CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032552	Pseudomonas aeruginosa strain PA34 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032552_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032552_1

346477-346590

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032552_1

>merge|CP032552|1|346477-346590|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>CP032552|1|1|346477-346590|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
CP032552.1\|AYK20858.1\|354220_354919_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|226274
CP032552.1\|AYK20842.1\|334367_335033_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP032552.1\|AYK20860.1\|355760_356255_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
CP032552.1\|AYK26654.1\|350017_350167_-\|transcriptional-regulator	unknown	unknown	unknown
CP032552.1\|AYK20855.1\|351770_352382_-\|thiol-disulfide-isomerase	unknown	unknown	gnl\|CDD\|239267
CP032552.1\|AYK20849.1\|343289_344387_+\|spermidine-binding-periplasmic-protein-SpuE	unknown	unknown	gnl\|CDD\|270377
CP032552.1\|AYK20854.1\|351162_351666_-\|transcriptional-regulator	unknown	unknown	unknown
CP032552.1\|AYK20844.1\|336410_337787_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP032552.1\|AYK20847.1\|340281_341652_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
CP032552.1\|AYK20850.1\|344441_345596_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
CP032552.1\|AYK20856.1\|352380_353400_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
CP032552.1\|AYK20845.1\|338064_338817_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
CP032552.1\|AYK20853.1\|350131_351184_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
CP032552.1\|AYK20857.1\|353419_354172_-\|hypothetical-protein	unknown	unknown	unknown
CP032552.1\|AYK20846.1\|338857_340216_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP032552.1\|AYK20843.1\|335093_336155_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
CP032552.1\|AYK20848.1\|341767_342871_+\|putrescine-binding-periplasmic-protein-SpuD	unknown	unknown	gnl\|CDD\|270377
CP032552.1\|AYK20841.1\|333326_334205_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
CP032552.1\|AYK20852.1\|347633_350021_-\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|225241
CP032552.1\|AYK20859.1\|354940_355495_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP032552.1\|AYK20858.1\|354220_354919_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	9.10189e-78
CP032552.1\|AYK20842.1\|334367_335033_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.54898e-08
CP032552.1\|AYK20860.1\|355760_356255_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	1.65548e-66
CP032552.1\|AYK20855.1\|351770_352382_-\|thiol-disulfide-isomerase	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.00342131
CP032552.1\|AYK20849.1\|343289_344387_+\|spermidine-binding-periplasmic-protein-SpuE	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP032552.1\|AYK20844.1\|336410_337787_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
CP032552.1\|AYK20847.1\|340281_341652_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
CP032552.1\|AYK20850.1\|344441_345596_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
CP032552.1\|AYK20856.1\|352380_353400_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	3.48481e-56
CP032552.1\|AYK20845.1\|338064_338817_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
CP032552.1\|AYK20853.1\|350131_351184_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	1.67458e-32
CP032552.1\|AYK20846.1\|338857_340216_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
CP032552.1\|AYK20843.1\|335093_336155_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.75222e-165
CP032552.1\|AYK20848.1\|341767_342871_+\|putrescine-binding-periplasmic-protein-SpuD	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP032552.1\|AYK20841.1\|333326_334205_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
CP032552.1\|AYK20852.1\|347633_350021_-\|penicillin-acylase-family-protein	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0

>CP032552.1|AYK20850.1|344441_345596_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>CP032552.1|AYK20849.1|343289_344387_+|spermidine-binding-periplasmic-protein-SpuE
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>CP032552.1|AYK20848.1|341767_342871_+|putrescine-binding-periplasmic-protein-SpuD
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>CP032552.1|AYK20847.1|340281_341652_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>CP032552.1|AYK20846.1|338857_340216_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>CP032552.1|AYK20845.1|338064_338817_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>CP032552.1|AYK20844.1|336410_337787_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>CP032552.1|AYK20843.1|335093_336155_-|polyamine-ABC-transporter-substrate-binding-protein
MPRLSVLLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLQPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPVVDEIWKAFRGASH
>CP032552.1|AYK20842.1|334367_335033_-|TetR/AcrR-family-transcriptional-regulator
MQPTSSIRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAERAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISDLNR
>CP032552.1|AYK20841.1|333326_334205_-|N-carbamoylputrescine-amidase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNHTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>CP032552.1|AYK20852.1|347633_350021_-|penicillin-acylase-family-protein
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLIAEKVNPDNPNQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWNGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAADADSPWWDDRRTERRETRADIVRAAWNASLAHLRSTLGNDPSGWLWGKAHTLTHEHALGQQALLKRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>CP032552.1|AYK26654.1|350017_350167_-|transcriptional-regulator
MGQGAGRRVVLHGGSSRLTKDFQGPSIRSMPRAGGIRRMLGTTTRRKDR
>CP032552.1|AYK20853.1|350131_351184_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHGVLTRHAEEQTRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREKGYSTSGT
>CP032552.1|AYK20854.1|351162_351666_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>CP032552.1|AYK20855.1|351770_352382_-|thiol-disulfide-isomerase
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>CP032552.1|AYK20856.1|352380_353400_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>CP032552.1|AYK20857.1|353419_354172_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAP
>CP032552.1|AYK20858.1|354220_354919_+|2OG-Fe(II)-oxygenase
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESVACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>CP032552.1|AYK20859.1|354940_355495_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKVGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>CP032552.1|AYK20860.1|355760_356255_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32081 : 105147

Dishui_lake_phycodnavirus(25.0%)

transposase,holin,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK20575.1\|32081_33005_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK20576.1\|33021_34533_-\|holin	choline-sulfatase	NA	NA	NA	NA
AYK20577.1\|34645_35560_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK20578.1\|35570_35948_+	dioxygenase	NA	NA	NA	NA
AYK20579.1\|35926_36292_-	Hpt domain-containing protein	NA	NA	NA	NA
AYK20580.1\|36299_36923_-	DNA-binding response regulator	NA	NA	NA	NA
AYK20581.1\|37108_37915_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
AYK20582.1\|37911_39120_-	tryptophan synthase subunit beta	NA	NA	NA	NA
AYK20583.1\|39223_40111_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK20584.1\|40211_40427_+	dodecin flavoprotein	NA	NA	NA	NA
AYK20585.1\|40610_40838_+	DUF1161 domain-containing protein	NA	NA	NA	NA
AYK20586.1\|41134_42823_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
AYK20587.1\|42935_53567_+	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
AYK20588.1\|53566_53896_+	hypothetical protein	NA	NA	NA	NA
AYK20589.1\|54320_54563_+	hydrolase	NA	NA	NA	NA
AYK20590.1\|54744_55437_+\|transposase	transposase	NA	NA	NA	NA
AYK26643.1\|56007_56223_+	hypothetical protein	NA	NA	NA	NA
AYK20591.1\|56443_59782_+	filamentous hemagglutinin	NA	NA	NA	NA
AYK20592.1\|59778_60096_+	hypothetical protein	NA	NA	NA	NA
AYK20593.1\|60326_61028_+\|transposase	transposase	NA	NA	NA	NA
AYK20594.1\|62811_63000_+	hypothetical protein	NA	NA	NA	NA
AYK20595.1\|63579_63858_+\|transposase	transposase	NA	NA	NA	NA
AYK20596.1\|63955_64351_+	hypothetical protein	NA	NA	NA	NA
AYK20597.1\|64387_64624_-	hypothetical protein	NA	NA	NA	NA
AYK20598.1\|64620_66030_-	DUF4010 domain-containing protein	NA	NA	NA	NA
AYK20599.1\|66193_67567_+	ADP-ribosyltransferase	NA	NA	NA	NA
AYK20600.1\|68062_68749_+	curli production assembly protein CsgG	NA	NA	NA	NA
AYK20601.1\|68779_69133_+	DUF4810 domain-containing protein	NA	NA	NA	NA
AYK20602.1\|69129_69795_+	hypothetical protein	NA	NA	NA	NA
AYK20603.1\|69809_70193_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYK20604.1\|70474_72136_-	hypothetical protein	NA	NA	NA	NA
AYK20605.1\|72746_72887_+	hypothetical protein	NA	NA	NA	NA
AYK20606.1\|73708_75541_+	asparagine synthase (glutamine-hydrolyzing)	A0A2K9R7N5	Dishui_lake_phycodnavirus	2.7e-17	28.3
AYK20607.1\|75593_76022_-	cupin domain-containing protein	NA	NA	NA	NA
AYK20608.1\|76461_76932_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
AYK20609.1\|76948_77497_-	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	5.2e-33	41.0
AYK20610.1\|77535_78042_-	DUF1993 family protein	NA	NA	NA	NA
AYK20611.1\|78107_79028_-	LysR family transcriptional regulator	NA	NA	NA	NA
AYK20612.1\|79135_80023_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AYK20613.1\|80085_80790_+	DsbA family protein	NA	NA	NA	NA
AYK20614.1\|80873_81329_+	OsmC family peroxiredoxin	NA	NA	NA	NA
AYK20615.1\|81439_81673_+	DUF1161 domain-containing protein	NA	NA	NA	NA
AYK20616.1\|81684_82122_-	hypothetical protein	NA	NA	NA	NA
AYK20617.1\|82178_82595_-	hypothetical protein	NA	NA	NA	NA
AYK26644.1\|82686_83814_+	aminopeptidase	NA	NA	NA	NA
AYK20618.1\|83821_84805_-	hypothetical protein	NA	NA	NA	NA
AYK20619.1\|84837_85503_-	HAD family hydrolase	NA	NA	NA	NA
AYK20620.1\|85495_86038_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
AYK20621.1\|86115_88161_+	oligopeptidase A	A0A1V0SD92	Indivirus	4.6e-34	21.3
AYK20622.1\|88157_88433_+	YheV family putative metal-binding protein	NA	NA	NA	NA
AYK20623.1\|88521_89580_+	PA0069 family radical SAM protein	NA	NA	NA	NA
AYK20624.1\|89810_90725_-	type VI secretion-associated lipoprotein TagQ	NA	NA	NA	NA
AYK20625.1\|90786_92499_-	formylglycine-generating enzyme family protein	NA	NA	NA	NA
AYK20626.1\|92491_93691_-	ABC transporter permease	NA	NA	NA	NA
AYK20627.1\|93690_94410_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-18	36.3
AYK20628.1\|97511_98240_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
AYK20629.1\|98249_98930_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
AYK20630.1\|98926_102460_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
AYK20631.1\|102456_103806_-	DotU family type VI secretion system protein	NA	NA	NA	NA
AYK20632.1\|103812_105147_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_2

638220 : 718640

Pseudomonas_phage(34.21%)

tRNA,holin,tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK21133.1\|638220_639246_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.7e-109	58.1
AYK21134.1\|639324_639894_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
AYK21135.1\|639977_640331_+	dihydroneopterin aldolase	NA	NA	NA	NA
AYK21136.1\|640321_640864_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AYK21137.1\|640836_642069_-\|tRNA	multifunctional tRNA nucleotidyltransferase/2',3'-cyclic phosphodiesterase/2' nucleotidase/2'phosphatase	A0A076G5T8	Escherichia_phage	2.6e-77	43.1
AYK21138.1\|642112_642619_-	DUF4136 domain-containing protein	NA	NA	NA	NA
AYK21139.1\|642712_644266_-	SpoVR family protein	NA	NA	NA	NA
AYK21140.1\|644262_645534_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
AYK21141.1\|645634_647557_-	PrkA family serine protein kinase	NA	NA	NA	NA
AYK21142.1\|647835_648168_-	thiosulfate sulfurtransferase	NA	NA	NA	NA
AYK21143.1\|648211_649063_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
AYK21144.1\|649062_649443_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AYK21145.1\|649479_650286_-	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AYK21146.1\|650401_651388_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
AYK21147.1\|651384_652677_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
AYK21148.1\|652657_655459_-	LPS-assembly protein LptD	NA	NA	NA	NA
AYK21149.1\|655585_656602_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AYK21150.1\|656598_657273_+	nucleotidyltransferase family protein	NA	NA	NA	NA
AYK21151.1\|657274_658033_+	molecular chaperone DjlA	NA	NA	NA	NA
AYK21152.1\|658033_659095_-	DUF3530 family protein	NA	NA	NA	NA
AYK21153.1\|659246_661640_+	PAS domain S-box protein	NA	NA	NA	NA
AYK21154.1\|661685_662318_+	DNA-binding response regulator	NA	NA	NA	NA
AYK21155.1\|662446_663481_+	extracellular solute-binding protein	NA	NA	NA	NA
AYK21156.1\|663714_664824_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
AYK21157.1\|664879_665926_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK21158.1\|666040_667288_+	ABC transporter permease	NA	NA	NA	NA
AYK21159.1\|667393_668224_+	ABC transporter permease	NA	NA	NA	NA
AYK21160.1\|668347_669022_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AYK21161.1\|669021_669840_+	phosphoglycolate phosphatase	NA	NA	NA	NA
AYK21162.1\|669912_671391_+	anthranilate synthase component I	NA	NA	NA	NA
AYK21163.1\|671577_671892_-	transcription regulatory protein PrtN	NA	NA	NA	NA
AYK21164.1\|671991_672762_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	7.9e-72	59.0
AYK21165.1\|673219_673420_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
AYK21166.1\|673467_673827_+	hypothetical protein	NA	NA	NA	NA
AYK21167.1\|674189_674639_+\|holin	holin	B5TK61	Pseudomonas_phage	5.0e-26	53.3
AYK21168.1\|674660_675176_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.1e-32	42.9
AYK21169.1\|675172_675730_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
AYK21170.1\|675882_676209_+	bacteriophage protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.4e-30	60.2
AYK21171.1\|676205_677093_+	bacteriophage protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
AYK21172.1\|677085_677619_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	5.2e-62	64.6
AYK21173.1\|677620_679729_+\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	6.5e-225	52.3
AYK21174.1\|679737_680178_+\|tail	phage tail protein	NA	NA	NA	NA
AYK21175.1\|680220_681381_+\|tail	phage tail sheath family protein	Q38068	Phage_PS17	2.7e-188	83.4
AYK21176.1\|681393_681897_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
AYK21177.1\|681911_682256_+\|tail	phage tail assembly protein	NA	NA	NA	NA
AYK21178.1\|682425_684663_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
AYK21179.1\|684672_685545_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
AYK21180.1\|685519_685726_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
AYK21181.1\|685783_686773_+	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.8e-106	55.8
AYK21182.1\|686805_687435_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	2.5e-87	78.5
AYK26659.1\|687431_687794_+	hypothetical protein	NA	NA	NA	NA
AYK21183.1\|687790_688048_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
AYK21184.1\|688062_688350_+	hypothetical protein	NA	NA	NA	NA
AYK21185.1\|688363_688858_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	1.4e-45	56.5
AYK21186.1\|688869_689217_+	hypothetical protein	NA	NA	NA	NA
AYK21187.1\|689246_689501_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	6.3e-10	38.4
AYK21188.1\|689547_691386_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	3.4e-28	35.8
AYK21189.1\|691378_691720_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-17	40.0
AYK21190.1\|691727_692423_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	1.5e-69	50.2
AYK21191.1\|692425_693196_+\|tail	phage tail protein	A0A2D1GNP8	Pseudomonas_phage	7.2e-81	55.6
AYK21192.1\|693250_693853_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	2.2e-53	57.8
AYK21193.1\|693911_697565_+	DUF1983 domain-containing protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	57.3
AYK21194.1\|698550_699627_+\|tail	phage tail protein	A0A0S3UG21	Pseudomonas_phage	1.2e-102	65.6
AYK21195.1\|699626_699929_+	hypothetical protein	I6PBW9	Pseudomonas_phage	6.3e-41	83.0
AYK21196.1\|699925_700150_+	hypothetical protein	A0A1B0YZV9	Pseudomonas_phage	1.5e-31	93.2
AYK21197.1\|700555_701161_+	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	6.0e-75	65.8
AYK21198.1\|701162_702212_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
AYK21199.1\|702208_703045_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9
AYK21200.1\|703106_703751_-	cyclic AMP receptor-like protein	NA	NA	NA	NA
AYK21201.1\|704021_704444_+	OsmC family protein	NA	NA	NA	NA
AYK21202.1\|704763_705558_+	S-adenosylmethionine decarboxylase proenzyme	NA	NA	NA	NA
AYK21203.1\|705612_706260_-	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
AYK21204.1\|706359_706698_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
AYK21205.1\|706776_708258_+	AAA family ATPase	U5XJW0	Phormidium_phage	3.9e-67	33.8
AYK21206.1\|708297_709098_-	SDR family oxidoreductase	NA	NA	NA	NA
AYK21207.1\|709158_710241_-	DUF805 domain-containing protein	NA	NA	NA	NA
AYK21208.1\|710362_711331_-	nitronate monooxygenase	NA	NA	NA	NA
AYK21209.1\|711347_711770_-	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
AYK21210.1\|712060_713095_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
AYK21211.1\|713094_713814_+	hypothetical protein	NA	NA	NA	NA
AYK21212.1\|713814_714237_+	polymer-forming cytoskeletal family protein	NA	NA	NA	NA
AYK21213.1\|714314_714665_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	3.0e-26	53.2
AYK21214.1\|714718_715810_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
AYK26660.1\|715812_717156_-	peptidase M23	O03937	Lactobacillus_phage	3.0e-18	44.1
AYK21215.1\|717440_718640_+\|tRNA	Tyrosine--tRNA ligase 2	NA	NA	NA	NA

DBSCAN-SWA_3

1442761 : 1451790

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK26683.1\|1442761_1443397_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
AYK21856.1\|1443442_1444336_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
AYK21857.1\|1444440_1445445_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
AYK21858.1\|1445871_1446195_-	Ferredoxin 1	NA	NA	NA	NA
AYK21859.1\|1446261_1448829_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	3.2e-24	22.1
AYK21860.1\|1448808_1448973_+	TolB-like translocation protein	NA	NA	NA	NA
AYK21861.1\|1448954_1449962_-	TolB-like translocation protein	NA	NA	NA	NA
AYK21862.1\|1450109_1450616_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
AYK21863.1\|1450749_1451790_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_4

2260445 : 2313824

Bacillus_phage(37.5%)

transposase,protease,integrase

attL 2313140:2313154|attR 2313854:2313868

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK22579.1\|2260445_2261210_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYK22580.1\|2261442_2261610_-	DUF2897 family protein	NA	NA	NA	NA
AYK22581.1\|2261846_2263148_+	CBS domain-containing protein	W8CYF6	Bacillus_phage	8.0e-08	30.9
AYK22582.1\|2263149_2264061_+	response regulator	NA	NA	NA	NA
AYK22583.1\|2264069_2264540_-	multidrug/biocide efflux PACE transporter	NA	NA	NA	NA
AYK22584.1\|2264631_2265522_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK22585.1\|2265545_2266187_-	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	5.1e-16	32.7
AYK22586.1\|2266232_2267126_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK22587.1\|2267222_2267921_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
AYK22588.1\|2268169_2269087_+	AAA family ATPase	NA	NA	NA	NA
AYK22589.1\|2269086_2270040_+	DUF58 domain-containing protein	NA	NA	NA	NA
AYK22590.1\|2270036_2272043_+	DUF3488 domain-containing protein	NA	NA	NA	NA
AYK22591.1\|2272039_2272810_+	CHAD domain-containing protein	NA	NA	NA	NA
AYK22592.1\|2272890_2273688_+	acyl-CoA thioesterase II	NA	NA	NA	NA
AYK22593.1\|2273696_2275274_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.8e-17	32.8
AYK22594.1\|2275283_2275772_-	oxidoreductase	NA	NA	NA	NA
AYK22595.1\|2275858_2276218_-	DUF962 domain-containing protein	NA	NA	NA	NA
AYK22596.1\|2276343_2277816_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-34	33.1
AYK22597.1\|2277954_2278758_-	hydrolase TatD	NA	NA	NA	NA
AYK22598.1\|2279004_2280435_+	lytic transglycosylase F	A0A0S2SXL7	Bacillus_phage	1.2e-07	35.6
AYK22599.1\|2280533_2280968_+	DoxX family protein	NA	NA	NA	NA
AYK22600.1\|2281142_2282165_-	lipase secretion chaperone	NA	NA	NA	NA
AYK22601.1\|2282214_2283150_-	lactonizing lipase	NA	NA	NA	NA
AYK26708.1\|2283345_2283894_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
AYK22602.1\|2283947_2284388_+	hypothetical protein	NA	NA	NA	NA
AYK22603.1\|2284880_2286260_+\|integrase	site-specific integrase	NA	NA	NA	NA
AYK22604.1\|2286634_2290285_+\|integrase	integrase	NA	NA	NA	NA
AYK22605.1\|2291276_2291555_-	hypothetical protein	NA	NA	NA	NA
AYK22606.1\|2292192_2292996_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	4.0e-34	36.2
AYK26709.1\|2292988_2294488_-\|transposase	IS21 family transposase	NA	NA	NA	NA
AYK22607.1\|2294928_2295375_-	hypothetical protein	NA	NA	NA	NA
AYK22608.1\|2295479_2295770_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK22609.1\|2295974_2296535_+	hypothetical protein	NA	NA	NA	NA
AYK22610.1\|2297067_2297538_+	DUF2384 domain-containing protein	NA	NA	NA	NA
AYK22611.1\|2298255_2299143_+	chromate resistance protein	NA	NA	NA	NA
AYK22612.1\|2299135_2300497_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.1e-27	67.1
AYK22613.1\|2300506_2300830_+	sulfurtransferase	NA	NA	NA	NA
AYK22614.1\|2300877_2301012_-	YHYH domain-containing protein	NA	NA	NA	NA
AYK22615.1\|2301111_2301813_-	conjugal transfer protein TraX	NA	NA	NA	NA
AYK22616.1\|2301812_2302253_-	DedA family protein	NA	NA	NA	NA
AYK22617.1\|2302253_2303375_-	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
AYK22618.1\|2303383_2303677_-	metal resistance protein	NA	NA	NA	NA
AYK22619.1\|2303783_2304125_+	hypothetical protein	NA	NA	NA	NA
AYK22620.1\|2304172_2304910_+	HupE/UreJ family protein	NA	NA	NA	NA
AYK22621.1\|2304922_2305600_+	transmembrane anchor protein	NA	NA	NA	NA
AYK22622.1\|2305713_2306334_+\|integrase	integrase	NA	NA	NA	NA
AYK22623.1\|2306521_2307451_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK22624.1\|2307499_2308396_+	EamA family transporter RarD	NA	NA	NA	NA
AYK22625.1\|2308759_2309587_+	phosphonate ABC transporter ATP-binding protein	NA	NA	NA	NA
AYK22626.1\|2309583_2310447_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK22627.1\|2310455_2311283_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AYK22628.1\|2311291_2312302_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
AYK22629.1\|2312295_2313150_+	LysR family transcriptional regulator	NA	NA	NA	NA
2313140:2313154	attL	NA	NA	NA	NA
AYK22630.1\|2313203_2313824_+\|integrase	integrase	A0A142F2H8	Mycobacterium_phage	1.6e-06	32.5
AYK22630.1\|2313203_2313824_+\|integrase	integrase	A0A142F2H8	Mycobacterium_phage	1.6e-06	32.5
2313854:2313868	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2494163 : 2528234

Pseudomonas_phage(60.61%)

tRNA,transposase,terminase,tail,integrase,holin

attL 2494450:2494464|attR 2502031:2502045

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK22810.1\|2494163_2495144_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
2494450:2494464	attL	NA	NA	NA	NA
AYK26723.1\|2495326_2496442_+\|integrase	site-specific integrase	A0A2K8I325	Pseudomonas_phage	2.1e-118	60.3
AYK22811.1\|2496415_2496691_-	Pyocin activator protein PrtN	A0A2K8HN48	Pseudomonas_phage	3.4e-25	65.5
AYK22812.1\|2496794_2497007_-	hypothetical protein	NA	NA	NA	NA
AYK22813.1\|2497003_2498884_-	cytosine methyltransferase	Q5QF27	Pseudomonas_virus	1.2e-132	43.2
AYK22814.1\|2498880_2499360_-	glycoside hydrolase	NA	NA	NA	NA
AYK22815.1\|2499369_2499609_-	hypothetical protein	NA	NA	NA	NA
AYK22816.1\|2499605_2500232_-	hypothetical protein	NA	NA	NA	NA
AYK22817.1\|2500281_2500599_-	transcriptional regulator	NA	NA	NA	NA
AYK22818.1\|2500595_2500826_-	hypothetical protein	NA	NA	NA	NA
AYK22819.1\|2500976_2501270_-	DNA-binding protein	NA	NA	NA	NA
AYK22820.1\|2501530_2502693_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
2502031:2502045	attR	NA	NA	NA	NA
AYK22821.1\|2503018_2503378_-	DUF4440 domain-containing protein	NA	NA	NA	NA
AYK22822.1\|2503728_2503995_-	hypothetical protein	H2BDH3	Pseudomonas_virus	1.9e-28	84.1
AYK22823.1\|2504095_2504746_-	NAD-dependent DNA ligase	A0A0U4J8W4	Pseudomonas_phage	1.6e-121	97.2
AYK22824.1\|2504879_2505452_-	S24 family peptidase	H2BD63	Pseudomonas_phage	1.9e-86	91.7
AYK22825.1\|2505828_2506047_+	helix-turn-helix domain-containing protein	A0A2D1GND2	Pseudomonas_phage	2.9e-19	64.7
AYK22826.1\|2506078_2506651_+	hypothetical protein	H2BD67	Pseudomonas_phage	1.3e-100	98.4
AYK22827.1\|2506653_2507538_+	hypothetical protein	NA	NA	NA	NA
AYK22828.1\|2507587_2508196_+	hypothetical protein	A0A2H4J6S4	uncultured_Caudovirales_phage	3.4e-41	43.9
AYK22829.1\|2508188_2508632_+	RusA family crossover junction endodeoxyribonuclease	H2BD71	Pseudomonas_phage	1.4e-52	69.2
AYK22830.1\|2508660_2509530_+	hypothetical protein	J7HXH6	Pseudomonas_phage	4.1e-141	84.4
AYK22831.1\|2509589_2509898_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
AYK22832.1\|2509872_2510148_-	type II toxin-antitoxin system prevent-host-death family antitoxin	A0A0A1IU40	Pseudomonas_phage	2.7e-06	64.9
AYK22833.1\|2510448_2510748_+	hypothetical protein	NA	NA	NA	NA
AYK22834.1\|2510855_2511236_+	hypothetical protein	H2BDJ3	Pseudomonas_virus	4.8e-38	67.5
AYK22835.1\|2511210_2511558_+\|holin	phage holin family protein	Q9MC42	Pseudomonas_phage	1.9e-25	61.3
AYK22836.1\|2511624_2512080_+	hypothetical protein	NA	NA	NA	NA
AYK22837.1\|2512137_2512734_+\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	3.3e-49	61.9
AYK22838.1\|2512720_2514016_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	1.4e-145	58.5
AYK22839.1\|2514018_2515374_+	DUF4055 domain-containing protein	A0A0H5AWC7	Pseudomonas_phage	3.7e-96	45.8
AYK22840.1\|2515370_2516450_+	hypothetical protein	A0A0S2SY77	Pseudomonas_phage	3.8e-197	97.7
AYK22841.1\|2516432_2516948_-	hypothetical protein	NA	NA	NA	NA
AYK26724.1\|2517100_2517844_+	hypothetical protein	A0A0H5AWD1	Pseudomonas_phage	8.4e-87	74.5
AYK22842.1\|2517853_2518825_+	hypothetical protein	A0A0M3LQL5	Mannheimia_phage	9.3e-110	64.7
AYK22843.1\|2518866_2519352_+	hypothetical protein	NA	NA	NA	NA
AYK22844.1\|2519335_2519800_+	hypothetical protein	H9EB35	Vibrio_phage	4.0e-10	36.4
AYK22845.1\|2519799_2520189_+	hypothetical protein	A0A2H4JAS3	uncultured_Caudovirales_phage	2.8e-33	55.0
AYK22846.1\|2520192_2520867_+	hypothetical protein	A0A0S2SY81	Pseudomonas_phage	3.0e-115	96.0
AYK22847.1\|2520863_2521274_+	hypothetical protein	A0A1B0VMI0	Pseudomonas_phage	2.5e-24	43.4
AYK22848.1\|2521341_2521995_+\|tail	phage tail protein	A0A2H4IZV5	uncultured_Caudovirales_phage	7.7e-60	52.8
AYK22849.1\|2522004_2522385_+	hypothetical protein	A0A1B0VMH4	Pseudomonas_phage	4.8e-22	44.9
AYK22850.1\|2522447_2522711_+	hypothetical protein	A0A2R3UAE2	Siphoviridae_environmental_samples	2.7e-16	46.0
AYK22851.1\|2522707_2525899_+\|tail	phage tail tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	2.5e-156	40.4
AYK22852.1\|2525904_2526243_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	3.1e-60	99.1
AYK22853.1\|2526239_2526989_+\|tail	phage minor tail protein L	A0A0S2SY57	Pseudomonas_phage	3.9e-148	99.6
AYK22854.1\|2526991_2527753_+\|tail	phage tail protein	A0A0S2SY75	Pseudomonas_phage	1.4e-140	93.9
AYK22855.1\|2527777_2528020_+	hypothetical protein	NA	NA	NA	NA
AYK22856.1\|2528000_2528234_-	hypothetical protein	K7PJU3	Enterobacteria_phage	2.1e-12	45.3

DBSCAN-SWA_6

2737173 : 2746137

uncultured_Caudovirales_phage(71.43%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK23060.1\|2737173_2738454_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
AYK23061.1\|2738455_2739853_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AYK23062.1\|2739857_2740832_-	glutathione S-transferase family protein	NA	NA	NA	NA
AYK23063.1\|2740919_2741903_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	9.3e-142	74.3
AYK23064.1\|2741899_2742235_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	9.5e-38	68.5
AYK23065.1\|2742231_2742537_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
AYK23066.1\|2742536_2742896_-	sulfurtransferase	A0A2H4J8C0	uncultured_Caudovirales_phage	1.8e-34	61.7
AYK23067.1\|2742892_2743288_-	sulfurtransferase TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
AYK23068.1\|2743398_2744067_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1
AYK23069.1\|2744451_2744883_+	hypothetical protein	NA	NA	NA	NA
AYK23070.1\|2744992_2745202_-	hypothetical protein	NA	NA	NA	NA
AYK23071.1\|2745219_2745411_-	hypothetical protein	NA	NA	NA	NA
AYK23072.1\|2745413_2745620_-	hypothetical protein	NA	NA	NA	NA
AYK23073.1\|2745612_2746137_-	hypothetical protein	D5LH05	Escherichia_phage	2.9e-09	44.0

DBSCAN-SWA_7

4895939 : 4903912

Pseudomonas_phage(100.0%)

capsid,integrase

attL 4890187:4890201|attR 4899920:4899934

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4890187:4890201	attL	NA	NA	NA	NA
AYK24924.1\|4895939_4896944_-\|integrase	integrase	Q56VN7	Pseudomonas_phage	1.7e-98	54.2
AYK24925.1\|4896943_4898236_-	hypothetical protein	Q56VN8	Pseudomonas_phage	6.9e-254	97.0
AYK24926.1\|4898464_4899748_-	hypothetical protein	Q56VN9	Pseudomonas_phage	4.2e-235	99.5
AYK24927.1\|4899751_4900108_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
4899920:4899934	attR	NA	NA	NA	NA
AYK24928.1\|4900112_4901450_-	attachment protein	Q56VP1	Pseudomonas_phage	1.9e-153	94.6
AYK24929.1\|4901603_4901852_-\|capsid	capsid protein	Q56VP2	Pseudomonas_phage	2.1e-34	100.0
AYK24930.1\|4901864_4902116_-	hypothetical protein	NA	NA	NA	NA
AYK24931.1\|4902128_4902221_-	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
AYK24932.1\|4902237_4902672_-	DNA-binding protein	Q56VP5	Pseudomonas_phage	3.8e-63	100.0
AYK24933.1\|4902806_4903184_-	hypothetical protein	Q56VP6	Pseudomonas_phage	3.4e-60	96.8
AYK24934.1\|4903187_4903478_-	hypothetical protein	Q56VP7	Pseudomonas_phage	1.8e-53	94.8
AYK24935.1\|4903481_4903694_-	hypothetical protein	Q56VP8	Pseudomonas_phage	6.0e-30	91.4
AYK24936.1\|4903696_4903912_-	DNA-binding protein	Q56VP9	Pseudomonas_phage	5.7e-36	98.6

DBSCAN-SWA_8

5672262 : 5709037

Pseudomonas_phage(25.0%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK25630.1\|5672262_5672811_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
AYK25631.1\|5672841_5673375_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
AYK25632.1\|5673374_5673917_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
AYK25633.1\|5673935_5674724_+	molecular chaperone	NA	NA	NA	NA
AYK25634.1\|5674740_5677116_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AYK25635.1\|5677112_5678060_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
AYK25636.1\|5678061_5679435_-	MFS transporter	NA	NA	NA	NA
AYK25637.1\|5679714_5680737_-	ferrochelatase	NA	NA	NA	NA
AYK25638.1\|5680733_5681651_-	TIGR01777 family protein	NA	NA	NA	NA
AYK25639.1\|5682064_5683048_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AYK25640.1\|5683200_5684160_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
AYK25641.1\|5684169_5685069_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	8.5e-17	39.1
AYK25642.1\|5685065_5686511_+	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	3.1e-45	29.0
AYK25643.1\|5686636_5687158_-	lipid A deacylase PagL	A0A2H4J0I5	uncultured_Caudovirales_phage	1.0e-59	70.4
AYK25644.1\|5687291_5688089_-	glutamate racemase	NA	NA	NA	NA
AYK26827.1\|5688078_5688837_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
AYK25645.1\|5688830_5689661_-	protein-(glutamine-N5) methyltransferase, release factor-specific	NA	NA	NA	NA
AYK25646.1\|5689662_5690745_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	5.6e-07	48.3
AYK25647.1\|5690762_5692031_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
AYK25648.1\|5692174_5693947_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYK25649.1\|5693951_5694569_+	outer membrane lipoprotein LolB	NA	NA	NA	NA
AYK25650.1\|5694570_5695419_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
AYK25651.1\|5695585_5696527_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	4.1e-46	35.4
AYK25652.1\|5696643_5697258_+	50S ribosomal protein L25	NA	NA	NA	NA
AYK25653.1\|5697299_5697884_+\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
AYK25654.1\|5697924_5699025_+	redox-regulated ATPase YchF	NA	NA	NA	NA
AYK25655.1\|5699239_5700427_+	DUF4102 domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	5.9e-74	39.9
AYK26828.1\|5700491_5701142_+	hypothetical protein	NA	NA	NA	NA
AYK26829.1\|5701213_5701792_+	hypothetical protein	NA	NA	NA	NA
AYK25656.1\|5701829_5702813_+	ATP-binding protein	E5EQU5	Bathycoccus_sp._RCC1105_virus	9.0e-12	29.8
AYK25657.1\|5702822_5705312_+	subtilase	NA	NA	NA	NA
AYK25658.1\|5705352_5706177_-	abortive infection family protein	NA	NA	NA	NA
AYK25659.1\|5706685_5707081_+\|transposase	transposase	NA	NA	NA	NA
AYK25660.1\|5707047_5707410_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AYK25661.1\|5707486_5709037_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.0e-118	46.7

DBSCAN-SWA_9

5939190 : 5981366

Pseudomonas_phage(62.75%)

head,transposase,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK25866.1\|5939190_5940798_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	4.4e-64	46.8
AYK25867.1\|5940901_5942191_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AYK25868.1\|5942294_5945123_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.6e-45	27.5
AYK25869.1\|5945431_5946109_-	XRE family transcriptional regulator	H1ZZB6	Pseudomonas_virus	1.1e-117	97.3
AYK25870.1\|5946349_5946706_+	nucleotide excision repair protein	A0A0U5KN61	unidentified_phage	8.5e-61	98.3
AYK25871.1\|5946708_5947143_+	hypothetical protein	A0A0U5KMV2	unidentified_phage	1.3e-76	100.0
AYK25872.1\|5947142_5947352_+	hypothetical protein	L7P7N2	Pseudomonas_phage	2.2e-32	100.0
AYK25873.1\|5947344_5949414_+\|transposase	transposase	A0A0U5LBU1	unidentified_phage	0.0e+00	97.7
AYK25874.1\|5949410_5950181_+	ATP-binding protein	I6PCA3	Pseudomonas_phage	2.9e-138	100.0
AYK25875.1\|5950177_5950843_+	hypothetical protein	A0A125RNF1	Pseudomonas_phage	1.6e-124	99.5
AYK25876.1\|5950914_5951550_+	hypothetical protein	A0A125RNF2	Pseudomonas_phage	5.9e-113	99.1
AYK26837.1\|5951650_5952064_+	hypothetical protein	L7P828	Pseudomonas_phage	1.2e-71	100.0
AYK25877.1\|5952026_5952338_+	hypothetical protein	H6V800	Pseudomonas_virus	4.5e-50	98.1
AYK25878.1\|5952354_5952873_+	host-nuclease inhibitor protein Gam	L7P7I4	Pseudomonas_phage	2.5e-90	99.4
AYK25879.1\|5952874_5953252_+	host nuclease inhibitor protein	A0A0U5G7F5	unidentified_phage	3.1e-61	95.2
AYK25880.1\|5953253_5953535_+	hypothetical protein	A0A125RNF9	Pseudomonas_phage	7.9e-46	98.9
AYK25881.1\|5953536_5953743_+	hypothetical protein	A0A0A1IWY9	Pseudomonas_phage	2.2e-29	100.0
AYK25882.1\|5953745_5954015_+	hypothetical protein	A0A076FSV2	Pseudomonas_phage	4.2e-44	97.8
AYK25883.1\|5954085_5954382_+	hypothetical protein	L7P7Y1	Pseudomonas_phage	1.2e-44	100.0
AYK25884.1\|5954378_5954786_+	regulatory protein GemA	I6PBV8	Pseudomonas_phage	7.9e-71	100.0
AYK25885.1\|5954772_5955222_+	hypothetical protein	B7SDY2	Pseudomonas_virus	1.2e-80	100.0
AYK25886.1\|5955325_5955673_+	hypothetical protein	B7SDY3	Pseudomonas_virus	2.0e-59	100.0
AYK25887.1\|5955665_5956088_+	hypothetical protein	L7P7S9	Pseudomonas_phage	1.5e-72	100.0
AYK25888.1\|5956087_5956504_+	structural protein	L7P7L2	Pseudomonas_phage	1.6e-74	100.0
AYK25889.1\|5956503_5956746_+	hypothetical protein	B7SDY6	Pseudomonas_virus	2.6e-37	100.0
AYK25890.1\|5956742_5957144_+	hypothetical protein	A0A0A7DJP8	Pseudomonas_phage	7.5e-66	99.2
AYK25891.1\|5957254_5957443_+	hypothetical protein	A0A0A1IVG3	Pseudomonas_phage	1.0e-25	100.0
AYK25892.1\|5957451_5957952_+	DUF1804 family protein	B7SDY9	Pseudomonas_virus	2.9e-83	99.4
AYK25893.1\|5957957_5958485_-	hypothetical protein	B7SDZ0	Pseudomonas_virus	2.2e-97	99.4
AYK25894.1\|5958483_5960136_+	hypothetical protein	A0SMN6	Pseudomonas_virus	0.0e+00	100.0
AYK25895.1\|5960145_5961726_+	DUF935 domain-containing protein	A0A0A1IVG5	Pseudomonas_phage	2.2e-302	100.0
AYK25896.1\|5961725_5963012_+\|head	phage head morphogenesis protein	B7SDZ3	Pseudomonas_virus	1.2e-245	100.0
AYK25897.1\|5963011_5963479_+	phage virion morphogenesis protein	B7SDZ4	Pseudomonas_virus	2.5e-81	100.0
AYK25898.1\|5963681_5964779_+\|protease	protease	A0A125RNI0	Pseudomonas_phage	4.1e-199	99.5
AYK25899.1\|5964782_5965697_+\|head	head protein	I6PBD3	Pseudomonas_phage	9.2e-176	100.0
AYK25900.1\|5965763_5966204_+	hypothetical protein	A0A125RNI2	Pseudomonas_phage	1.2e-45	100.0
AYK25901.1\|5966367_5966784_+	DUF1320 domain-containing protein	A0A0A1IX76	Pseudomonas_phage	3.9e-73	100.0
AYK25902.1\|5966780_5967254_+	hypothetical protein	A0A0A1IUZ7	Pseudomonas_phage	3.8e-85	100.0
AYK25903.1\|5967241_5967421_+	hypothetical protein	A0A0A1IX00	Pseudomonas_phage	2.2e-25	100.0
AYK25904.1\|5967453_5968224_+	hypothetical protein	A0A0A1IW08	Pseudomonas_phage	2.1e-141	100.0
AYK25905.1\|5968227_5968746_+	hypothetical protein	B7SE04	Pseudomonas_virus	3.2e-85	93.0
AYK25906.1\|5968872_5972571_+\|tail	phage tail protein	B7SE05	Pseudomonas_virus	0.0e+00	99.2
AYK25907.1\|5972578_5973535_+	hypothetical protein	A0A0A7DK02	Pseudomonas_phage	2.4e-182	94.7
AYK25908.1\|5973536_5974460_+	hypothetical protein	A0A125RNJ1	Pseudomonas_phage	9.2e-176	93.5
AYK25909.1\|5974459_5976163_+	hypothetical protein	L7P7V0	Pseudomonas_phage	0.0e+00	98.1
AYK25910.1\|5976152_5976974_+	DUF2163 domain-containing protein	A0A076FSS7	Pseudomonas_phage	2.6e-161	99.3
AYK25911.1\|5976982_5977222_+	hypothetical protein	A0A076FRB9	Pseudomonas_phage	2.1e-39	100.0
AYK25912.1\|5977218_5977437_+	hypothetical protein	A0A076FR11	Pseudomonas_phage	5.7e-36	100.0
AYK25913.1\|5977426_5979634_+	hypothetical protein	A0A0A1IX03	Pseudomonas_phage	0.0e+00	98.2
AYK25914.1\|5979630_5980779_+	hypothetical protein	B7SE13	Pseudomonas_virus	2.7e-225	99.2
AYK25915.1\|5980775_5981063_+	hypothetical protein	A0A076FSS3	Pseudomonas_phage	6.2e-46	95.8
AYK25916.1\|5981141_5981366_+	hypothetical protein	Q5ZQV7	Pseudomonas_phage	5.5e-34	98.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage