CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
CP033524	Acinetobacter pittii strain 2012N08-034 plasmid p2012N08-034-4, complete sequence	0 crisprs	NA	0	0
CP033523	Acinetobacter pittii strain 2012N08-034 plasmid p2012N08-034-3, complete sequence	0 crisprs	NA	0	0
CP033521	Acinetobacter pittii strain 2012N08-034 plasmid p2012N08-034-1, complete sequence	0 crisprs	NA	0	0
CP033520	Acinetobacter pittii strain 2012N08-034 chromosome, complete genome	2 crisprs	WYL,csa3,DEDDh	1	1
CP033522	Acinetobacter pittii strain 2012N08-034 plasmid p2012N08-034-2, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033520_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033520_1

435558-435782

Orphan

Consensus_repeat	Method
GGTGGTGAAGATCGTCCACGTCGT	CRISPRCasFinder

3 spacers

The CRISPR arrays of CP033520_1

>merge|CP033520|1|435558-435782|CRISPRCasFinder
GGTGGTCGTGATGGTCGTCGTGGTGGCGGTTTTGGCGGTGGTCGTCGTTTTGAAGGCGAAAGCAACTTCAAACGCCGTGAAGGTGGTCGTGATGACCGTCCACGTCGTAGCTTTGATGACAAACCACGTGGTGAACGTCCATTCGGTGGTGAAGATCGTCCACGTCGCGAGTTCAATTCAGATCGCCCACGTCGTGAAGGTGGTTTTGAAGATCGTCCACGTCGT

>CP033520|1|1|435558-435782|CRISPRCasFinder
GGTGGTCGTGATGGTCGTCGTGGT	GGCGGTTTTGGCGGTGGTCGTCGTTTTGAAGGCGAAAGCAACTTCAAACGCCGTGAAGGT
GGTCGTGATGACCGTCCACGTCGT	AGCTTTGATGACAAACCACGTGGTGAACGTCCATTC
GGTGGTGAAGATCGTCCACGTCGC	GAGTTCAATTCAGATCGCCCACGTCGTGAAGGT
GGTTTTGAAGATCGTCCACGTCGT

Protein	Signature genes	Signature genes Name	Protein_function
CP033520.1\|AZB91548.1\|445680_446664_+\|RND-transporter	unknown	unknown	gnl\|CDD\|270388
CP033520.1\|AZB90013.1\|437423_438200_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
CP033520.1\|AZB90003.1\|411332_412199_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
CP033520.1\|AZB90005.1\|416410_417388_-\|glycine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|236473
CP033520.1\|AZB90008.1\|421264_422365_+\|HPP-family-protein	unknown	unknown	gnl\|CDD\|225979
CP033520.1\|AZB90011.1\|436308_436518_+\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90004.1\|413781_414255_-\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90010.1\|428119_428908_-\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
CP033520.1\|AZB90012.1\|436608_437427_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213228
CP033520.1\|AZB91547.1\|438954_439557_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
CP033520.1\|AZB90014.1\|439560_439848_+\|anti-sigma-factor-antagonist	unknown	unknown	gnl\|CDD\|132914
CP033520.1\|AZB90006.1\|418089_418515_-\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90009.1\|422933_423581_+\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90016.1\|451853_452804_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|378401
CP033520.1\|AZB90002.1\|410386_411097_-\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|376478
CP033520.1\|AZB90018.1\|454331_455096_-\|flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
CP033520.1\|AZB90007.1\|420334_421132_+\|DNA-metabolism-protein	unknown	unknown	gnl\|CDD\|274851
CP033520.1\|AZB90017.1\|453806_454244_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236820
CP033520.1\|AZB90015.1\|446616_449283_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsB	unknown	unknown	gnl\|CDD\|235325
CP033520.1\|AZB90001.1\|408858_409278_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP033520.1\|AZB91548.1\|445680_446664_+\|RND-transporter	gnl\|CDD\|270388	cd13670, PBP2_TRAP_Tp0957_like, Uncharacterized substrate-binding protein of the Tripartite ATP-independent Periplasmic transporter family; the type 2 periplasmic-binding protein fold. This subfamily includes the putative periplasmic substrate-binding protein Tp0957 from Treponema pallidum, which is similar to TRAP transport systems such as SiaP (a sialic acid binding virulence factor) and TeaA (an ectoine binding protein). TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.06273e-06
CP033520.1\|AZB90013.1\|437423_438200_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	5.27286e-83
CP033520.1\|AZB90003.1\|411332_412199_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	5.14718e-54
CP033520.1\|AZB90005.1\|416410_417388_-\|glycine--tRNA-ligase-subunit-alpha	gnl\|CDD\|236473	PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated.	0
CP033520.1\|AZB90008.1\|421264_422365_+\|HPP-family-protein	gnl\|CDD\|225979	COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms].	1.77013e-100
CP033520.1\|AZB90010.1\|428119_428908_-\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	7.90118e-115
CP033520.1\|AZB90012.1\|436608_437427_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213228	cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.48792e-139
CP033520.1\|AZB91547.1\|438954_439557_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	3.00697e-40
CP033520.1\|AZB90014.1\|439560_439848_+\|anti-sigma-factor-antagonist	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	3.05088e-07
CP033520.1\|AZB90016.1\|451853_452804_-\|metal-dependent-hydrolase	gnl\|CDD\|378401	pfam10118, Metal_hydrol, Predicted metal-dependent hydrolase. Members of this family of proteins comprise various bacterial transition metal-dependent hydrolases.	1.60821e-75
CP033520.1\|AZB90002.1\|410386_411097_-\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|376478	pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase. This family contains aspartate racemase, maleate isomerases EC:5.2.1.1, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase EC:4.1.1.76.	6.97037e-62
CP033520.1\|AZB90007.1\|420334_421132_+\|DNA-metabolism-protein	gnl\|CDD\|274851	TIGR03915, putative_DNA_metabolism_protein, probable DNA metabolism protein. This model represents a conserved hypothetical protein that almost invariably pairs with an uncharacterized radical SAM protein. The pair occurs in about twenty percent of completed prokaryotic genomes. About forty percent of the members of this family occur as fusion proteins, where the C-terminal domain belongs to the uracil-DNA glycosylase family, a DNA repair family (because uracil in DNA is deamidated cytosine). The linkage by gene clustering and correlated species distribution to a radical SAM protein, and by gene fusion to a DNA repair protein family, suggests a role in DNA modification and/or repair.	7.30228e-95
CP033520.1\|AZB90017.1\|453806_454244_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|236820	PRK11014, PRK11014, HTH-type transcriptional repressor NsrR.	3.06731e-31
CP033520.1\|AZB90015.1\|446616_449283_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsB	gnl\|CDD\|235325	PRK04974, PRK04974, glycerol-3-phosphate 1-O-acyltransferase PlsB.	0
CP033520.1\|AZB90018.1\|454331_455096_-\|flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	7.64353e-89

>CP033520.1|AZB90010.1|428119_428908_-|shikimate-dehydrogenase
MTKQFAVIGNPIEQSRSPELHLAFAQKTGVDLDYQKRLAPLDGFEPSMRSFFENGGSGMNVTVPFKEQAFALCDVLTERAQIAKAVNTLWMENGKLHGDNTDGQGLVAAIQALEWKLENTTILILGAGGATRGVIYPLVQAGAKKIVIANRTLARAEQLVDDLKAAVPQAQLQAVSLNELEGKFDIVINATSASLSGDALQLPENLEFKYAYEMAYGKPSSFLDQAKQRNVPYAEGFGMLVGQAIEAFYIWNGVKPELKDFL
>CP033520.1|AZB90009.1|422933_423581_+|hypothetical-protein
MSLKWFRFLVKHVVVVAALCMTLSACDINHTNSKDHSTTSSSSNHEENLIKSSTSIKTLDYVAGRTFLPEDTSDQTQKLNAVSLQYVGRYHTRISCEDAFADCESGEAEYILNLLPNGSAYWNVVHFGRVGSKDGAKSAAVNQLCPTLNWKVDEKERELIIQCPLSKVNFYFNIDSNKRLVTNLEKLLYSDYGKNREFLEQNYFVPNQAYVLTKE
>CP033520.1|AZB90008.1|421264_422365_+|HPP-family-protein
MSVIQREWLQILKPNFKVLPLKERLLCGIGALCGLAISSLISWYVLGGINAWYIAPMGASSVLLFAVPTSPLAQPWNVIVGNTLAGIIGVACAQWIPDLTTAFSVAVGFAIFLMMTTDSLHPPSGAVAITAVLGGAAIHKLGFYFIFYPVLLNSLLLLGFAVFFNRLIGRHYPVTAHLNERSKDPTPTQKVSIQPKDIEYALGHHTELLDISQYDLEKIILEAQEHANERMVNQYICQDIMSRDVIKLHEDDDIHQALDKFKQVNLMSLPVVNAENHLVGTLALYEVVEWFKGAADPRNSWQHYVKQIMSRRVVTVLPTQPIQDLVPYFVEKSFNYIPVVEDRKLIGMISRADMIAALQQQLNRKL
>CP033520.1|AZB90007.1|420334_421132_+|DNA-metabolism-protein
MFNDEVAYYFDGSMVGLLSCVFRAFQFKELQVRLCLNDTAQHGLFADKIEVSNNEQHAERVWSALQKKLSSSSLKQFYFAYLSESLDAYQHLFNYCIYVFTSHVSVEKDYSNLSVLAIAQWTKKVGREKHRMEAFIRFKKTKDELFLSLVRPDFNVLPLIQPHFKRRYQDQRWLIYDEKRKFGLYYDLQEIHEVSLEAPEVDRNLKNGMSQSFQLELDEQEVLYDQLWKDYFNSVNITERQNIKLHVQYLPKRYWRYLNEKLMEY
>CP033520.1|AZB90006.1|418089_418515_-|hypothetical-protein
MLQYSKKMIIRALALAPIPLLSISALGIIIFNAEFSLYSVAVIFLAHFLFYLLFYGLLVIPFAYITSYFLARKNRLNLMSIFICATVIWILISPITRLIFVGSFPSPWWHIYKIYSFYLMILFTSFCYWLGLKWLSQKQIG
>CP033520.1|AZB90005.1|416410_417388_-|glycine--tRNA-ligase-subunit-alpha
MSRAISHIDTFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKDGRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTKGQFGTVTYGDVFHQNEVEQSTYNFEYAPVEKLFELFDFYESEANRLIEAKLSLPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLARAIAQSYVQARAELGFPMAEPHLRDEVLAQLKAQAESEAAKAEKN
>CP033520.1|AZB90004.1|413781_414255_-|hypothetical-protein
MNTSPIKNFYRIDAYLVLCHTLLLVIGYGLWKVYPHIKTKPDMSGLFFMIISILGGFAGLIMLAITLPRLDRSVRNLSMNKFILALLYWVSSTIIFVLFGISKFFFNNPLVLLVFVLVFFSSIYLSVIRLADMRKKDWLILSGIFGAIVLFFFLPKL
>CP033520.1|AZB90003.1|411332_412199_-|LysR-family-transcriptional-regulator
MDIAQLKMFQTVVECGTMAKASMQLHCVPSNITTRIKQLEEELGAPLFYREGKSLKLTPSGEIFLDYCHKILALCDEAKRSIHPDAPPSGPLKIGAIESSATTRLPNLLAKYHQRFPEVSIQIITGTWKQLLVDISQHKLDGAIVAGNIDFPMLNKLGIYQEDMVLIASHSLGEIHCQEDLIGKEIFMWTEGCPYRAALEEWLKLKNISLPITSITSYATIIGCVSAGSGVSLVPKSLFEQYKNLTNIRGYKFEHLAFMQNQFFWHKNVSNHKARDMFIELIKSEFIV
>CP033520.1|AZB90002.1|410386_411097_-|aspartate/glutamate-racemase-family-protein
MNKAIGILGGMGPQATIDAMNKIIKNTPAHCDQEHIPVVTVSIPDIPDRTQSIINHDDKPLEKMAEYLKILEAAQVGCIIIPCNTAHFWFNQLQKRTQTKMISIIESAVHFIQDSQIDEVCILATSATINTELYQSQFIENSIGFSTPSAEMQNKVMQSIYQYKAGNIQQAREMLNEVINFYTNKRNIKFLLACTEIPLILEESIEAYPQLFIDTTDILIKNAIAWYQNSPIAKVA
>CP033520.1|AZB90001.1|408858_409278_-|hypothetical-protein
MKTLQVLCVASSILASSTLFAETTQPQQVVETTPKTQPYGDNPSLGRVLLYKTGKGIQNLGNSIQGASEKTSNKISEKWQNTKEFTTEKAEVVQQKADTAKVFTEQKIEQAKQNITSSRNGENIPIEQGELSKSSTTAN
>CP033520.1|AZB90011.1|436308_436518_+|hypothetical-protein
MSKSKRKETIMAQLKNLLVQHGLPYLFIALVLCNGVYFAYAFITGSSIEQFQISELTSFYEHTSSISTN
>CP033520.1|AZB90012.1|436608_437427_+|ABC-transporter-ATP-binding-protein
MNNKTPLSTQPLIEVKNLSFNRGERVIYDNISLNIRRGQITAIMGPSGTGKTTLLRLIGGQLVPDQGEVLLDGKDIAKMSRQELFSARARMGMLFQSGALFTDMSVYENVAFPIRAHTKLPENLIAELVALKLESVGLRGSEQLMPTELSGGMNRRVALARAIALDPDLIMYDEPFAGQDPIVKGVLTRLIRSLREALDLTTIIVSHDVPETLSIADYIYVVAEGKIQGEGTPEELQAYASPFVRQFLTGSAEGPVEYQFSHQAYLDNEVRP
>CP033520.1|AZB90013.1|437423_438200_+|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MNTIAWLGRLVIERIRGIGVAALMLLQIVFSFPSSGGFGRFIYQMHRVGVMSLLIITVSGLFIGLVLGLQGYSILVNVGSESMLGTMVSLTLLRELAPVVAALLFAGRAGSALTAEIGSMKQSEQLASMEMIGVDPLKQIVSPRLWAGVVSLPMLTVIFAAIGIVGGKMVGVDFLGVDEGSFWSGMQNNVQFGHDVVNGIIKSIVFALLCTWIAVYQGYACDPTPEGIATAMTRTVVYSSLCVLGFDFVLTAVMFGGI
>CP033520.1|AZB91547.1|438954_439557_+|ABC-transporter-substrate-binding-protein
MIAGTAFAAPSEAPPDFIKRVADGLIARLKADHAKLQNNPALVKSIVRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQFETNFRNTLIENYGSAFAKYTNQSYTMRPYKATAGKNPVVTLDFNHNGEKIPVSFQLADKGTQWKIRNINVSGIDLGLQFRNQFAATVKRNGGDLNKAIATFQPDADAAVNQNKKEISR
>CP033520.1|AZB90014.1|439560_439848_+|anti-sigma-factor-antagonist
MVQYLNQQLVVSGKIDFENAEQQYQAGLAIIKKQQSFPLVVDLTELEHGSTLALAVLVQWLRETPKNTGLHFKNVPEKMLKIIQACHLQDDLQMI
>CP033520.1|AZB91548.1|445680_446664_+|RND-transporter
MKKICLALILSITAVASWAEDQVWCAYDPIGSQGDITRRLNDIRLYAQQYQVKFKVVTYQKEQQAIQAFDDGKCSGLAASNFNTYRYNQFMGSTAGIGLIPNNRTTKSFLQLLNHPTIEKRLISKNYEAIGMIPIGTAYMVLKNKNLSRVAQLRNQRIGVLPNNPPQQALVRSVGAQPVYVDLSNAIAQFKQNKIDIIAAPVYGLLPYNLQKEFGPDTQVINFPLAYFGVNLIIKPQAYPANFGRKIRGWFVQNSQLLTNRATQWENHLPAYYWVDVSFYEKQSYDVMVAKIRNQYVLSGYYDAYFVQLMKRLRCMDDPRYFECPIH
>CP033520.1|AZB90015.1|446616_449283_-|glycerol-3-phosphate-1-O-acyltransferase-PlsB
MSKSGFGQMYRRLSSKLLDLVVTPHVLGEVPTEPVSETTETEAKTDRQKVVCYVLQNHSRSNALVVDGETRRLNLKPALDPLIVATHQEKASVLFLQHNDENNLLNPPPHAFPPRLIKLIEVLQENPELDIELVPVTVLWGRSPDKEDSWFKLLFSDTWATPSTVKQLVNIGLHGRQSYLEFHEPQSLRELVDYAQQHYPNLSPATYIVSTLNDYLDRQREVVLGPDLSDRRNVMQSVVKSRDVQEAIRRESIRGKVSMLEAERRAIGYVNEIVSDYSHSAVRFADLALTRLWTQLYDGVEVHNFSTVRELAKDYEVVYTPCHRSHIDYLLLSYVIYKRGLMVPYIAAGDNLNLPFVGQLLRGGGAFFIRRSFRGNGLYTTVFKEYLYSILSRNTPLEYFIEGGRSRTGRLLPPKTGMLAMTVHSHLRGRAKPIVFLPTYIGYERLMEGSTYVGEMQGKPKEAESIFGIVKTLRKIERIFGKVHVNFGEPVFLDDLLKQHNAENVYIEKNDDPIPQAVSDAVNSSAHAILENINRAVVINPVSLLSIILLATPKHTLDEEICIKQLEAYRNLASNFPYDQRMEVTPLSGKEIIAYGLKLKLIKRVQHALGDIIAIEDNQAVLLTYFRNNILHAFVLPSLVASLVEHNGKISRSDLTNVIYTLYPFLKAELFLKWKSSELKAQVEQYADALVQSNLIQQDDEGNLISSAPNTEEHNQLVVLATPVKQSLERYYMTLALITQRGSGNISAKQVEELSHLLGQRLSVLYEFNSPEFFDKALFQSFLKVLTQQNYIRTNDQGQIEFDDNFRQMAAGAQLVLDEVTLQMLQHITTFTDEELKDALEAMASQQAKRRLKRKKLKVFSQNKRQLRLPFILLVNWTFKITWIVHTT
>CP033520.1|AZB90016.1|451853_452804_-|metal-dependent-hydrolase
MMKLLSFLKNKALGSSIDYKILPRKVKFDWKDTPVDWIPNQPFASYFINEINNILPAGEFWFCRLYNKVLPQIKDEKLKQDVQAFIRQEAMHANAHTSANKEYLSARNIDIQRNLDIMNYLFTTALADKPFDKEVPQFLQGQWDLFRLGVIATVEHMTCVLGKYALYNKRWEELGADPEMVDLVKWHGSEEIEHRTVAFDLYRHLGGGYIPRYYLSLAVIVLVLGLWVDGAAHIMKQDPRFADAAKSRFFPVWVAVEWYKISRKDNQVLPNPIWLIAQQIDYLMPWYDPVKEGSTEDAVSYLSQSPAAKRAELQAA
>CP033520.1|AZB90017.1|453806_454244_-|Rrf2-family-transcriptional-regulator
MQLNKFTDYALRLLMYVARPSDAPYTIAEIAKDLHVSQNHLVKVVHFMGKQEWIITIRGKGGGIRLNPDALNSNLGSIVRILQGDNQIVECNTPPCVLRSHCGLKGILDQALESFYQSLDQYTLGEVLQQSKSAPANSPIAFLQI
>CP033520.1|AZB90018.1|454331_455096_-|flavohemoprotein
MTPQQIELVKSTVPVLREHGVTLTTYFYKRMLNNNPELKNVFNLDDQTSLRQPRALAAAVLAYAENIENPTVLAKAVERITTKHVSLDIQPDQYAIVGDNLLHSISEVLNVPFESELIEAWKQAYLQLADILIGVEKQKYEQLESLKGGWAGWRSFEITQIDPLESGKRFTLKATDHEDVLTSPANAFISVKVQVPEQQLEQPKAFKFTEAQEDNSYHFEVQPEENHTEFSVANILLEHYRVGDQVQVSAPLTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033520_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033520_2

1897491-1897591

Orphan

Consensus_repeat	Method
AAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033520_2

>merge|CP033520|2|1897491-1897591|CRISPRCasFinder
AAAGCGTTGCTTTACTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCATCTCAGGGTAAAGCGTTGCTTTACTTATCCTC

>CP033520|2|2|1897491-1897591|CRISPRCasFinder
AAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCATCTCAGGGT
AAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP033520.1\|AZB90629.1\|1887953_1890161_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
CP033520.1\|AZB90628.1\|1886476_1887895_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
CP033520.1\|AZB90625.1\|1881769_1882942_+\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
CP033520.1\|AZB90642.1\|1910792_1911932_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|183114
CP033520.1\|AZB90631.1\|1894535_1895471_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP033520.1\|AZB90624.1\|1879535_1880177_+\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
CP033520.1\|AZB90638.1\|1905751_1907290_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP033520.1\|AZB90640.1\|1908324_1909287_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP033520.1\|AZB90632.1\|1896598_1897390_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP033520.1\|AZB91612.1\|1885559_1885781_-\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90627.1\|1885891_1886074_-\|hypothetical-protein	unknown	unknown	unknown
CP033520.1\|AZB90635.1\|1902437_1903496_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP033520.1\|AZB90626.1\|1882988_1883816_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033520.1\|AZB90634.1\|1899248_1899896_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP033520.1\|AZB90637.1\|1904337_1905741_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP033520.1\|AZB90639.1\|1907291_1908311_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP033520.1\|AZB90630.1\|1892148_1893495_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
CP033520.1\|AZB90636.1\|1903525_1904311_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
CP033520.1\|AZB90641.1\|1909649_1910636_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP033520.1\|AZB90643.1\|1911981_1912734_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634

Protein	Function_ID	Function_description	E-value
CP033520.1\|AZB90629.1\|1887953_1890161_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	2.03331e-104
CP033520.1\|AZB90628.1\|1886476_1887895_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
CP033520.1\|AZB90635.1\|1902437_1903496_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	1.425e-180
CP033520.1\|AZB90642.1\|1910792_1911932_+\|transcriptional-regulator	gnl\|CDD\|183114	PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional.	1.1581e-09
CP033520.1\|AZB90631.1\|1894535_1895471_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	3.38147e-14
CP033520.1\|AZB90624.1\|1879535_1880177_+\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	3.62827e-124
CP033520.1\|AZB90638.1\|1905751_1907290_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	4.19573e-112
CP033520.1\|AZB90640.1\|1908324_1909287_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.05614e-132
CP033520.1\|AZB90632.1\|1896598_1897390_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.0987e-22
CP033520.1\|AZB90641.1\|1909649_1910636_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP033520.1\|AZB90626.1\|1882988_1883816_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.04881e-83
CP033520.1\|AZB90634.1\|1899248_1899896_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.81261e-78
CP033520.1\|AZB90637.1\|1904337_1905741_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP033520.1\|AZB90639.1\|1907291_1908311_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	7.65284e-168
CP033520.1\|AZB90630.1\|1892148_1893495_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	7.54456e-59
CP033520.1\|AZB90636.1\|1903525_1904311_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.24848e-115
CP033520.1\|AZB90625.1\|1881769_1882942_+\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
CP033520.1\|AZB90643.1\|1911981_1912734_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	7.03466e-18

>CP033520.1|AZB90632.1|1896598_1897390_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPAGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>CP033520.1|AZB90631.1|1894535_1895471_+|DMT-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAAILGLIGIVLLFWHDLINSQFNTQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLSLALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYIWTLNAVFGILLILLGNYLMFSKLEIGKKLFNSQKVVRSRHKSLLFL
>CP033520.1|AZB90630.1|1892148_1893495_+|chromate-efflux-transporter
MENEKSPLPESIIQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWIVAIAAFFAIFVLKLPFPLIVLSAGIAGYLASKKYPELFSSAAGHKASQKDYGPAFIDDETPTPEHAKFHWLRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDVIAALITVAAFIALFRFNVNVLYVIFASALVGLGVYLL
>CP033520.1|AZB90629.1|1887953_1890161_-|TonB-dependent-siderophore-receptor
MHGMAGSYSMERRSLNLHFMTCSKTALASSIVLITSVVYANEAEVSQLPTITVNATQNHDALYTSKKVNLSGFQTGDVKKVPASITTITSERIADQHAKTLTDVIKNDSSLGDGYAAIGYYPNFVARGFALDLGSSYLINGHNIRGEQNVALENKEQVEILKGISAIQSGMSTPGGVVNYVTKRPADVKNITVDANSEGGYTLATDVGGFVNDSFGYRINLAHESIHPNVDHANGKREFGSVALDWKINDRSKLLFDIEAQHQSQRSVPGYQLLDGQEVPTNVDQDRLLGYQSWSKPVVNNSVNASLKYQYAFNDQWNASLSASQSRVVIDDYSAFPWACYSDGVCQNNTFDKDGNYGIYDFRSPDDTRITNQFSAGLNGQFSTGIIQHQIAFEIQHTYKTLKRYNSNSMELDPIGLGNIYEETKDYEPAQIDLRNYYKALESDQTAFTISDRVQFNDQWSTLLGGKLIHLDEQAYNSDGQQSRDTDLNKFLPQLALMYSPTATTNLYASYAKGLSDGGEAPWYAEANAYQVLSPRNSEQYELGVKKQIRNFLLTAAIFDLKQDNQYTTTNSEGKLEFVEQGEQHNQGIELGLTGALTDTVDVSSGITYTKSRLVDIESDSYKGHQTQNVPKVRATAQLSYKVPSVEGLRLLSGMQYSSSKYANKEGTAKVGGYSVFNIGAAYKTSFAGHDTTFRFNIDNLFNKKYWRDVGAFMGDDYLFLGNPRTAQFSTTFSF
>CP033520.1|AZB90628.1|1886476_1887895_+|aspartate-ammonia-lyase
MMNAEITTRIEKDLIGYREINNNDYYGVQTLRALENFNLTQSKVGNFPHLIKALAMVKLACAEANYNLKSLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHAKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFRNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALAKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQIKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQVLDDILSINNMVKPKMSA
>CP033520.1|AZB90627.1|1885891_1886074_-|hypothetical-protein
MLKVTAALIILGSFTYYVLFHGEEKSESKTSRLLKEAEQSIASAETSVNKANSIVPISYK
>CP033520.1|AZB91612.1|1885559_1885781_-|hypothetical-protein
MKFIAYDPNSGEKLSLKEHIHHMDKYTTYIFFSDENDNMVFNPQKKQVFEITQYTSNMMVEISRKLYYLIGEY
>CP033520.1|AZB90626.1|1882988_1883816_-|LysR-family-transcriptional-regulator
MAADAIGLTQPSVSNGLNKIRQHFNDPLFIRVGNEMIPTELAKEIFPLISEVIDKVESINNFSVNFDPLTSDQLFTIAMTDVSHLVLLPQLTNYLKEKAPLIRLNIRPITPETSYQMANGEIDLAIGFLPQLEEGFYQQKFFKQHYVVISSKSHPRLDPNNFTLDDYMREYHIDIDAGIGHYHIKNELQNKGLDRNILIRLPSYLGVGLVVQETDAIATVPYYLSQVLLVRENLQILPAPLDFPTYDVKQHWHMSCHHKSSHKWFRQTCYELFKV
>CP033520.1|AZB90625.1|1881769_1882942_+|thiolase-family-protein
MSSIVIVSGSRTAMGGFQGSLSALTAPELGAAVIRESIQRAGIAPEQVDEVIFGCVLSAGIGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTNAPYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDNFAISSLKKAQTAITEGYFKEEIVPVEVKTRKGVEIIDQDEQPLKANLEKIPTLRPAFSKDGTITAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIIATSTHSQHPSEFTIAPISAIQKVLERAGWCVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNIHGGACALGHPIGATGSRIILSLIYALKRLGKKKGVAALCIGGGEATAVAIEI
>CP033520.1|AZB90624.1|1879535_1880177_+|CoA-transferase-subunit-B
MAWSRNEMAQRAAKELEDGFYVNLGIGLPTLVANYIPENINVWLQSENGLLGIGEFPTEETVDADLINAGKQTVTARPGAAFFSSSESFAMIRGGHVNIAILGAMEVSENGDLANWMIPGKKVKGMGGAMDLVVGVQKVVVLMEHCAKDGTPKIVKNCSLPLTGKGVVHRVITDLGVMDITPQGVELIELAKDVTLEQIQAATGVEFYKTLVA
>CP033520.1|AZB90634.1|1899248_1899896_-|MBL-fold-metallo-hydrolase
MFGCEETREAVLIDPVASDIEIYTKELEQHQFTLIYTLDTHVHADHITAANLLRELLDCKSVLHRNSDVSCGDILITDGCMLKVGNLSIEARYTPGHTNACTSYLVENMVFTGDALLIDGCGRTDFQQGSAGTLYDSIHKQLFSLPDDTIVYPGHDYKGRFSSTIGYERLNNSRLGQNRSREDFIELMNNLNLPYPKQIDKALPANQACGSISQL
>CP033520.1|AZB90635.1|1902437_1903496_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGIDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP033520.1|AZB90636.1|1903525_1904311_-|acetoin-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYSAINHAEQTFGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP033520.1|AZB90637.1|1904337_1905741_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAKEKIAVTDAQGNSQDLSAPHIILATGAKARHVSQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIENEQVHCVVETASDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVIHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP033520.1|AZB90638.1|1905751_1907290_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIALCAEGQVSDAEIEQFIASLGGSAAKAPEAPSEQSKAETSAPVAEKAEQPQSVAASAPVPVKTAKGDYAVPESLQGYQVSNELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVRAAGGQWPDIKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQSAQCAVAQPQSIITTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP033520.1|AZB90639.1|1907291_1908311_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEDNELEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALVAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP033520.1|AZB90640.1|1908324_1909287_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDASSKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP033520.1|AZB90641.1|1909649_1910636_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEIKHIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVANLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYEHSLNLLKRFKKYCPDIKTKCGLMVGLGEIEAEVIALLNDLKDHDVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTQHGQRLGFKNIWSAPMVRSSYFADRQYFGEEVPKPFRRQDVLS
>CP033520.1|AZB90642.1|1910792_1911932_+|transcriptional-regulator
MDMSEQLSSPLIDTTPSLFRPESSSHSKQLGKKPSLDLEAAPLFDLGEEWEHSLFGRSIHECHRNLMHIAEDADMAIGVTDPHGTLLWTWSSHPMRSSAEQVHFVEGGQWSTQAVGQNAIGLALNTHSASCVYSHENQMNSVRDWVCYAAPITDANTGQFYGIMNLSTKYQKHNSLGILAVERCADIVKQAIQLHQKNILYIKALGTPKVQYNQHGLTLTQRQIEILCILALCPEGINLEELHYALYGDRPVSTTTLKAELSQLRNLIPDVIESRPYRLNCEIQCDFLMAEQALNLGFTSTTLTLYRGSFLAKSESPFLCAWRDCFDARLSHVIYQIKDIDQLLRVVSRVPDRVDAVERLLELLPEEIPYRTKLLKLLE
>CP033520.1|AZB90643.1|1911981_1912734_-|iron-containing-redox-enzyme-family-protein
MTALNQYGMNLEITPHNEWSQRFWDDLLPAKERVSKHPFFTEMANGGLSLDSFRYALLNFYPLVAHFPSYMAGALGKATGFSEPGVTEARDWLIQNIKVEERHLKWYRDWAGGFGLTVEELDHVRPPVAMNAVNHFLWNMSHRGNLAECLAATNLAIEWATGDWSIQVYKGIHTYTDHPEVTIDKRSLAWLRAHAHYDDLHPYEAMELIKRLCNDRPDWQQKAFHAAEEGLRYYELALDDCYKVQLKASA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP033520_1	1.3\|435726\|33\|CP033520\|CRISPRCasFinder	435726-435758	33	CP033520.1	435783-435815	2	0.939

1. spacer 1.3|435726|33|CP033520|CRISPRCasFinder matches to position: 435783-435815, mismatch: 2, identity: 0.939

gagttcaattcagatcgcccacgtcgtgaaggt	CRISPR spacer
gagttcaattcagatcgtccgcgtcgtgaaggt	Protospacer
*****************.**.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2560382 : 2597851

Acinetobacter_phage(75.68%)

terminase,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB90948.1\|2560382_2561063_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
AZB90949.1\|2561162_2561567_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
AZB90950.1\|2561659_2561842_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	8.2e-28	98.3
AZB91635.1\|2561910_2562240_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	3.1e-25	57.0
AZB90951.1\|2562167_2562683_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	3.1e-72	98.5
AZB90952.1\|2562754_2563672_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.0e-166	97.4
AZB90953.1\|2564874_2565228_-	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	6.2e-56	92.3
AZB90954.1\|2565309_2565603_-	hypothetical protein	A0A2H4J762	uncultured_Caudovirales_phage	6.4e-06	38.0
AZB90955.1\|2565641_2566040_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	7.8e-55	75.0
AZB90956.1\|2567597_2567966_-	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	1.7e-64	98.4
AZB90957.1\|2567952_2568345_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	1.1e-50	82.4
AZB90958.1\|2568348_2568684_-	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	5.7e-51	96.4
AZB90959.1\|2568727_2569678_-	methyltransferase	A0A0P0HSG2	Acinetobacter_phage	8.9e-174	95.6
AZB90960.1\|2569691_2570447_-	hypothetical protein	A0A0P0J090	Acinetobacter_phage	5.5e-126	97.6
AZB90961.1\|2570556_2571108_-	hypothetical protein	A0A2I7RHW2	Vibrio_phage	1.1e-17	66.7
AZB90962.1\|2571231_2571456_-	hypothetical protein	NA	NA	NA	NA
AZB90963.1\|2571468_2571705_-	hypothetical protein	A0A0D4DC19	Acinetobacter_phage	3.1e-35	91.0
AZB90964.1\|2571803_2572232_-	hypothetical protein	A0A0D4DBV9	Acinetobacter_phage	2.6e-72	99.3
AZB90965.1\|2572240_2573347_-\|head	phage head morphogenesis protein	A0A0P0IR98	Acinetobacter_phage	5.1e-197	94.0
AZB90966.1\|2574738_2575980_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.2e-204	85.7
AZB90967.1\|2577161_2577608_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.9e-73	93.0
AZB90968.1\|2577668_2578124_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.7e-80	95.4
AZB90969.1\|2580042_2580297_-	hypothetical protein	NA	NA	NA	NA
AZB90970.1\|2580268_2580745_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
AZB90971.1\|2581144_2581258_-	putative phage replication protein	A0A0D4DCC7	Acinetobacter_phage	3.4e-08	81.1
AZB90972.1\|2581254_2582025_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	7.0e-145	98.0
AZB90973.1\|2583314_2583611_-	hypothetical protein	J7HXM0	Acinetobacter_phage	8.3e-46	94.9
AZB90974.1\|2583607_2583883_-	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	8.3e-40	96.7
AZB90975.1\|2583937_2584294_-	transcriptional regulator	J7I452	Acinetobacter_phage	8.8e-58	98.3
AZB90976.1\|2584577_2585348_+	LexA family transcriptional regulator	J7I4M9	Acinetobacter_phage	1.0e-103	78.8
AZB90977.1\|2585784_2586288_+	hypothetical protein	NA	NA	NA	NA
AZB90978.1\|2586284_2586764_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZB90979.1\|2586774_2587137_+	hypothetical protein	NA	NA	NA	NA
AZB90980.1\|2587343_2587784_+	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	7.7e-72	95.2
AZB90981.1\|2588120_2588888_+	hypothetical protein	I3PUZ3	Vibrio_phage	2.9e-05	28.7
AZB90982.1\|2589868_2590126_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	5.6e-38	100.0
AZB90983.1\|2590521_2590731_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	6.3e-32	94.2
AZB90984.1\|2591016_2591274_+	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	4.4e-43	91.7
AZB90985.1\|2591275_2591491_+	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
AZB90986.1\|2593228_2593483_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
AZB90987.1\|2593549_2594116_-	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	1.3e-26	43.3
AZB90988.1\|2594186_2594627_-	hypothetical protein	NA	NA	NA	NA
AZB90989.1\|2594816_2595374_+	cytochrome b	NA	NA	NA	NA
AZB90990.1\|2596531_2597851_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.1e-60	36.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033520

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection