43|CP030788|PILER-CR matches to position: 2749831-2749873, mismatch: 0, identity: 1.0

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccattctttt	Protospacer
*******************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103819-103861	5	0.884
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35424-35466	5	0.884
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296497-296539	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	KU052038	Escherichia phage SerU-LTIIb, partial genome	1162-1204	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	KU052038	Escherichia phage SerU-LTIIb, partial genome	3068-3110	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	LN997803	Escherichia coli phage phi467	15122-15164	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1925-1967	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52074-52116	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52080-52122	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52085-52127	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52084-52126	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13641-13683	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	MH494197	Escherichia phage CMSTMSU, complete genome	196768-196810	6	0.86
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85813-85855	7	0.837
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	KY653118	Morganella phage IME1369_01, complete genome	694-736	7	0.837
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NC_049942	Escherichia phage JLK-2012, complete sequence	23522-23564	10	0.767
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	LC494302	Escherichia phage SP27 DNA, complete genome	76609-76651	11	0.744
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17115-17157	11	0.744
CP030788_1	1.1\|2750185\|43\|CP030788\|PILER-CR	2750185-2750227	43	NC_027364	Escherichia phage PBECO 4, complete genome	207828-207870	11	0.744

1. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 5, identity: 0.884

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatcaagtc	Protospacer
*************************************.   *.

2. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.884

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagccggcaccaatcaagt	Protospacer
***************************.******** **   *

3. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

4. spacer 1.1|2750185|43|CP030788|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

5. spacer 1.1|2750185|43|CP030788|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

6. spacer 1.1|2750185|43|CP030788|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccatatgcgg	Protospacer
************************************* . .

7. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccagaatgcg	Protospacer
************************************   * .

8. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

9. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

10. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

11. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccacttacga	Protospacer
************************************.*. .

12. spacer 1.1|2750185|43|CP030788|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcacaaatcagcc	Protospacer
********************************** * **  ..

13. spacer 1.1|2750185|43|CP030788|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 6, identity: 0.86

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcacaaatcagcc	Protospacer
********************************** * **  ..

14. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 7, identity: 0.837

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgattccggtagtcggcaccaaatgcgg	Protospacer
************************************  . .

15. spacer 1.1|2750185|43|CP030788|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 7, identity: 0.837

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
agtaggtcaccagttcgactccggtagccggcaccatattaaa	Protospacer
******************.********.********* .*

16. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 10, identity: 0.767

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
atcaggtcgccagttcgattccggtagccggcaccatatgcgg	Protospacer
* .*****.******************.********* . .

17. spacer 1.1|2750185|43|CP030788|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

18. spacer 1.1|2750185|43|CP030788|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

19. spacer 1.1|2750185|43|CP030788|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 11, identity: 0.744

agtaggtcaccagttcgattccggtagtcggcaccattctttt	CRISPR spacer
gaaaggtcaccagttcgattccggtagtcggcacaaaataaag	Protospacer
.. ******************************* *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

589817 : 596883

Faustovirus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB30582.1\|589817_591032_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	4.8e-31	29.9
AXB30583.1\|591069_591453_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.4e-53	78.2
AXB30584.1\|591525_591849_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.0e-25	50.5
AXB30585.1\|591904_592420_+	co-chaperone protein HscB	NA	NA	NA	NA
AXB30586.1\|592441_594295_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	9.4e-111	40.4
AXB30587.1\|594308_594647_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AXB30588.1\|594691_594886_+	Fe-S assembly protein IscX	NA	NA	NA	NA
AXB30589.1\|595058_596357_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	9.1e-36	34.7
AXB30590.1\|596457_596883_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	2.1e-21	40.6

DBSCAN-SWA_2

667653 : 674344

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB30647.1\|667653_668793_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.2e-62	41.7
AXB30648.1\|668810_670061_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-99	48.2
AXB30649.1\|670188_670638_+	transcriptional regulator NrdR	NA	NA	NA	NA
AXB30650.1\|670645_671770_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.0e-44	35.1
AXB30651.1\|671781_672435_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.3e-34	38.0
AXB30652.1\|672594_673704_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	8.8e-64	39.6
AXB30653.1\|673873_674344_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_3

1692681 : 1717736

Vibrio_phage(42.86%)

portal,protease,lysis,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB31512.1\|1692681_1693551_-	S49 family peptidase	A0A2I6TC87	Escherichia_phage	4.0e-80	52.4
AXB32908.1\|1693543_1695100_-\|portal	phage portal protein	A0A0K2FJC0	Enterobacteria_phage	1.5e-157	55.4
AXB31513.1\|1695111_1695309_-\|tail	phage tail protein	NA	NA	NA	NA
AXB31514.1\|1695305_1697213_-	DNA packaging protein	A0A1I9KF19	Aeromonas_phage	8.4e-123	39.7
AXB31515.1\|1697169_1697772_-	hypothetical protein	D4HTU0	Vibrio_phage	4.7e-19	36.5
AXB31516.1\|1697888_1698371_-\|lysis	lysis protein	A0A1P8DTG0	Proteus_phage	5.2e-21	44.5
AXB31517.1\|1698819_1699011_-	hypothetical protein	A0A1V1FD92	Vibrio_phage	1.7e-12	54.1
AXB31518.1\|1699166_1699835_-	hypothetical protein	R9TRM8	Vibrio_phage	1.3e-81	65.6
AXB31519.1\|1700172_1700766_-	hypothetical protein	NA	NA	NA	NA
AXB31520.1\|1700969_1701254_+	hypothetical protein	NA	NA	NA	NA
AXB31521.1\|1701367_1702039_-	hypothetical protein	NA	NA	NA	NA
AXB31522.1\|1702825_1703137_+	hypothetical protein	NA	NA	NA	NA
AXB31523.1\|1703348_1704083_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AXB31524.1\|1704079_1704487_-	hypothetical protein	NA	NA	NA	NA
AXB31525.1\|1705728_1707027_-	hypothetical protein	NA	NA	NA	NA
AXB31526.1\|1708290_1708818_-	hypothetical protein	NA	NA	NA	NA
AXB31527.1\|1708861_1708984_-	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB31528.1\|1709174_1710131_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AXB31529.1\|1710153_1710903_-	alpha/beta hydrolase	NA	NA	NA	NA
AXB32909.1\|1710948_1711080_-	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB31530.1\|1711067_1711436_-	hypothetical protein	NA	NA	NA	NA
AXB31531.1\|1711579_1712158_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXB31532.1\|1712309_1712711_-	hypothetical protein	NA	NA	NA	NA
AXB31533.1\|1712749_1712881_-	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB31534.1\|1712856_1713390_-	hypothetical protein	NA	NA	NA	NA
AXB31535.1\|1713532_1714111_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXB31536.1\|1714305_1714539_-	hypothetical protein	NA	NA	NA	NA
AXB32910.1\|1714568_1714688_-	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB31537.1\|1714684_1715128_-	hypothetical protein	NA	NA	NA	NA
AXB31538.1\|1715670_1716210_-	XRE family transcriptional regulator	NA	NA	NA	NA
AXB31539.1\|1716466_1716589_-	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB31540.1\|1716779_1717736_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1724141 : 1731858

Vibrio_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB31553.1\|1724141_1725056_-	DUF968 domain-containing protein	A0A1V0E819	Vibrio_phage	4.1e-51	41.3
AXB31554.1\|1725048_1725360_-	hypothetical protein	R9TNL4	Vibrio_phage	2.7e-47	89.1
AXB31555.1\|1725356_1726052_-	DNA-binding protein	R9TMN1	Vibrio_phage	9.7e-77	67.1
AXB31556.1\|1726045_1726258_-	hypothetical protein	A0A1V0E856	Vibrio_phage	3.6e-11	51.8
AXB31557.1\|1726268_1727225_-	helix-turn-helix domain-containing protein	R9TPU9	Vibrio_phage	7.7e-125	72.8
AXB31558.1\|1727224_1727746_-	DNA methyltransferase	R9TNL7	Vibrio_phage	6.1e-92	89.6
AXB31559.1\|1727902_1728172_-	hypothetical protein	NA	NA	NA	NA
AXB31560.1\|1728168_1728621_-	hypothetical protein	R9TRN6	Vibrio_phage	1.0e-42	65.7
AXB31561.1\|1728610_1728877_-	XRE family transcriptional regulator	A0A1V0E8C7	Vibrio_phage	1.0e-10	47.8
AXB31562.1\|1728974_1729697_+	XRE family transcriptional regulator	R9TNM0	Vibrio_phage	4.3e-88	67.1
AXB31563.1\|1729992_1730205_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	2.4e-10	43.3
AXB31564.1\|1730392_1730623_+	hypothetical protein	NA	NA	NA	NA
AXB31565.1\|1730622_1731858_+	DUF3596 domain-containing protein	A0A0U2JGI6	Escherichia_phage	8.5e-76	41.7

DBSCAN-SWA_5

2672226 : 2687794

uncultured_Mediterranean_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB32376.1\|2672226_2674809_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.5e-77	37.5
AXB32377.1\|2674951_2675419_-	recombination regulator RecX	NA	NA	NA	NA
AXB32378.1\|2675625_2676669_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	2.4e-111	60.7
AXB32379.1\|2676869_2677352_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.4e-26	48.1
AXB32380.1\|2677437_2679999_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	4.4e-34	22.8
AXB32381.1\|2680087_2681074_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
AXB32382.1\|2681154_2682078_-	LysM peptidoglycan-binding domain-containing protein	D7RWE0	Brochothrix_phage	1.8e-06	36.4
AXB32383.1\|2682092_2682719_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.0e-37	53.9
AXB32384.1\|2682718_2683495_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.6e-67	53.7
AXB32385.1\|2683494_2684538_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
AXB32386.1\|2684583_2685060_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AXB32387.1\|2685074_2685785_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AXB32388.1\|2685786_2686068_-	cell division protein FtsB	NA	NA	NA	NA
AXB32389.1\|2686492_2687794_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.0e-135	60.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030789

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1041532 : 1097928

Vibrio_phage(79.49%)

capsid,portal,protease,tail,head,integrase,terminase

attL 1058074:1058093|attR 1097711:1097730

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXB33842.1\|1041532_1042534_-\|protease	serine protease	G9E3T9	Emiliania_huxleyi_virus	7.3e-17	29.7
AXB33843.1\|1042696_1043599_-	LysR family transcriptional regulator	NA	NA	NA	NA
AXB33844.1\|1043741_1044665_+	DMT family transporter	NA	NA	NA	NA
AXB33845.1\|1044773_1045214_+	SRPBCC domain-containing protein	NA	NA	NA	NA
AXB33846.1\|1045298_1046054_+	phosphatase	NA	NA	NA	NA
AXB33847.1\|1046154_1046550_+	cytochrome b562 family protein	NA	NA	NA	NA
AXB33848.1\|1046727_1047087_+	hypothetical protein	NA	NA	NA	NA
AXB33849.1\|1047242_1048682_+	PepSY domain-containing protein	NA	NA	NA	NA
AXB33850.1\|1048734_1049118_-	VOC family protein	NA	NA	NA	NA
AXB33851.1\|1049144_1050074_-	LysR family transcriptional regulator	NA	NA	NA	NA
AXB33852.1\|1050151_1050625_-	hypothetical protein	NA	NA	NA	NA
AXB33853.1\|1050912_1051596_+	hypothetical protein	NA	NA	NA	NA
AXB33854.1\|1051605_1052301_+	hypothetical protein	NA	NA	NA	NA
AXB33855.1\|1055558_1056752_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	8.6e-41	29.9
AXB33856.1\|1056951_1057983_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
1058074:1058093	attL	NA	NA	NA	NA
AXB33857.1\|1058094_1059132_-\|integrase	integrase	R9TMQ4	Vibrio_phage	4.3e-129	63.3
AXB33858.1\|1059259_1060189_+	HNH endonuclease	NA	NA	NA	NA
AXB33859.1\|1060579_1061143_+	hypothetical protein	NA	NA	NA	NA
AXB33860.1\|1061139_1061250_+	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB33861.1\|1061301_1061685_+	hypothetical protein	NA	NA	NA	NA
AXB33862.1\|1061822_1062287_+	N-acetyltransferase	NA	NA	NA	NA
AXB33863.1\|1062421_1062982_+	suppressor of fused domain protein	NA	NA	NA	NA
AXB33864.1\|1062986_1063097_+	DUF3265 domain-containing protein	NA	NA	NA	NA
AXB33865.1\|1063133_1063808_+	DUF4145 domain-containing protein	M1PSB6	Streptococcus_phage	1.4e-27	34.7
AXB33866.1\|1063955_1064363_+	hypothetical protein	NA	NA	NA	NA
AXB33867.1\|1064419_1064605_+	hypothetical protein	NA	NA	NA	NA
AXB33868.1\|1064666_1066997_+	hypothetical protein	NA	NA	NA	NA
AXB33869.1\|1067232_1067511_+	hypothetical protein	NA	NA	NA	NA
AXB33870.1\|1067734_1068361_-	transcriptional regulator	A0A2I7RNF9	Vibrio_phage	4.7e-38	40.9
AXB33871.1\|1068452_1068665_+	hypothetical protein	U3PFJ1	Vibrio_phage	1.3e-13	54.3
AXB33872.1\|1068778_1069318_+	transcriptional regulator	A0A2I7RNI1	Vibrio_phage	6.0e-50	54.7
AXB33873.1\|1069346_1069547_+	hypothetical protein	A0A2I7RNH0	Vibrio_phage	2.6e-06	41.3
AXB33874.1\|1069546_1069774_+	hypothetical protein	NA	NA	NA	NA
AXB33875.1\|1069770_1070007_+	hypothetical protein	NA	NA	NA	NA
AXB33876.1\|1070012_1071899_+	replication endonuclease	A0A218M4H2	Erwinia_phage	8.8e-64	38.4
AXB33877.1\|1071949_1072213_+	hypothetical protein	Q8HA64	Vibrio_phage	2.2e-13	56.9
AXB33878.1\|1072207_1072459_-	transcriptional regulator	R9TNQ2	Vibrio_phage	1.2e-29	75.9
AXB33879.1\|1072742_1073615_+	hypothetical protein	NA	NA	NA	NA
AXB33880.1\|1074082_1074739_+	hypothetical protein	NA	NA	NA	NA
AXB33881.1\|1075116_1075473_-	hypothetical protein	NA	NA	NA	NA
AXB33882.1\|1075524_1075860_-	hypothetical protein	NA	NA	NA	NA
AXB33883.1\|1075967_1076291_-	hypothetical protein	NA	NA	NA	NA
AXB33884.1\|1076946_1077966_-\|portal	phage portal protein	A0A1D9C9P9	Salinivibrio_phage	7.7e-115	58.9
AXB33885.1\|1077970_1079752_-\|terminase	terminase	A0A1D9C9R1	Salinivibrio_phage	2.6e-259	77.2
AXB33886.1\|1079926_1080817_+\|capsid	phage capsid protein	A0A2I7RNH1	Vibrio_phage	8.6e-78	57.8
AXB33887.1\|1080816_1081821_+\|capsid	phage major capsid protein, P2 family	R9TPZ5	Vibrio_phage	7.6e-99	61.6
AXB33888.1\|1081824_1082541_+\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	6.5e-68	54.5
AXB33889.1\|1082657_1083119_+\|head	head protein	U3PFL1	Vibrio_phage	2.6e-54	71.9
AXB33890.1\|1083115_1083604_+	hypothetical protein	U3PIL4	Vibrio_phage	1.5e-63	72.8
AXB33891.1\|1083590_1084250_+	phage virion morphogenesis protein	U3PDG7	Vibrio_phage	1.3e-94	81.7
AXB33892.1\|1084251_1085361_+	DUF2586 family protein	U3PB71	Vibrio_phage	1.7e-171	82.6
AXB34643.1\|1085354_1085813_+	DUF2597 family protein	U3PCG7	Vibrio_phage	4.0e-71	84.2
AXB33893.1\|1085821_1086028_+	TraR/DksA family transcriptional regulator	U3PFL5	Vibrio_phage	2.4e-20	71.6
AXB33894.1\|1086027_1086240_+	hypothetical protein	U3PIL8	Vibrio_phage	9.6e-28	81.2
AXB33895.1\|1086226_1086817_+	lysozyme	U3PDH1	Vibrio_phage	7.7e-83	75.5
AXB33896.1\|1086791_1087133_+	hypothetical protein	U3PB75	Vibrio_phage	1.4e-28	60.2
AXB33897.1\|1087089_1087344_+	hypothetical protein	U3PCH1	Vibrio_phage	2.2e-26	69.1
AXB33898.1\|1087336_1087621_+	hypothetical protein	A0A160DHS7	Vibrio_phage	5.8e-28	70.2
AXB33899.1\|1087821_1090023_+\|tail	phage tail tape measure protein	U3PFL8	Vibrio_phage	1.2e-242	63.6
AXB33900.1\|1090012_1090345_+	DUF2590 family protein	R9TMS7	Vibrio_phage	5.0e-39	70.6
AXB33901.1\|1090341_1091547_+	hypothetical protein	R9TRT3	Vibrio_phage	1.2e-151	65.8
AXB33902.1\|1091539_1092214_+\|tail	phage tail protein	U3PB79	Vibrio_phage	1.6e-52	56.5
AXB33903.1\|1092214_1092976_+	hypothetical protein	A0A0U4K5K2	Pseudomonas_phage	2.8e-29	43.6
AXB33904.1\|1092972_1093974_+	hypothetical protein	NA	NA	NA	NA
AXB33905.1\|1093980_1094370_+	hypothetical protein	A0A088C3N9	Shewanella_sp._phage	4.6e-28	59.8
AXB33906.1\|1094372_1095266_+	hypothetical protein	U3PIM3	Vibrio_phage	2.5e-85	53.9
AXB33907.1\|1095253_1095727_+	DNA-binding protein	R9TPX7	Vibrio_phage	5.1e-53	70.1
AXB33908.1\|1095723_1097358_+	hypothetical protein	R9TNN7	Vibrio_phage	5.8e-213	66.2
AXB33909.1\|1097359_1097557_+	hypothetical protein	D4HTV1	Vibrio_phage	5.6e-06	43.8
AXB33910.1\|1097793_1097928_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	5.3e-16	86.4
1097711:1097730	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030788

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP030789

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection